FR2862659A1 - New genome of Legionella pneumophila Paris strain and derived polypeptides, useful for detection or identification of the strain and for treatment and prevention of infections - Google Patents

Abstract

Isolated or purified nucleotide sequences (I) from Legionella pneumophilaParis strain, that: (a) is any of 56 sequences (not reproduced but available from the French Patent Office); (b) has at least 80% sequence identity with (a); (c) hybridizes under stringent conditions to (a); (d) is the complement of (a)-(c), or is the corresponding RNA; or (e) comprises at least 15 nucleotides from (a). Independent claims are also included for the following: (1) nucleotide sequences (Ia) that include a sequence (Ib) encoding any of 3399 polypeptides (II), also sequences related to (Ib) in the same way that (b)-(e) are related to (a) above; (2) polypeptides (II) encodes by (I) or (Ia); (3) polypeptide (IIa) that comprises (II), or sequences with at least 80% identity or biologically active fragments with at least 5 amino acids; (4) nucleotide sequences (Ic) that encode (IIa); (5) DNA chip or filter that includes, as primer or probe, at least one (I), of (b)-(e), (Ia) or (Ic); (6) kit for detecting/identifying Legionella, at the level of genus, species or strain, containing the chip or filter of (5) or any of the sequences present on the chip or filter; (7) cloning and/or expression vector containing a (I), of (b)-(e), (Ia) or (Ic); (8) host cell transformed with the vector of (7); (9) plant or non-human animal containing a cell of (8); (10) method for preparing a polypeptide (PP) by culturing cells transformed by the vector of (7); (11) recombinant PP prepared by method (10); (12) preparation of (II) or (IIa) by chemical synthesis; (13) hybrid polypeptide (hPP) containing (i) at least one (II) or (IIa) that is a surface polypeptide of L. pneumophilaand (ii) the sequence of a polypeptide (III) able to induce an immune response in a human or animal; (14) nucleic acid sequence (Id) that encodes hPP; (15) vector containing (Id); (16) mono- or poly-clonal antibodies (Ab), or their fragments, or chimeric antibodies able to recognize specifically (II) or (IIa); (17) method for detecting/identifying Legionella, at the level of genus, species or strain, by using Ab and detecting any complex formed; (18) method for detecting and/or quantifying expression of a specific gene in Legionellaby using Ab and detecting any complex formed; (19) kit for performing methods (17) and (18); (20) protein chip that contains at least one of the new polypeptides or Ab, immobilized on a support; (21) kit for detecting/identifying Legionella, at the level of genus, species or strain, containing the chip of (20); (22) method for detecting/identifying Legionella, at the level of genus, species or strain, by using any of the new nucleotide sequences; (23) kit for detecting/identifying Legionella, at the level of genus, species or strain, that includes the primer/probe of (6), optionally also reagents for performing hybridization or amplification assays; (24) method for selecting a compound that inhibits expression of genes implicated in biosynthesis of envelope polysaccharides in L. pneumophilaParis strain; (25) vaccinating or immunogenic composition that contains (a) (II) or (IIa) that are surface proteins of L. pneumophilaParis strain or hPP or (b) a vector of (7) or (15); (26) genomic DNA bank from L. pneumophilaParis strain, deposited as CNCM I-3138; and (27) method for isolating selected polynucleotides by using the bank of (26). ACTIVITY : Antibacterial. No details of tests for antibacterial activity are given. MECHANISM OF ACTION : Vaccine; inhibiting expression of genes involved in synthesis of surface polysaccharides.

Description

The subject of the invention is the genomic sequence and sequences

  nucleotides encoding Legionella pneumophila Paris strain polypeptides, such as cell surface polypeptides, especially specific to the Philadelphia strain, or involved in virulence or biosynthesis of polysaccharides

  of cell envelope, as well as vectors including said sequences and cells transformed with these vectors. The invention also relates to methods for detecting such nucleic acids or polypeptides and kits for diagnosing or typing Legionella bacteria, especially Legionella pneumophila, such as the Paris strain versus the Philadelphia strain. The invention also relates to a method for selecting compounds capable of modulating the biosynthesis of these cell envelope polysaccharides using said nucleotide sequences or said polypeptides. The invention finally comprises pharmaceutical compositions, especially vaccine, for the prevention and / or treatment of bacterial infections, in particular by Legionella pneumophila strain Paris.

  Legionella is an environmental bacterium responsible for legionellosis and Pontiac fever. Epidemiological data indicate that probably only some isolates are capable of provoking clinical cases. The species L. pneumophila appears to have greater virulence than other species, being responsible for 90% of cases of legionellosis. Among this group of 15 serogroups, serogroup 1 isolates are associated with 80% of cases.

  To date, no human-to-human transmission has been observed and legionella prevention measures therefore focus on the elimination of this pathogen from water circuits or air-cooled towers of air conditioning systems. In order to put in place a rational prevention policy, it is necessary to predict the risk associated with each strain. In this regard, it would be desirable to have methods or diagnostic kits based on the recognition of specific protein or nucleic acid of this legio pathogenic species species or of a particular strain (or subspecies) thereof. species.

  Indeed, the interest of the use of these specific sequences in the field of diagnosis or epidemiology, is based on the possibility of analyzing at the same time and very quickly a large number of sequences, for: - classification or the typing of bacteria according to the presence of a sequence or sequence profile characteristic of a genus, species or strain (subspecies) of bacteria, this, in particular, in association with gravity or not pathologies that such bacteria can induce in case of infection in mammals, especially in humans; and the simultaneous comparison of sequence or sequence profile between different genera, species or strain (subspecies) of bacteria, pathogenic or non-pathogenic, making it possible in particular to identify a gene, or the corresponding protein sequence, or a gene profile whose presence and / or expression in a bacterium is specific to a genus, species or strain of bacteria, and / or its pathogenicity or not, this, in particular, using tools such as microarray chips, DNA or, where appropriate, protein, on which are immobilized these specific sequences.

  These specific sequences may be specific sequences of the genus Legionella, or of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or of a bacterium of the species Legionella pneumophila strain Paris, or else specific for a bacterium of the species Legionella pneumophila strain Paris compared to the Philadelphia strain, This information is greatly useful in particular to quickly identify the presence or absence of a pathogenic bacterium, the severity of the infection it can cause, the treatment adapted to an infection, and / or the need and the means to be used to decontaminate contaminated or contaminated objects, circuits or fluids. This information will also be greatly useful for epidemiological studies relating to this kind of bacteria.

  This is precisely one of the aspects of the present invention.

  In a first step, the inventors have studied and try to understand the genomic diversity within the genus Legionella by complete sequencing of the strain L. pneumophila serogroup 1, strain Paris found in various French departments (2) and the low level sequencing of cover of two strains not belonging to the species L. pneumophila. The selected strains are L. longbeachae, responsible for cases of legionellosis mainly in Australia and L. anisa frequently found in water circuits but not found in patients.

  The inventors have, during this study, highlighted variable genes found between the Legionella strains, as well as conserved genes having a functional link with wall or cell envelope, or the virulence of L. pneumophila, which genes will be able to be used for carrying out these methods or diagnostic kits, in particular for making protein or DNA biochips.

  A large number of isolates of various origins isolated from the environment or from clinical cases can be analyzed using these tools to identify markers to discriminate between the two categories of strains.

  This approach will also identify new functions required for the virulence of Legionella in humans and help to understand the different stages of this disease.

  The invention therefore aims to allow the development of new tools for the typing of Legionella strains. These tools could be of the protein or DNA / RNA biochip type. The new features of these typing tools will be: speed and ease of use; - high discriminating power between strains; and - possibility to provide information on the genomic content of the strain analyzed and possibly to predict the risk associated with Legionella contamination.

  The inventors firstly sequenced the complete genome of L. pneumophila strain Paris in the form of 56 contigs (SEQ ID No. 1 to 56), a sequence consisting of a chromosome approximately 3.65 Mb long and a plasmid about 36 kb long. The inventors have also identified on these contigs (SEQ ID No. 1 to 56) the nucleic sequences coding for proteins with their respective function (see Tables I and II with the annotated sequences). The inventors have further compared these sequences with the genome sequences of L. pneumophila Philadelphia strain available at http://genome3.cpmc.columbia.edu/ legion / index. html. and highlighted their presence or not in the sequences of this strain Philadelphia. The genome sequences of L. pneumophila Philadelphia strain available at the site http: //genome3.cpmc.columbia.edul4egion/index.html correspond to the sequences of the 51 contigs identified in the sequence list under SEQ ID Nos. This comparison, made from the available genomic sequence of L. pneumophila Philadelphia strain and protein sequences obtained by the inventors from the 6 possible reading frames, revealed that about 88% of these two genomes are very strongly conserved (95 to 100% protein identity), the remaining 12% being specific to each strain (see Tables I, II and IV). These results show that there is a large genomic diversity within L. pneumophila species. Among the genes specific to the Paris strain, an autotransporter serine protease homolog has been identified in which about ten tandem repeats of a 60 amino acid motif are inserted. Autotransporters are secretory systems for gram-negative bacteria in which the N-terminal and terminal parts respectively allow secretion through the inner membrane and pore formation in the outer membrane. The central part of the protein can then remain exposed at the cell surface or be cleaved and released into the external medium. The role of some autotransporters in the virulence of Gram-negative bacteria has already been demonstrated; Moreover, work on autotransporters of enterobacteria has identified a serine protease group present only in pathogenic bacteria whose diversity of functions could be related to adaptation to the niche occupied by the pathogen.

  In addition, the inventors have demonstrated a very great interspecies diversity from the sequencing of a pathogenic strain of L. longbeachae, which causes very few cases of legionellosis in France but which is the major source of legionellosis in Australia. , and that of a nonpathogenic L. anisa strain. To date, we have been able to identify 703 ORFs of the L. longbeachae strain, 53% of which are specific to it; the majority of ORFs conserved between L. longbeachae and L. pneumophila Paris have a protein homology percentage greater than 80%. The preliminary results obtained by the inventors on the non-pathogenic L. anisa strain made it possible to identify 54% of specific sequences and a percentage of protein homology greater than 70% for the sequences conserved between the L. anisa and L. pneumophila strains. Paris.

  Tables I and II (bestblast obtained for each of the nucleic and protein sequences corresponding to the annotated ORFs) below comprise, for each of the ORFs identified in the Paris strain, its position on the contigs, the existence of a signal peptide, the best blast result on nrprot (Best-Blastp). The ORFs specific to the L. pneumophila Paris strain with respect to the L. pneumophila Philadelphia strain were identified by considering as specific the ORFs having a percentage of protein identity lower than 75%. In the case where the ORF is conserved in both genomes, the percentage identity between the two proteins is mentioned.

  In this Table I, the ORFs present in the partial sequence of the L. longbeachae strain were also noted. Finally, Legionella-specific ORFs were identified by considering as specific the ORFs having a percentage of protein identity with nprotot sequences less than 25%.

  In conclusion, the diversity revealed by the content of the present patent application makes it possible to define protein probes, such as antibodies, or DNA probes to develop a typing tool. The use of this tool on a large number of strains isolated from patients and strains isolated from the environment will validate this tool, a tool that will predict strain-related risk by clearly discriminating strains isolated from patients. other strains.

  Among the important families of proteins of Legionella pneumophila strain Paris, there may be mentioned the family of surface proteins or that of the proteins involved in the biosynthesis of surface polysaccharides, or that of the proteins involved in the virulence of these bacteria. The evolutionary processes have allowed the development of a number of unique mechanisms on Gram + bacteria, by which they can immobilize proteins on their surface. The functions of these different cell wall proteins are extremely diverse. However, many proteins that are covalently bound to the surface of Gram + pathogens are thought to be important for the survival of the pathogen within the infected host. The study of Legionella pneumophila strain Paris requires new approaches, especially genetic, to improve the understanding of the different metabolic pathways of this organism.

  Thus, it is an object of the present invention to disclose the complete genome sequence of Legionella pneumophila strain Paris (Collection of Pasteur Institute CIP 107-629-T), a sequence obtained from a collection of clones ( BAC) filed on November 19, 2003 at the National Collection of Cultures of Microorganisms (CNCM), 25 rue du Docteur Roux, 75724 Paris Cedex 15, France, according to the provisions of the Budapest Treaty and registered under the deposit number I-3137, as well as all the genes contained in this genome.

  Indeed, the knowledge of the genome of this organism makes it possible to better define the interactions between the different genes, the different proteins, and hence the different metabolic pathways. Indeed, and contrary to the disclosure of isolated sequences, the complete genomic sequence of an organism forms a whole, making it possible to immediately obtain all the information necessary for this organism to grow and function.

  If the present invention provides the nucleotide sequence of the genome of Legionella pneumophila strain Paris (Collection Pasteur Institute CIP 107-629-T), having been the subject of a deposit of a collection of clones (BAC) covering this genome at the CNCM in Paris on November 19, 2003 and registered under the deposit number I-3138, and also certain polypeptide sequences, the skilled person can determine the other ORFs, using known methods, and appropriate software.

  In the set of claims below, it will be possible in particular to replace the term nucleotide sequence by the term polynucleotide without modifying the object and scope of the set of claims as filed.

  The present invention therefore relates to a genomic nucleotide sequence of Legionella pneumophila strain Paris characterized in that it is chosen from the sequence SEQ ID N 55 and among the sequences SEQ ID SEQ ID N 1 to SEQ ID N 54, and SEQ ID N 56 .

  The present invention also relates to an isolated or purified nucleotide sequence of Legionella pneumophila strain Paris, characterized in that it is chosen from: a) a nucleotide sequence comprising at least one sequence having 80% identity with SEQ ID N 1 to SEQ ID N 56; b) a nucleotide sequence hybridizing under conditions of high stringency with SEQ ID N 1 to SEQ ID N 56; c) a nucleotide sequence complementary to SEQ ID No. 1 to SEQ ID No. 56 or complementary to a nucleotide sequence as defined in a) or b), or a nucleotide sequence of the corresponding RNA; and d) a nucleotide sequence of at least 15 nucleotides of fragment representative of SEQ ID N 1 to SEQ ID N 56, or fragment representative of their sequence.

  More particularly, the subject of the present invention is also the nucleotide sequences characterized in that they are derived from SEQ ID N 1 to SEQ ID N 56 and in that they encode a polypeptide chosen from the polypeptides of sequence SEQ ID N 56 to SEQ ID N 3455, preferably coding for a polypeptide present on the surface of Legionella pneumophila strain Paris of sequence SEQ ID Nos. 3410, 704, 746, 2267, 2751, 3192, 3218, 3221, 3222, 3317, 3324, 136, 171, 310, 337, 481, 527, 652, 664, 893, 972, 1148, 1298, 1361, 1503, 1521. , 1576, 1651, 1755, 1847, 1877, 2224, 2406, 2843, 2930, 3037, 3139, 3157, 3165, 3181, preferably coding for a polypeptide present at the specific surface of Legionella pneumophila strain Paris relative to the strain. Philadelphia, in particular of sequence SEQ ID Ns 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or one of its representative fragments of at least 5 amino acids, or coding for a polypeptide involved in the biosynthesis of cell envelope polyssacharides SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411, or the nucleic sequences of the rtxA gene, in particular those coding for the polypeptides of sequences SEQ ID nos. 3410, 3037, 3165 and 3181.

  The present invention also relates more generally to the nucleotide sequences derived from SEQ ID N 1 to SEQ ID N 56, and coding for a Legionella pneumophila strain strain Paris, such that they can be isolated from these sequences SEQ ID N 1 at SEQ ID N 56.

  In addition, the nucleotide sequences characterized in that they comprise a nucleotide sequence chosen from: a) a nucleotide sequence coding for a polypeptide chosen from the sequences SEQ ID N 56 to SEQ ID N 3455; b) a nucleotide sequence comprising at least 80%, 85%, 90%, 95% or 98% identity with a nucleotide sequence coding for a polypeptide selected from the sequences SEQ ID N 56 to SEQ ID N 3455; c) a nucleotide sequence hybridizing under conditions of high stringency with a nucleotide sequence coding for a polypeptide selected from the sequences SEQ ID N 56 to SEQ ID N 3455; d) a complementary nucleotide sequence or RNA corresponding to a sequence as defined in a), b) or c); e) a representative fragment nucleotide sequence having at least 15 nucleotides of a sequence as defined in a) or d); and f) a modified nucleotide sequence of a sequence as defined in a), d) or e), are also objects of the invention.

  By nucleic acid, nucleic or nucleic acid sequence, polynucleotide, oligonucleotide, polynucleotide sequence, nucleotide sequence, terms which will be used indifferently in the present description, is meant to designate a precise sequence of nucleotides, modified or otherwise, to define a fragment or a region of a nucleic acid, with or without unnatural nucleotides, and which may correspond to both a double-stranded DNA, a single-stranded DNA and transcripts of said DNAs. Thus, the nucleic sequences according to the invention also include PNAs (Peptid Nucleic Acid), or the like.

  It should be understood that the present invention does not relate to nucleotide sequences in their natural chromosomal environment, i.e., in the natural state. These are sequences that have been isolated and / or purified, that is to say that they were taken directly or indirectly, for example by copy, their environment having been at least partially modified. It is thus also intended to designate the nucleic acids obtained by chemical synthesis.

  By percentage identity between two nucleic acid or amino acid sequences in the sense of the present invention, it is meant to designate a percentage of nucleotides or identical amino acid residues between the two sequences to be compared, obtained after the best alignment, this percentage being purely statistical and the differences between the two sequences being randomly distributed over their entire length. By "best alignment" or "optimal alignment" is meant the alignment for which the percentage of identity determined as hereinafter is the highest. Sequence comparisons between two nucleic acid or amino acid sequences are traditionally performed by comparing these sequences after optimally aligning them, said comparison being made by segment or comparison window to identify and compare the local regions of the sequence. sequence similarity. The optimal alignment of the sequences for the comparison can be realized, besides manually, by means of the local homology algorithm of Smith and Waterman (1981, Ad App Math 2: 482), by means of the algorithm Local homology of Neddleman and Wunsch (1970, J. Mol Biol 48: 443), using the similarity search method of Pearson and Lipman (1988, Proc Natl Acad Sci USA 85: 2444). ), using computer software using these algorithms (GAP, BESTFIT, BLAST P, BLAST N, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI). In order to obtain the optimal alignment, the BLAST program is preferably used with the BLOSUM 62 matrix. The PAM or PAM250 matrices can also be used.

  The percentage identity between two nucleic acid or amino acid sequences is determined by comparing these two optimally aligned sequences in which the nucleic acid or amino acid sequence to be compared may comprise additions or deletions. relative to the reference sequence for optimal alignment between these two sequences. The percent identity is calculated by determining the number of identical positions for which the nucleotide or amino acid residue is identical between the two sequences, dividing this number of identical positions by the total number of positions compared and multiplying the number of identical positions. result obtained by 100 to obtain the percentage of identity between these two sequences.

  By nucleic sequences having an identity percentage of at least 80%, preferably 85% or 90%, more preferably 95% or even 98% or 99%, after optimal alignment with a reference sequence, it is intended to designate the nucleic sequences having, with respect to the reference nucleic sequence, certain modifications such as, in particular, a deletion, a truncation, an elongation, a chimeric fusion and / or a substitution, in particular one-off, and whose nucleic sequence has at least 80%, preferably 85%, 90%, 95%, 98% or 99% identity after optimal alignment with the reference nucleic sequence. These are preferably sequences whose complementary sequences are likely to hybridize specifically with the reference sequences. Preferably, the specific hybridization conditions or high stringency will be such that they provide at least 80%, preferably 85%, 90%, 95%, 98% or 99% identity after optimal alignment between one of the two sequences and the complementary sequence of the other.

  Hybridization under high stringency conditions means that the temperature and ionic strength conditions are chosen such that they allow the maintenance of hybridization between two complementary DNA fragments. As an illustration, conditions of high stringency of the hybridization step for the purpose of defining the polynucleotide fragments described above are advantageously as follows.

  DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1) prehybridization at 42 ° C. for 3 hours in phosphate buffer (20 mM, pH 7.5) containing 5 × SSC (1 × SSC corresponds to a solution 0.15 M NaCl + 0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 10 x Denhardt's, 5% dextran sulfate and 1% salmon sperm DNA; (2) hybridization proper for 20 hours at a temperature dependent on the size of the probe (ie: 42 C, for a probe size> 100 nucleotides) followed by 2 washes of 20 minutes at 20 C in 2 x SSC + 2 % SDS, 1 wash for 20 minutes at 20 ° C. in 0.1 × SSC + 0.1% SDS. The last washing is carried out in 0.1 x SSC + 0.1% SDS for 30 minutes at 60 ° C. for a probe of size> 100 nucleotides. The high stringency hybridization conditions described above for a polynucleotide of defined size may be adapted by those skilled in the art for oligonucleotides of larger or smaller size, as taught by Sambrook et al. 1989, Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor).

  In addition, by representative fragment of sequences according to the invention is meant any nucleotide fragment having at least 15 nucleotides, preferably at least 20, 25, 30, 50, 75, 100, 150, 300 and 450 consecutive nucleotides of the sequence from which it comes.

  By representative fragment, is meant in particular a nucleic sequence encoding a biologically active fragment of a polypeptide, as defined below.

  Representative fragment also refers to the intergenic sequences, and in particular the nucleotide sequences carrying the regulatory signals (promoters, terminators, or even enhancers, etc.), or sequences of probes or primers making it possible to detect or detect specifically amplifying the nucleic sequences encoding the polypeptides of SEQ ID N 56 to SEQ ID N 3455.

  Among said representative fragments, those having nucleotide sequences corresponding to open reading frames, called ORFs (ORFs for Open Reading Frame), generally understood between an initiation codon and a stop codon, or between two stop codons, are preferred. and encoding polypeptides, preferably at least 100 amino acids, such as, for example, but not limited to, the ORF sequences that will be described later.

  The representative fragments according to the invention can be obtained for example by specific amplification such as PCR or after digestion with appropriate restriction enzymes of nucleotide sequences according to the invention, this method being described in particular in the book by Sambrook et al. These representative fragments may also be obtained by chemical synthesis when their size is not too large, according to methods well known to those skilled in the art.

  The representative genome fragments of Legionella pneumophila strain Paris according to the invention also comprise at least one fragment of at least 15 nucleotides or more as mentioned above for the fragments resulting from an enzymatic cleavage at a restriction site. . Of course, the expression proteins such as RNA or proteins are understood according to the present invention. Paiini sequences containing sequences of the invention, or representative fragments, are also understood to mean the sequences which are naturally flanked by sequences which present at least 80%, 85%, 90%, 95% or 98% identity with the sequences according to the invention.

  By modified nucleotide sequence is meant any nucleotide sequence obtained by mutagenesis according to techniques well known to those skilled in the art, and comprising modifications, preferably at most 10%, 7.5%, 5%, 2.5%, 1%, 0.5%, 0.1% or even less than 0.01% of modified nucleotides, relative to the normal sequences, for example mutations in the regulatory sequences and / or promoters of the expression of the polypeptide, in particular leading to a modification of the level of expression or the activity of said polypeptide.

  By modified nucleotide sequence is also meant any nucleotide sequence encoding a modified polypeptide as defined below.

  The representative fragments according to the invention may also be probes or primers, which may be used in methods for detecting, identifying, assaying or amplifying nucleic sequences.

  Preferably, the invention relates to a nucleotide sequence coding for a polypeptide according to the invention.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a specific polypeptide of a bacterium of the genus Legionella, or one of its fragments of at least 5 amino acids , or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a specific polypeptide of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or the one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris, or one of its fragments. at least 5 amino acids, or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, or one of its fragments of at least 5 amino acids, in particular chosen from the polypeptides of sequence SEQ ID NO: 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181 or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a surface polypeptide of Legionella pneumophila strain Paris, or one of its fragments of at least 5 amino acids , in particular, chosen from polypeptides of sequence SEQ ID Ns. 3410, 704, 746, 2267, 2751, 3192, 3218, 3221, 3222, 3317, 3324, 136, 171, 310, 337, 481, 527, 652, 664, 893, 972, 1148, 1298, 1361, 1503, 1521. , 1576, 1651, 1755, 1847, 1877, 2224, 2406, 2843, 2930, 3037, 3139, 3157, 3165, 3181, or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a specific surface polypeptide of Legionella pneumophila strain Paris relative to the Philadelphia strain, selected from the polypeptides of sequence SEQ ID NO: 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a polypeptide involved in the biosynthesis of cell envelope polysaccharide of Legionella pneumophila strain Paris, in particular chosen from polypeptides SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411, or one of its representative fragments of at least 5 amino acids, or its complementary nucleic sequence.

  Preferably, the invention relates to a nucleotide sequence according to the invention, characterized in that it codes for a Legionella pneumophila strain, a Paris strain, encoded by the rtxA gene of sequence SEQ ID Nos. 3410, 3037, 3165 and 3181, or one of its representative fragments of at least 5 amino acids, or its complementary nucleic sequence.

  The rtxA gene of Legionella pneumophila that has been shown to be involved in virulence. This gene encodes a protein of 1208 aa. Four ORFs whose references are given below (SEQ ID 3410 3037 3165 3181) correspond to this gene in the Paris strain which would encode a protein of at least 4000 aa. The comparison with the Philadelphia strain shows the presence of a homologous gene for the N and C-terminal parts. The central portion of the protein consists of repeats of a pattern of about 20 aa different between the two strains.

  In another aspect, preferably, the invention relates to a nucleotide sequence according to the invention characterized in that it codes for a Legionella pneumophila strain strain Paris, or one of its representative fragments of at least 5 acids. amino involved in the biosynthesis of amino acids, in the biosynthesis of cofactors, prosthetic groups and transporters, involved in cellular machinery, involved in central intermediate metabolism, involved in energy metabolism, involved in the metabolism of fatty acids and phospholipids, involved in the metabolism of nucleotides, purines, pyrimidines or nucleosides, involved in regulatory functions, involved in the process of replication, involved in the transcription process, involved in the translation process, involved in the process of transport and protein binding, involved in adaptation to x atypical conditions, involved in sensitivity to drugs and the like, or involved in transposon-related functions.

  Thanks to the genomic sequence presented in the present invention, those skilled in the art will be able to identify the genes coding for proteins regulating the transcription of Legionella pneumophila strain Paris genes. Furthermore, Table I provides the list of the open reading frames (ORFs for Open Reading Frame) annotated and identified on the genome of Legionella pneumophila strain Paris (SEQ ID No. 1 to SEQ ID No. 55), with in particular their position on said genome, and, in Table II, the putative functions that can be attributed to them using the usual genomic comparison techniques (Bestblast). However, such a list should not be considered as limiting, since a protein can have several roles in the cell.

  Modifying the structure or integrity of these genes may make it possible to modify the expression of target genes controlled by target promoters of these regulators. Thus, a person skilled in the art will be able to choose the regulator (s) relevant for the desired application as well as their target, which allows the optimization of the expression of genes of interest. The use of previously described tools such as DNA chips also makes it possible to identify all the genes whose regulation is modified by the inactivation of certain genes. It is thus possible to select a set of control sequences answering, in nuances, the same type of regulation. These sequences can then be used to control the expression of genes of interest.

  In general, the list of SEQ ID sequences, or their corresponding coding nucleic sequence, may be determined by those skilled in the art from the most probable putative functions determined for each of the SEQ ID sequences in Table 1 and 2 below. -after for each of the activity classes listed below.

  It is important to note, however, that a living organism is a whole and must be taken as such. Thus, in order to develop and exhibit its properties, any organism needs interactions between different metabolic pathways. Thus, the classification set out above should not be considered as limiting, as one gene may be involved in two distinct metabolic pathways.

  The invention also relates to the polypeptides encoded by a nucleotide sequence according to the invention, preferably by a fragment representative of the sequence SEQ ID N 55 or sequences SEQ ID SEQ ID N 1 to SEQ ID N 54, and SEQ ID N 56, and corresponding to an ORF sequence, as described in Table I (coding for one of the sequences SEQ ID N 57 to SEQ ID N 3455).

  In particular, the polypeptides of Legionella pneumophila strain Paris, characterized in that they are chosen from the following polypeptides: polypeptides of sequence SEQ ID N 56 to SEQ ID N 3455; preferably the polypeptides present on the surface of Legionella pneumophila strain Paris, in particular of sequence SEQ ID N s. 3410, 704, 746, 2267, 2751, 3192, 3218, 3221, 3222, 3317, 3324, 136, 171, 310, 337, 481, 527, 652, 664, 893, 972, 1148, 1298, 1361, 1503, 1521. , 1576, 1651, 1755, 1847, 1877, 2224, 2406, 2843, 2930, 3037, 3139, 3157, 3165, 3181, even more preferably the polypeptides present on the specific surface of Legionella pneumophila strain Paris relative to the Philadelphia strain, especially those of sequence SEQ ID No. 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or one of its representative fragments of at least 5 amino acids; the polypeptides involved in the biosynthesis of cell envelope polysaccharides, in particular of sequence SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411; or the polypeptides of sequence SEQ ID Nos. 3410, 3037, 3165 and 3181, encoded by the rtxA gene.

  The invention also comprises polypeptides characterized in that they comprise a polypeptide chosen from: a) a polypeptide of sequence SEQ ID No. 56 to SEQ ID No. 3455; b) a polypeptide having at least 80%, preferably 85%, 90%, 95% and 98% identity with a polypeptide of sequence SEQ ID N 56 to SEQ ID N 3455; c) a fragment of at least 5 amino acids, preferably biologically active, of a as defined in b); d) a biologically active fragment of a polypeptide of sequence SEQ ID N 56 to SEQ ID N 3455; and e) a modified polypeptide of a polypeptide of sequence SEQ ID N 56 to SEQ ID N 3455, comprising at most 10% of modified amino acids, preferably 7.5%, 5%, 2.5%, 1% , 0.5%, 0, 1% or even 0.01%.

  The nucleotide sequences coding for the polypeptides described above are also the subject of the invention.

  In the present description, the terms polypeptides, polypeptide sequences, peptides and proteins are interchangeable.

  It should be understood that the invention does not relate to polypeptides in natural form, that is to say that they are not taken in their natural environment but that they could be isolated or obtained by purification from natural sources, or obtained by genetic recombination, or by chemical synthesis, and they may then include non-natural amino acids as will be described later.

  By polypeptide exhibiting a certain percentage of identity with another, which will also be designated by homologous polypeptide, is meant polypeptides having, relative to the natural polypeptides, certain modifications, in particular deletion, addition or substitution of at least an amino acid, a truncation, an elongation, a chimeric solution and / or a mutation, or the polypeptides having post-translational modifications. Among the homologous polypeptides, those whose amino acid sequence have at least 80%, preferably 85%, 90%, 95%, 98% and 99% identity with the amino acid sequences of the polypeptides according to the invention are preferred. the invention. In the case of a substitution, one or more consecutive amino acid (s) or non-consecutive acid (s) are replaced by equivalent amino acids. The expression "equivalent amino acids" is intended herein to designate any amino acid that may be substituted for one of the amino acids of the basic structure without essentially modifying the biological activities of the corresponding peptides and as they will be defined thereafter. .

  These equivalent amino acids can be determined either on the basis of their structural homology with the amino acids to which they are substituted, or on results of comparative tests of biological activity between the different polypeptides that may be carried out.

  By way of example, mention is made of the possibilities of substitution that can be carried out without it resulting in a thorough modification of the biological activity of the corresponding modified polypeptide. Leucine can thus be replaced by valine or isoleucine, aspartic acid with glutamine acid, glutamine with asparagine, arginine with lysine, etc., the reverse substitutions being naturally conceivable in the same conditions.

  The homologous polypeptides also correspond to the polypeptides encoded by the homologous or identical nucleotide sequences, as defined above, and thus comprise, in the present definition, mutated or inter and intra-species variant polypeptides which may exist in Legionella, and which correspond in particular to truncations, substitutions, deletions and / or additions, of at least one amino acid residue.

  It is understood that the percent identity between two polypeptides is calculated in the same way as between two nucleic acid sequences. Thus, the percentage identity between two polypeptides is calculated after optimal alignment of these two sequences, on a window of maximum homology. To define said maximum homology window, the same algorithms can be used as for the nucleic acid sequences.

  By biologically active fragment of a polypeptide according to the invention, is meant in particular a polypeptide fragment, as defined below, having at least one of the biological characteristics of the polypeptides according to the invention, especially in that is capable of generally performing even a partial activity, such as, for example: an enzymatic (metabolic) activity or an activity that may be involved in the biosynthesis or biodegradation of organic or inorganic compounds; structural activity (cell envelope, chaperone molecule, ribosome); - a transport activity (energy, ion); or in the secretion of protein; an activity in the process of replication, amplification, preparation, transcription, translation or maturation, in particular of DNA, RNA or proteins.

  By fragment of polypeptides according to the invention is meant a polypeptide comprising at least 5 amino acids, preferably 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 75, 100, 150. acids and 200 amino acids.

  The polypeptide fragments may correspond to isolated or purified fragments naturally present in the Legionella strains, or to fragments which can be obtained by cleavage of said polypeptide by a proteolytic enzyme such as trypsin or chymotrypsin or collagenase, by a reagent chemical (cyanogen bromide, CNBr) or by placing said polypeptide in a highly acidic environment (for example at pH = 2.5). Polypeptide fragments may also be prepared by chemical synthesis, from hosts transformed with an expression vector according to the invention which contain a nucleic acid allowing the expression of said fragment, and placed under the control of the regulatory elements and / or or appropriate expression.

  By modified polypeptide of a polypeptide according to the invention is meant a polypeptide obtained by genetic recombination or by chemical synthesis as described below, which has at least one modification with respect to the normal sequence, preferably at most 10% d amino acids modified with respect to the normal sequence, more preferably at most 7.5%, 5%, 2.5%, 1%, 0.5%, 0.1% or even 0.01%. These modifications may in particular be related to the amino acids necessary for the specificity or the effectiveness of the activity, or at the origin of the structural conformation, the charge, or the hydrophobicity of the polypeptide according to the invention. It is thus possible to create polypeptides of equivalent, increased or decreased activity, or of equivalent, narrower or broader specificity. Among the modified polypeptides are polypeptides in which up to five amino acids can be modified, truncated at the N- or C-terminus, or deleted, or added.

  As indicated, the modifications of a polypeptide are intended in particular: to allow its implementation in processes for the biosynthesis or biodegradation of organic or inorganic compounds, to allow its implementation in replication processes, amplification, repair and rule of transcription, translation, or processing including DNA, RNA, or proteins, to allow its improved secretion, - to modify its solubility, the effectiveness or the specificity of its activity, or to facilitate its purification.

  Chemical synthesis also has the advantage of being able to use unnatural amino acids or non-peptide bonds. Thus, it may be advantageous to use unnatural amino acids, for example under foline D, or amino acid analogues, especially sulfur forms.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a specific polypeptide of a bacterium of the genus Legionella, or one of its fragments at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a polypeptide specific for a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or one of its representative fragments of at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris, or the one of its fragments representative of at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, or one of its fragments representative of at least 5 amino acids, in particular chosen from the polypeptides of sequence SEQ ID No. 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181 , or one of its representative fragments of at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a surface polypeptide of Legionella pneumophila strain Paris, or one of its fragments representative of at least 5 amino acids, in particular chosen from polypeptides of sequence SEQ ID Nos. 3410, 704, 746, 2267, 2751, 3192, 3218, 3221, 3222, 3317, 3324, 136, 171, 310, 337, 481, 527, 652, 664, 893, 972, 1148, 1298, 1361, 1503, 1521. , 1576, 1651, 1755, 1847, 1877, 2224, 2406, 2843, 2930, 3037, 3139, 3157, 3165, 3181, or one of its representative fragments of at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a specific surface polypeptide of Legionella pneumophila strain Paris relative to the Philadelphia strain, selected from the polypeptides of SEQ ID Nos. 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or one of its representative fragments of at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a Legionella pneumophila strain of the Paris strain involved in the biosynthesis of Legionella cell envelope polysaccharide. pneumophila strain Paris, in particular chosen from polypeptides of sequence SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411, or one of its representative fragments of at least 5 amino acids.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a Legionella pneumophila polypeptide strain Paris coded by the rtxA gene of sequence SEQ ID Nos. 3410, 3037, 3165 and 3181, or one of its representative fragments of at least 5 amino acids, or its complementary nucleic sequence.

  In another aspect, preferably, the invention relates to a polypeptide according to the invention, characterized in that it is a Legionella pneumophila strain strain of Paris, or one of its representative fragments of minus 5 amino acids, involved in the biosynthesis of amino acids, in the biosynthesis of cofactors, prosthetic groups and transporters, involved in cellular machinery, involved in central intermediate metabolism, involved in energy metabolism, involved in the metabolism of fatty acids and phospholipids, involved in the metabolism of nucleotides, purines, pyrimidines or nucleosides, involved in the regulatory functions, involved in the replication process, involved in the transcription process, involved in the translation process, involved in the protein transport and binding process, involved in adaptation to atypical conditions is involved in sensitivity to drugs and the like, or involved in transposon-related functions.

  The subject of the present invention is also the nucleotide and / or polypeptide sequences according to the invention, characterized in that said sequences are recorded on a recording medium the form and nature of which facilitate reading, analysis and / or the exploitation of said sequence (s). These supports may also contain other information extracted from the present invention, in particular the analogies with already known sequences, and / or information concerning the nucleotide sequences and / or polypeptides of other microorganisms in order to facilitate comparative analysis and exploitation of the results obtained.

  Among these recording media, computer-readable media, such as magnetic, optical, electrical or hybrid media, in particular computer diskettes, CD-ROMs, computer servers, are particularly preferred. Such recording media are also object of the invention.

  The recording media according to the invention, with the information provided, are very useful for the choice of primers or nucleotide probes for the determination of genes in Legionella pneumophila strain Paris or strains close to this organism. Similarly, the use of these supports for the study of the genetic polymorphism of the strain near Legionella pneumophila strain Paris, in particular by the determination of colinearity regions, is very useful insofar as these supports provide not only the nucleotide sequence genome of Legionella pneumophila strain Paris, but also the genomic organization in said sequence. Thus, the uses of recording media according to the invention are also objects of the invention.

  The homology analysis between different sequences is effected advantageously using sequence comparison software, such as BlastP or BlastN software, or other software well known to those skilled in the art.

  For the purposes of the invention, a probe or primer is defined as a single-stranded nucleic acid fragment or a denatured double-stranded fragment comprising, for example, from 12 bases to a few kb, in particular from 15 to a few hundred bases, of preferably from 15 to 50 or 100 bases, and having hybridization specificity under specified conditions to form a hybridization complex with a target nucleic acid.

  The probes and primers according to the invention may be labeled directly or indirectly with a radioactive or non-radioactive compound by methods well known to those skilled in the art, in order to obtain a detectable and / or quantifiable signal.

  The unlabeled polynucleotide sequences according to the invention can be used directly as probe or primer.

  The sequences are generally labeled to obtain sequences that can be used for many applications. The labeling of the primers or probes according to the invention is carried out by radioactive elements or by non-radioactive molecules.

  Among the radioactive isotopes used, mention may be made of 32P, 33P, 355, 3H or 125I. The non-radioactive entities are selected from ligands such as biotin, avidin, streptavidin, dioxygenine, haptens, dyes, luminescent agents such as radioluminescent, chemiluminescent, bioluminescent, fluorescent, phosphorescent agents.

  The polynucleotides according to the invention can thus be used as primer and / or probe in processes using in particular the PCR (polymerase chain amplification) technique (Rolfs et al., 1991, Berlin: Springer-Verlag). This technique requires the choice of oligonucleotide primer pairs flanking the fragment that needs to be amplified. For example, reference can be made to the technique described in U.S. Patent No. 4,683,202. The amplified fragments can be identified, for example after agarose gel or polyacrylamide gel electrophoresis, or after a chromatographic technique such as gel filtration or ion exchange chromatography, and then sequenced. The specificity of the amplification can be controlled by using as primer the nucleotide sequences of polynucleotides of the invention as a template, plasmids containing these sequences or the derived amplification products. The amplified nucleotide fragments can be used as reagents in hybridization reactions in order to demonstrate the presence, in a biological sample, of a target nucleic acid of sequence complementary to that of said amplified nucleotide fragments.

  The invention also relates to the nucleic acids that can be obtained by amplification using primers according to the invention.

  Other amplification techniques for the target nucleic acid can advantageously be used as an alternative to PCR (PCR-like) using a pair of nucleotide sequence primers according to the invention. By PCR-like is meant all methods using direct or indirect reproductions of nucleic acid sequences, or in which the labeling systems have been amplified, these techniques are of course known, generally speaking. amplification of the DNA with a polymerase; when the original sample is an RNA, it is first necessary to perform a reverse transcription. There are currently numerous methods for this amplification, such as for example the SDA technique (Strand Displacement Amplification) or strand displacement amplification technique (Walker et al., 1992, Nucleic Acids Res., 20: 1691), the technique TAS (Transcription-based Amplification System) described by Kwoh et al. (1989, Proc Natl Acad Sci USA, 86, 1173), the 3SR technique (Self-Sustained Sequence Replication) described by Guatelli et al. (1990, Proc Natl Acad Sci USA 87: 1874), NASBA (Nucleic Acid Sequence Based Amplification) technique described by Kievitis et al. (1991, J. Virol Methods, 35, 233), the TMA (Transcription Mediated Amplification) technique, the LCR (Ligase Chain Reaction) technique described by Landegren et al. (1988, Science 241, 1077), the technique of RCR (Repair Chain Reaction) described by Segev (1992, Kessler C. Springer Verlag, Berlin, New York, 197-205), the CPR (Cycling Probe Reaction) technique described by Duck et al. (1990, Biotechniques, 9, 142), the Q-beta-replicase amplification technique described by Miele et al. (1983, J. Mol Biol., 171, 281). Some of these techniques have since been perfected.

  In the case where the target polynucleotide to be detected is an mRNA, it is advantageous to use, prior to carrying out an amplification reaction with the aid of the primers according to the invention or the implementation of a method detection using the probes of the invention, a reverse transcriptase enzyme to obtain a cDNA from the mRNA contained in the biological sample. The cDNA obtained will then serve as a target for the primers or probes used in the amplification or detection method according to the invention.

  The probe hybridization technique can be performed in a variety of ways (Matthews et al., 1988, Anal Biochem., 169, 1-25). The most general method is to immobilize the nucleic acid extracted from cells of different tissues or cells in culture on a support (such as nitrocellulose, nylon, polystyrene) and to incubate, under well defined conditions, the target nucleic acid immobilized with the probe. After hybridization, the excess probe is removed and the hybrid molecules formed are detected by the appropriate method (measurement of radioactivity, fluorescence or enzymatic activity related to the probe).

  According to another mode of implementation of the nucleic probes according to the invention, the latter can be used as capture probes. In this case, a probe, called a capture probe, is immobilized on a support and serves to capture by specific hybridization the target nucleic acid obtained from the biological sample to be tested and the target nucleic acid is then detected by means of a second probe, called a detection probe, marked by an easily detectable element.

  Among the nucleic acid fragments that may be of interest, it is thus worth mentioning in particular antisense oligonucleotides, that is to say whose structure ensures, by hybridization with the target sequence, an inhibition of the expression of the corresponding product. . It is also necessary to mention the sense oligonucleotides which, by interaction with proteins involved in the regulation of the expression of the corresponding product, will induce either an inhibition or an activation of this expression.

  In a preferred manner, the probes or primers according to the invention are immobilized on a support, in a covalent or non-covalent manner. In particular, the support may be a DNA chip or a high density filter, also objects of the present invention.

  The interest of the use of microarrays or, where appropriate, protein in the field of diagnosis or epidemiology is based, as has been said previously, on the possibility of analyzing at the same time and very quickly a large number of sequences, for: - the classification or typing of bacteria according to the presence of a sequence or a sequence profile characteristic of the genus, in particular the pathogenicity or not of the genus, in particular Legionella, or of the species, in particular Legionella pneumophila, or specific for a bacterium of the genus Legionella and / or of the species Legionella pneumophila, or specific for a bacterium of the subspecies Legionella pneumophila strain Paris, or specific for a bacterium of the subspecies Legionella pneumophila strain Paris compared to the Philadelphia strain, this, in particular, in association with the gravity or not of the pathologies that such bacteria can induce in case of infection in mammals, especially in humans; or - the simultaneous comparison of sequence or sequence profile between different genera, species or strain of bacteria, pathogenic or non-pathogenic, making it possible in particular to identify a gene, or the corresponding protein sequence, or a gene profile whose presence and / or or the expression in a bacterium is specific according to its genus, its species or its subspecies or strain of bacteria, and / or its pathogenicity or not. This information is particularly useful in particular to quickly identify the presence or absence of a pathogenic bacterium, the severity of the infection it may cause, the treatment adapted to infection, and / or the need and the means to implement to decontaminate contaminated or potentially contaminated objects, circuits or fluids. This information will also be of great benefit to epidemiological studies of this kind of bacteria.

  The term "DNA chip" or "high density filter" is intended to mean a support on which DNA sequences are attached, each of which can be identified by its geographical location. These chips or filters differ mainly in size, support material, and possibly the number of DNA sequences attached thereto.

  The probes or primers according to the first invention can be fixed on solid supports, in particular DNA chips, by different manufacturing processes. In particular, it is possible to carry out a synthesis in situ by photochemical addressing or by inkjet. Other techniques include performing ex situ synthesis and attaching the probes to the microarray support by mechanical, electronic or inkjet addressing. These various methods are well known to those skilled in the art.

  Indeed, many techniques or devices for analyzing biological samples have been developed in recent years, in particular for the parallel analysis of several quantities of nucleic acids, in particular following the rise of genomics.

  Among these techniques or devices, the supports for performing high-throughput analysis of nucleic acids, such as biochips, or DNA chips (also called micro- or macroarrays, or DNA chip) have been the subject of many studies.

  These biochips may in particular be made from a support, generally solid, functionalized on which were fixed by covalent binding and localized nucleic acids given (nucleic probes) and on which nucleic probes will specifically bind respectively by pairing ( or specific hybridization) or by recognition of an affinity site the nucleic acids that are to be detected or identified in the biological sample.

  Among the documents describing the techniques relating to DNA microarrays, mention may be made in particular of: the review article by Wang J. (Nucleic Acids Research, 28, 16, 3011-3016, 2000), which presents a summary making the a review of the main known techniques relating to microarrays, - the patent document issued under N US 6,030,782, which describes a grafting with a mercaptosilanized surface, of nucleic acids modified with a sulhydryl or disulfide group, and the article of Bamdad (Biophysical Journal, 75, 1997-2003, 1998), which describes the obtaining of surfaces presenting DNAs by incorporation of composite molecules, the thiol-DNAs, in self-assembled monolayers (SAMs); the international patent application published under N WO 00/43539 which proposes to immobilize molecules, such as oligonucleotides, by means of polyfunctional polymers (polymer brushes), which makes it possible to increase the grafting density. These polymers can be obtained from hydroxyethyl methacrylate, acrylamide, or vinyl pyrrolidone; the international patent application published under N WO 00/36145 describes a method for manufacturing DNA chips, comprising the polymerization on a metal-layer-type substrate, of a pyrrole and functionalized pyrrole copolymer, the fixing a crosslinking agent on the functionalized pyrrole, and then fixing a biological probe (such as an oligonucleotide). The crosslinking agent may be bifunctional and, for example, have an ester function of N-hydroxysuccinimide and a maleimide function; the international patent application published under N WO 98/20020 which also describes the high density immobilization of nucleic acids on solid supports, this time by contacting a nucleic acid containing a thiol group with a support having a group reacting with this thiol, optionally via a crosslinking agent; - the article by Penchovsky et al. (Nucleic Acids Research, 28, 22, e98, 2000), which describes a method of immobilizing oligonucleotides on amino latex beads, using a crosslinking agent that reacts under the action of light. ; and the international patent applications published under the names WO 99/16907, WO 00/40593 and WO 00/44939 of the company Suiinodics (which produces slides for the deposition of oligonucleotides functionalized with an amine). These applications describe, in particular, the fixation of nucleic acids on surfaces such as glass, via a polymer backbone to which one or more photochemically active groups are attached on one side of the polymer (for grafting on the surface) and thermochemically active on the other side (for grafting with functionalized nucleic acid).

  A nucleotide sequence (probe or primer) according to the invention therefore allows the detection and / or amplification of specific nucleic sequences. In particular, the detection of these sequences is facilitated when the probe is fixed on a DNA chip, or a high-density filter.

  The use of DNA chips or high-density filters indeed makes it possible to determine the expression of genes in an organism having a genomic sequence close to the genome of Legionella pneumophila strain Paris (Collection of the Institut Pasteur CIP 107-629- T).

  The genomic sequence of Legionella pneumophila strain Paris, completed by the identification of all the genes of this organism, as presented in the present invention, serves as a basis for the construction of these DNA or filter chips.

  The preparation of these filters or chips consists in synthesizing oligonucleotides corresponding to the 5 'and 3' ends of the genes. These oligonucleotides are selected using the genomic sequence and its annotations disclosed by the present invention.

  The pairing temperature of these oligonucleotides at the corresponding positions on the DNA should be approximately the same for each oligonucleotide. This makes it possible to prepare DNA fragments corresponding to each gene by the use of appropriate PCR conditions in a highly automated environment. The amplified fragments are then immobilized on filters or supports made of glass, silicon or synthetic polymers and these media are used for hybridization.

  The availability of such filters and / or chips and the corresponding annotated genomic sequence makes it possible to study the expression of large sets, or even of all the genes in the microorganisms of the genus Legionella or of the species Legionella pneumophila, in preparing the complementary DNAs, and hybridizing them to immobilized DNA or oligonucleotides on the filters or chips. Also, the filters and / or the chips make it possible to study the variability of the strains or species, by preparing the DNA of these organisms and by hybridizing them to the immobilized DNA or oligonucleotides on the filters or chips.

  Differences between genomic sequences of different strains or species can greatly affect the intensity of hybridization and, therefore, disrupt the interpretation of the results. It may therefore be necessary to have the precise sequence of the genes of the strain that one wishes to study. The gene detection method described later in detail, involving the determination of the sequence of random fragments of a genome, and organizing them according to the complete genome sequences of Legionella pneumophila strain disclosed in the present invention, can be very useful.

  The nucleotide sequences, or protein sequences, according to the invention may also be used in DNA chips, or, where appropriate, in proteins to carry out the analysis of mutations. This analysis is based on the constitution of chips, in particular DNA, capable of analyzing each base of a nucleotide sequence according to the invention. In particular, this may be done using micro-sequencing techniques on a DNA chip. The mutations are detected by extension of immobilized primers hybridizing to the matrix of the analyzed sequences, just adjacent to that of the mutated nucleotide sought. A single-stranded template, RNA or DNA, sequences to be analyzed will advantageously be prepared according to conventional methods, from products amplified according to the PCR type techniques. The single-stranded DNA or RNA matrices thus obtained are then deposited on the DNA chip, under conditions allowing their specific hybridization to the immobilized primers. A thermostable polymerase, for example Tth or Taq DNA polymerase, specifically extends the 3 'end of the immobilized primer with a labeled nucleotide analog complementary to the nucleotide at the variable site position; for example, a thermal cycle is carried out in the presence of fluorescent dideoxyribonucleotides. The experimental conditions will be adapted in particular to the chips used, to the immobilized primers, to the polymerases used, and to the marking system chosen. An advantage of microsequencing over probe hybridization techniques is that it allows all variable nucleotides to be identified with optimal discrimination under homogeneous reaction conditions; used on microarrays, it allows optimal resolution and specificity for the routine and industrial detection of multiplex mutations.

  The use of high density filters and / or chips thus makes it possible to obtain new knowledge on the regulation of genes in organisms of industrial importance, and in particular legionelloses propagated under various conditions. It also allows rapid identification of differences between genomes of strains used in multiple industrial applications.

  In addition, a DNA chip or a filter can be an extremely useful tool for determining, detecting and / or identifying a microorganism. Thus, the microarrays according to the invention which also contain at least one nucleotide sequence of a microorganism other than Legionella pneumophila strain Paris immobilized on the support of said chip are also preferred. Preferably, the microorganism chosen is one of the species of bacteria of the genus Legionella (hereinafter sometimes designated as Legionella pneumophila-associated bacteria), or the subspecies of Legionella pneumophila, or the variants of Legionella pneumophila strain Paris.

  A DNA chip or a filter according to the invention is a very useful element of some kits or necessary for the detection and / or identification of microorganisms, in particular the bacteria belonging to the species Legionella pneumophila strain Paris or the associated microorganisms. , also objects of the invention.

  Moreover, the DNA chips or the filters according to the invention, containing probes or primers specific for Legionella pneumophila strain Paris, in particular compared to the philadelphia strain, are very advantageous elements of kits or necessary for the detection and / or the quantification of the expression of Legionella pneumophila strain (or associated microorganisms) genes.

  Indeed, the control of the expression of the genes is a critical point to optimize the growth and the yield of a strain, either by allowing the expression of one or more new genes, or by modifying the expression of genes already present in the cell. The present invention provides all the sequences naturally active in Legionella pneumophila strain Paris allowing the expression of genes. It thus makes it possible to determine all the sequences expressed in Legionella pneumophila strain Paris. It also provides a tool to identify genes whose expression follows a given pattern. To achieve this, the DNA of all or part of the genes of Legionella pneumophila strain Paris can be amplified by means of primers according to the invention, then attached to a support such as for example glass or nylon or a DNA chip, so to build a tool to follow the expression profile of these genes. This tool consisting of this support containing the coding sequences serves as a hybridization template for a mixture of labeled molecules reflecting the messenger RNAs expressed in the cell (in particular the labeled probes according to the invention). By repeating this experiment at different times and combining all these data with an appropriate treatment, we obtain the expression profiles of all these genes. The knowledge of the sequences which follow a given control scheme can also be used to search in a directed manner, for example by homology, other sequences following globally, but slightly differently the same control scheme. In addition, it is possible to isolate each control sequence present upstream of the probe segments and to monitor the activity using appropriate means such as a reporter gene (luciferase, 13-galactosidase, GFP for Green Fluorescent Protein). These isolated sequences can then be modified and assembled by metabolic engineering with sequences of interest for optimal expression.

  The invention also relates to the cloning and / or expression vectors, which contain a nucleotide sequence according to the invention. Particularly preferred are nucleotide sequences encoding cell or surface envelope polypeptides, or involved in cellular machinery, particularly secretion, central intermediate metabolism, particularly sugar production, energy metabolism, and processes. synthesis of vitamin B12, transcription and translation, synthesis of polypeptides.

  The vectors according to the invention preferably comprise elements which allow the expression and / or the secretion of the nucleotide sequences in a specific host cell.

  The vector must then include a promoter, translation initiation and termination signals, as well as appropriate transcriptional regulatory regions. It must be able to be stably maintained in the host cell and may possibly have particular signals that specify the secretion of the translated protein. These different elements are chosen and optimized by those skilled in the art depending on the cellular host used. For this purpose, the nucleotide sequences according to the invention can be inserted into vectors with autonomous replication within the chosen host, or be integrative vectors of the chosen host.

  Such vectors are prepared by methods commonly used by those skilled in the art, and the resulting clones can be introduced into a suitable host by standard methods, such as lipofection, electroporation, heat shock, or chemical methods. .

  The vectors according to the invention are for example vectors of plasmid or viral origin. They are useful for transforming host cells in order to clone or express the nucleotide sequences according to the invention.

  The invention also comprises the host cells transformed with a vector according to the invention.

  The cellular host may be chosen from prokaryotic or eukaryotic systems, for example bacterial cells, but also yeast cells or animal cells, in particular mammalian cells. Insect cells or plant cells can also be used. The preferred host cells according to the invention are in particular prokaryotic cells, preferably bacteria such as E. coli, or belonging to the genus Legionella, the species Legionella pneumophila strain Paris, or the microorganisms associated with the species Legionella pneumophila strain Paris.

  The invention also relates to animals, except humans, which comprise a transformed cell according to the invention. The cells transformed according to the invention can be used in processes for preparing recombinant polypeptides according to the invention. The methods for preparing a polypeptide according to the invention in recombinant form, characterized in that they implement a vector and / or a cell transformed with a vector according to the invention are themselves included in the present invention. Preferably, a cell transformed with a vector according to the invention is cultured under conditions which allow the expression of said polypeptide and said recombinant peptide is recovered. The host cells according to the invention can also be used for the preparation of food compositions, which are themselves the subject of the present invention.

  As has been said, the cellular host may be selected from prokaryotic or eukaryotic systems. In particular, it is possible to identify nucleotide sequences according to the invention, facilitating secretion in such a prokaryotic or eukaryotic system. A vector according to the invention carrying such a sequence can therefore be advantageously used for the production of recombinant proteins, intended to be secreted. Indeed, the purification of these recombinant proteins of interest will be facilitated by the fact that they are present in the supernatant of the cell culture rather than inside the host cells.

  The polypeptides according to the invention can also be prepared by chemical synthesis. Such a preparation method is also an object of the invention.

  Those skilled in the art are familiar with chemical synthesis processes, for example techniques involving solid phases (see, in particular, Steward et al., 1984, Solid Phase Peptide Synthesis, Pierce Chem Company, Rockford, 111, 2nd ed. (1984)) or techniques using partial solid phases, by fragment condensation or by conventional solution synthesis. The polypeptides obtained by chemical synthesis and which may comprise corresponding unnatural amino acids are also included in the invention.

  The invention further relates to hybrid polypeptides having at least one polypeptide or fragment thereof according to the invention, and a sequence of a polypeptide capable of inducing an immune response in humans or animals.

  Advantageously, the antigenic determinant is such that it is capable of inducing a humoral and / or cellular response.

  Such a determinant may comprise a polypeptide or a fragment thereof according to the invention in glycosylated form used to obtain immunogenic compositions capable of inducing the synthesis of antibodies directed against multiple epitopes. Said polypeptides or their glycosylated fragments also form part of the invention.

  These hybrid molecules may consist in part of a molecule carrying polypeptides or fragments thereof according to the invention, associated with a possibly immunogenic part, in particular an epitope of diphtheria toxin, tetanus toxin, a surface antigen of the virus. hepatitis B (patent FR 79 21811), the VP1 antigen of the polio virus or any other toxin or viral or bacterial antigen.

  Methods for synthesizing hybrid molecules include methods used in genetic engineering to construct hybrid nucleotide sequences encoding the desired polypeptide sequences. For example, it may be advantageous to refer to the technique for obtaining genes coding for fusion proteins described by Minton in 1984.

  Said hybrid nucleotide sequences coding for a hybrid polypeptide as well as the hybrid polypeptides according to the invention characterized in that they are recombinant polypeptides obtained by the expression of said hybrid nucleotide sequences, also form part of the invention.

  The invention also comprises the vectors characterized in that they contain one of said hybrid nucleotide sequences. The host cells transformed with said vectors, the transgenic animals comprising one of said transformed cells as well as the methods for preparing recombinant polypeptides using said vectors, said transformed cells and / or said transgenic animals are of course also part of the invention.

  The coupling between a polypeptide according to the invention and an immunogenic polypeptide can be carried out chemically or biologically. Thus, according to the invention, it is possible to introduce one or more linker (s), in particular amino acids to facilitate the coupling reactions between the polypeptide according to the invention, and the immunostimulatory polypeptide, the covalent coupling of the immunostimulatory antigen that can be produced at the N or C-terminal end of the polypeptide according to the invention. The bifunctional reagents allowing this coupling are determined as a function of the end chosen to achieve this coupling, and the coupling techniques are well known to those skilled in the art.

  Conjugates derived from peptide coupling can also be prepared by genetic recombination. The hybrid peptide (conjugate) can indeed be produced by recombinant DNA techniques, by insertion or addition to the DNA sequence coding for the polypeptide according to the invention, of a sequence encoding the peptide (s) ) antigen (s), immunogen (s) or hapten (s). These recombinant hybrid peptide preparation techniques are well known to those skilled in the art (see, for example, Makrides, 1996, Microbiological Reviews 60,512-538).

  Preferably, said immune polypeptide is selected from the group of peptides containing toxoids, in particular diphtheria toxoid or tetanus toxoid, streptococcus-derived proteins (such as human serum albumin binding protein), OMPA membrane proteins and complexes. outer membrane proteins, outer membrane vesicles or thermal shock proteins.

  The hybrid polypeptides according to the invention are very useful for obtaining monoclonal or polyclonal antibodies, capable of specifically recognizing the polypeptides according to the invention. Indeed, a hybrid polypeptide according to the invention allows the potentiation of the immune response against the polypeptide according to the invention coupled to the immunogen molecule. Such monoclonal or polyclonal antibodies, their fragments, or chimeric antibodies, recognizing the polypeptides according to the invention, are also objects of the invention.

  Specific monoclonal antibodies can be obtained according to the conventional hybridoma culture method described by Kohler and Milstein (1975, Nature 256, 495).

  The antibodies according to the invention are for example chimeric antibodies, humanized antibodies, Fab fragments, or F (ab ') 2. It can also be in the form of immunoconjugate or labeled antibody in order to obtain a detectable and / or quantifiable signal.

  Thus, the antibodies according to the invention can be used in a process for the detection and / or identification of bacteria belonging to the species Legionella pneumophila strain Paris or to an associated microorganism in a biological sample, characterized in that comprises the following steps: a) contacting the biological sample with an antibody according to the invention; b) demonstration of the antigenbody antibody complex possibly formed.

  The antibodies according to the present invention can also be used in order to detect an expression of a Legionella pneumophila strain or associated microorganisms gene. Indeed, the presence of the expression product of a gene recognized by an antibody specific for said expression product can be detected by the presence of an antigen-antibody complex formed after the contacting of the strain of Legionella pneumophila strain Paris, or microorganism associated with an antibody according to the invention. The bacterial strain used may have been prepared, that is to say centrifuged, lysed, placed in a suitable reagent for the constitution of the environment conducive to the immunological reaction. In particular, a method for detecting the expression in the gene, corresponding to a Western blot, which can be carried out after polyacrylamide gel electrophoresis of a lysate of the bacterial strain, in the presence or in the absence of a bacterial strain, is preferred. reducing conditions (SDS-PAGE). After migration and separation of the proteins on the polyacrylamide gel, said proteins are transferred to an appropriate membrane (for example nylon) and the presence of the protein or polypeptide of interest is detected by contacting said membrane with a membrane. antibody according to the invention.

  Thus, the present invention also comprises the kits or kits necessary for the implementation of a method as described (for detecting the expression of a Legionella pneumophila Paris strain gene, or an associated microorganism, or for detection and / or identification of bacteria belonging to the species Legionella pneumophila strain Paris or an associated microorganism), comprising the following elements: a) a polyclonal or monoclonal antibody according to the invention; b) optionally, the reagents for the constitution of the environment conducive to the immunological reaction; c) optionally, the reagents making it possible to demonstrate the antigen-antibody complexes produced by the immunological reaction.

  The polypeptides and antibodies according to the invention may advantageously be immobilized on a support, in particular a protein chip. Such a protein chip is an object of the invention, and may also contain at least one polypeptide of a microorganism other than Legionella pneumophila strain Paris or an antibody directed against a compound of a microorganism other than Legionella pneumophila strain Paris.

  The protein chips or high density filters containing proteins according to the invention can be constructed in the same way as the DNA chips according to the invention. In practice, it is possible to synthesize the polypeptides attached directly to the protein chip, or to carry out an ex situ synthesis followed by a step of fixing the polypeptide synthesized on said chip. The latter method is preferable when it is desired to attach large size proteins to the support which are advantageously prepared by genetic engineering. However, if it is desired to fix only peptides on the support of said chip, it may be more advantageous to proceed to the synthesis of said peptides directly in situ.

  The protein chips according to the invention can be advantageously used in kits or necessary for the detection and / or identification of bacteria associated with the species Legionella pneumophila strain Paris, or a microorganism, or more generally in kits or kits for the detection and / or identification of microorganisms. When the polypeptides according to the invention are fixed on the DNA chips, the presence of antibodies in the tested samples is sought, the fixation of an antibody according to the invention on the support of the protein chip allowing the identifying the protein of which said antibody is specific.

  Preferably, an antibody according to the invention is fixed on the support of the protein chip, and the presence of the corresponding antigen, specific for Legionella pneumophila strain Paris, or of an associated microorganism is detected.

  A protein chip described above can be used for the detection of gene products, to establish an expression profile of said genes, in addition to a DNA chip according to the invention.

  The protein chips according to the invention are also extremely useful for proteomic experiments, which studies the interactions between the different proteins of a given microorganism. In a simplified manner, peptides representative of the various proteins of an organism on a support are fixed. Then, said support is brought into contact with labeled proteins, and after an optional rinsing step, interactions between said labeled proteins and the peptides attached to the protein chip are detected.

  Thus, the protein chips comprising a polypeptide sequence according to the invention or an antibody according to the invention are the subject of the invention, as well as kits or kits containing them.

  The present invention also covers a method for the detection and / or identification of bacteria belonging to the species Legionella pneumophila strain Paris or to an associated microorganism in a biological sample, which implements a nucleotide sequence according to the invention.

  It is to be understood that the term biological sample relates in the present invention to samples taken from a living organism (in particular blood, tissues, organs or other material taken from a mammal) or a sample containing biological material, that is, DNA. Such a biological sample includes in particular any fluids (liquid or aerial), or any object, such as fluid conduits, fluid filters, or any object that may be involved in the fluid supply of buildings, the food compositions containing bacteria or others.

  The method of detection and / or identification using the nucleotide sequences according to the invention can be of various kinds.

  A method comprising the following steps is preferred: a) optionally, isolating the DNA from the biological sample to be analyzed, or obtaining a cDNA from the RNA of the biological sample; b) specific amplification of the DNA of bacteria belonging to the species Legionella pneumophila strain Paris, or to an associated microorganism using at least one primer according to the invention; c) highlighting the amplification products.

  This method is based on the specific amplification of the DNA, in particular by a chain amplification reaction.

  A method comprising the following steps is also preferred: a) contacting a nucleotide probe according to the invention with a biological sample, the nucleic acid contained in the biological sample having, if necessary, been previously made accessible to hybridization, under conditions allowing hybridization of the probe to the nucleic acid of a bacterium belonging to the species Legionella pneumophila strain Paris, or to an associated microorganism; b) demonstration of the hybrid possibly formed between the nucleotide probe and the DNA of the biological sample.

  Such a method should not be limited to detecting the presence of the DNA contained in the certified biological sample, it can also be used to detect the RNA contained in said sample. This process includes in particular Southern and Northern blot.

  Another preferred method according to the invention comprises the following steps: a) contacting a nucleotide probe immobilized on a support according to the invention with a biological sample, the nucleic acid of the sample having, if appropriate was previously made accessible to hybridization, under conditions allowing the hybridization of the probe to the nucleic acid of a bacterium belonging to the species Legionella pneumophila strain Paris or to an associated microorganism; b) contacting the hybrid formed between the nucleotide probe immobilized on a support and the nucleic acid contained in the biological sample, where appropriate after removal of the DNA from the biological sample which has not hybridized with the probe, with a labeled nucleotide probe according to the invention; c) highlighting the new hybrid fonlié in step b).

  This method is advantageously used with a DNA chip according to the invention, the desired nucleic acid hybridizing with a probe present on the surface of said chip, and being detected by the use of a labeled probe. This method is advantageously implemented by combining a prior step of amplification of the DNA or complementary DNA optionally obtained by reverse transcription, using primers according to the invention.

  Thus, the present invention also encompasses the kits or kits necessary for the detection and / or identification of bacteria belonging to the species Legionella pneumophila strain Paris or to an associated microorganism, characterized in that it comprises the following elements: a) a nucleotide probe according to the invention; b) optionally, the reagents necessary for carrying out a hybridization reaction; c) optionally, at least one primer according to the invention as well as the reagents necessary for an amplification reaction of the DNA.

  Similarly, the present invention also encompasses the kits or kits necessary for the detection and / or identification of bacteria belonging to the species Legionella pneumophila strain Paris or to an associated microorganism, characterized in that it comprises the following elements a) a nucleotide probe, called a capture probe, according to the invention; b) an oligonucleotide probe, called a revelation probe, according to the invention; c) optionally, at least one primer according to the invention as well as the reagents necessary for an amplification reaction of the DNA.

  Finally, kits or kits for the detection and / or identification of bacteria belonging to the species Legionella pneumophila strain Paris, or to an associated microorganism, characterized in that it comprises the following elements: a) at least a primer according to the invention; b) optionally, the reagents necessary to perform a DNA amplification reaction; c) optionally, a component for verifying the sequence of the amplified fragment, more particularly an oligonucleotide probe according to the invention.

  are also objects of the present invention.

  Preferably, said primers and / or probes and / or polypeptides and / or antibodies according to the present invention used in the methods and / or kits or necessary according to the present invention are chosen from primers and / or probes and / or polypeptides and / or or specific antibodies of the species Legionella pneumophila strain Paris. Preferably, these elements are chosen pallni the nucleotide sequences leading to a secreted protein, among the secreted polypeptides, or from the antibodies directed against exported polypeptides, such as those involved in the wall or cell encapsulation of Legionella pneumophila strain Paris .

  The subject of the present invention is also the strains of Legionella pneumophila strain Paris and / or associated microorganisms containing one or more mutations, at most less than 10% of mutation (or even less as cited for the modifications of polypeptides) in a nucleotide sequence according to the invention, in particular an ORF sequence, or their regulatory elements (in particular promoters).

  According to the present invention, the strains of Legionella pneumophila strain Paris having one or more mutation (s) in the nucleotide sequences coding for polypeptides involved in the cellular machine, in particular secretion, central intermediate metabolism, energy metabolism, are preferred. , the processes of amino acid synthesis, transcription and translation, synthesis of polypeptides.

  Said mutations can lead to inactivation of the gene, or in particular when they are located in the regulatory elements of said gene, to overexpression thereof.

  The invention further relates to the use of a method of selecting a compound capable of inhibiting the expression of genes involved in the biosynthesis of cell envelope polysaccharides of the bacterium Legionella pneumophila strain Paris, characterized in that it comprises the following steps: a) placing said compound in contact with a bacterium of said strain Paris, said bacterium being under conditions and in a medium suitable for its culture; b) determination of the ability of said compound to inhibit the expression of the genes encoding the proteins of SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411; c) using a method according to the invention wherein said antibody is directed specifically against a polypeptide involved in the biosynthesis of polysaccharides, or using a method according to the invention wherein the probes or primers are specific for a nucleic acid sequence encoding a polypeptide involved in the biosynthesis of polysaccharides.

  c) selecting an organic or inorganic compound capable of modulating, regulating, inducing or inhibiting the expression of genes, and / or modifying the cellular replication of eukaryotic or prokaryotic or inducible cells, inhibit or aggravate pathologies related to infection with Legionella pneumophila strain Paris or one of its associated microorganisms.

  The invention also comprises a method for selecting compounds capable of binding to a polypeptide or a fragment thereof according to the invention, capable of binding to a nucleotide sequence according to the invention, or capable of recognizing an antibody according to claim , and / or capable of modulating, regulating, inducing or inhibiting the expression of genes, and / or modifying the growth or the cellular replication of eukaryotic or prokaryotic cells, or capable of inducing, inhibiting or to aggravate in an animal or human body the pathologies related to an infection with Legionella pneumophila strain Paris, or one of its associated microorganisms, characterized in that it comprises the following steps: a) bringing said compound into contact with said polypeptide, said nucleotide sequence, with a transformed cell according to the invention and / or administration of said compound to a transformed animal according to the invention; b) determining the ability of said compound to bind with said polypeptide or nucleotide sequence, or modulate, regulate, induce or inhibit gene expression, or modulate cell growth or replication, or to induce, inhibit or aggravate in said transformed animal the pathologies related to an infection with Legionella pneumophila strain Paris or one of its associated microorganisms.

  The cells and / or animals transformed according to the invention may advantageously serve as a model and be used in processes to study, identify and / or select compounds likely to be responsible for pathologies induced or aggravated by Legionella pneumophila strain Paris, or likely to prevent and / or treat these pathologies such as genital diseases, ocular or systemic, including the lymphatic system. In particular, the transformed host cells, in particular the bacteria of the Legionella e family whose transformation with a vector according to the invention may, for example, increase or inhibit its infectivity, or modulate the pathologies usually induced or aggravated by the infection, may be used to infect animals whose onset of pathology will be followed. These unprocessed animals, infected for example with Legionella e transformed bacteria, can serve as a study model. In the same manner, the animals transformed according to the invention may be used in methods of selecting compounds capable of preventing and / or treating Legionella diseases. Said methods using said transformed cells and / or transformed animals form part of the invention.

  The compounds that can be selected may be organic compounds such as polypeptides or carbohydrates or any other organic or inorganic compounds already known, or new organic compounds prepared from molecular modeling techniques and obtained by chemical or biochemical synthesis. these techniques being known to those skilled in the art.

  Said selected compounds may be used to modulate the growth and / or cell replication of Legionella pneumophila strain Paris or any other associated microorganism and thus to control infection by these microorganisms. Said compounds according to the invention may also be used to modulate the growth and / or the cellular replication of all eukaryotic or prokaryotic cells, in particular tumor cells and infectious microorganisms, for which said compounds will prove to be active, methods allowing determining said modulations being well known to those skilled in the art.

  What is meant by compound capable of modulating the growth of a microorganism any compound allowing to intervene, modify, limit and / or reduce the development, growth, proliferation rate and / or viability of said microorganism microorganism.

  This modulation can be carried out for example by an agent capable of binding to a protein and thus of inhibiting or potentiating its biological activity, or capable of binding to a membrane protein of the outer surface of a microorganism and of blocking the penetration of said microorganism into the host cell or promoting the action of the immune system of the infected organism directed against said microorganism. This modulation can also be carried out by an agent capable of binding to a nucleotide sequence of a DNA or RNA of a microorganism and blocking, for example, the expression of a polypeptide whose biological or structural activity is necessary. the growth or reproduction of said microorganism.

  For these screening methods, the term microorganism associated herewith in the present method of selection is also understood to mean any microorganism whose gene expression can be modulated, regulated, induced or inhibited, or whose cell growth or replication can be also modulated by a compound of the invention. The term microorganism associated with the present invention is also intended to denote any microorganism comprising nucleotide sequences or polypeptides according to the invention. These microorganisms may in certain cases contain polypeptides or nucleotide sequences identical to or homologous to those of the invention may also be detected and / or identified by the methods or kit of detection and / or identification according to the invention and also serve as a target for the compounds of the invention.

  The invention relates to compounds that can be selected by a selection method according to the invention.

  The invention also relates to a pharmaceutical composition comprising a compound chosen from the following compounds: a) a nucleotide sequence according to the invention; b) a polypeptide according to the invention; c) a vector according to the invention; d) an antibody according to the invention; and e) a compound capable of being selected by a selection method according to the invention, optionally in combination with a pharmaceutically acceptable vehicle.

  The term "effective amount" is intended to denote a sufficient quantity of said compound or antibody, or polypeptide of the invention, for modulating the growth of Legionella pneumophila or a related microorganism.

  The invention also relates to a pharmaceutical composition according to the invention for the prevention or treatment of an infection with a bacterium belonging to the species Legionella pneumophila strain Paris, or by an associated microorganism.

  The invention is further directed to an immunogenic and / or vaccine composition, characterized in that it comprises one or more polypeptides according to the invention and / or one or more hybrid polypeptides according to the invention.

  The invention also comprises the use of a transformed cell according to the invention, for the preparation of a vaccine composition.

  The invention also relates to a vaccine composition, characterized in that it contains a nucleotide sequence according to the invention, a vector according to the invention and / or a transformed cell according to the invention.

  The invention also relates to the vaccine compositions according to the invention for the prevention or treatment of an infection with a bacterium belonging to the species Legionella pneumophila strain Paris, or by an associated microorganism.

  Preferably, the immunogenic and / or vaccine compositions according to the invention intended for the prevention and / or treatment of infection with Legionella pneumophila strain Paris, or with an associated microorganism will be chosen from immunogenic and / or vaccine compositions comprising a polypeptide or a fragment thereof corresponding to a protein, or a fragment thereof, of the cell envelope of Legionella pneumophila strain Paris. Vaccine compositions comprising nucleotide sequences will also preferably comprise nucleotide sequences coding for a polypeptide or a fragment thereof corresponding to a protein, or a fragment thereof, of the cell envelope of Legionella pneumophila strain Paris.

  Among these preferred immunogenic and / or vaccine compositions, the most preferred are those comprising a polypeptide or a fragment thereof, or a nucleotide sequence or a fragment thereof whose sequences are chosen from the nucleotide or amino acid sequences identified in this patent. functional group and listed previously.

  The polypeptides of the invention or their fragments entering into the immunogenic compositions according to the invention may be selected by techniques known to those skilled in the art, for example on the capacity of said polypeptides to stimulate T cells, which results in for example by their proliferation or the secretion of interleukins, and which leads to the production of antibodies directed against said polypeptides.

  In the mouse, in which a dose of the vaccine composition comparable to the dose used in humans is administered, the antibody reaction is tested by serum sampling followed by a study of the formation of a complex between the antibodies present. in the serum and antigen of the vaccine composition, according to the usual techniques.

  According to the invention, said vaccine compositions will preferably be in association with a pharmaceutically acceptable vehicle and, where appropriate, with one or more appropriate immunity adjuvants.

  Today, various types of vaccines are available to protect humans against infectious diseases: live attenuated microorganisms (M. bovis - BCG for tuberculosis), inactivated microorganisms (influenza virus), acellular extracts (Bordetella pertussis for whooping cough), recombinant proteins (hepatitis B surface antigen), polysaccharides (pneumococci). Vaccines prepared from synthetic peptides or genetically modified microorganisms expressing heterologous antigens are being tested. More recently, recombinant plasmid DNAs carrying genes encoding protective antigens have been proposed as an alternative vaccine strategy. This type of vaccination is carried out with a particular plasmid derived from an E. coli plasmid which does not replicate in vivo and which codes only for the vaccinating protein.

  Animals were immunized by simply injecting bare plasmid DNA into the muscle. This technique leads to the expression of the vaccine protein in situ and to a cellular type (CTL) and humoral (antibody) type immune response. This double induction of the immune response is one of the main advantages of the technique of vaccination with naked DNA.

  The vaccine compositions comprising nucleotide sequences or vectors in which said sequences are inserted are described in particular in the international application N WO 90/11092 and also in the international application N WO 95/11307.

  The constitutive nucleotide sequence of the vaccine composition according to the invention may be injected into the host after having been coupled to compounds which promote the penetration of this polynucleotide within the cell or its transport to the cell nucleus. The resulting conjugates can be encapsulated in polymeric microparticles as described in International Application No. WO 94/27238 (Medisorb Technologies International).

  According to another embodiment of the vaccine composition according to the invention, the nucleotide sequence, preferably a DNA, is complexed with DEAE-dextran, with nuclear proteins, with lipids or encapsulated in liposomes or introduced under the form of a gel facilitating its transfection into the cells. The polynucleotide or the vector according to the invention can also be suspended in a buffer solution or be associated with liposomes.

  Advantageously, such a vaccine will be prepared according to the technique described by Tacson et al. or Huygen et al. in 1996 or according to the technique described by Davis et al. in the international application N WO 95/11307.

  Such a vaccine may also be prepared in the form of a composition containing a vector according to the invention, placed under the control of regulatory elements allowing its expression in humans or animals. For example, the plasmid pcDNA3 or the plasmid pcDNAl / neo, both marketed by Invitrogen (R & D Systems, Abingdon, United Kingdom), may be used as an in vivo expression vector for the polypeptide antigen of interest. ). Such a vaccine will advantageously comprise, in addition to the recombinant vector, a saline solution, for example a sodium chloride solution.

  The term "pharmaceutically acceptable carrier" is intended to mean a compound or a combination of compounds used in a pharmaceutical or vaccine composition which does not cause side reactions and which makes it possible, for example, to facilitate the administration of the active compound, to increase its duration of administration. life and / or its effectiveness in the body, the increase of its solubility in solution or the improvement of its conservation. These pharmaceutically acceptable carriers are well known and will be adapted by those skilled in the art depending on the nature and mode of administration of the selected active compound.

  As regards the vaccine formulations, these may comprise suitable immunity adjuvants which are known to those skilled in the art, such as, for example, aluminum hydroxide, a representative of the family of muramyl peptides. as one of the peptide derivatives of N-acetyl-muramyl, a bacterial lysate, or incomplete Freund's adjuvant.

  Preferably, these compounds will be administered systemically, particularly intravenously, intramuscularly, intradermally or subcutaneously, or orally. More preferably, the vaccine composition comprising polypeptides according to the invention, will be administered several times, spread over time, intradermally or subcutaneously.

  Their modes of administration, dosages and optimal dosage forms can be determined according to the criteria generally taken into account in the establishment of a treatment adapted to a patient such as the age or the body weight of the patient, the severity of his general condition, tolerance to treatment and side effects noted.

  The invention comprises the use of a composition according to the invention for the treatment or prevention of diseases induced or aggravated by the presence of Legionella pneumophila strain Paris.

  The invention comprises the use of a composition according to the invention, for the treatment or prevention of systemic diseases, induced or aggravated by the presence of Legionella pneumophila strain Paris.

* Furthermore, the present invention also relates to a genomic DNA library of a bacterium of the species Legionella pneumophila strain Paris, characterized in that it is the bank deposited at the CNCM November 19, 2003 , under order number I-3138.

  Furthermore, the subject of the present invention is also a vector or a host cell according to claim 38 or 42, characterized in that it is the vector or the cell deposited at the CNCM on November 19, 2003, under the number order I-3137.

  One of the advantages of using the BAC system over a cosmid system is that the plasmid used is present at only one or at most two copies per transformed cell, which reduces the potential for recombination between cells. DNA fragments, and more importantly, eliminating the risk of lethal overexpression of cloned bacterial genes. Nevertheless, the presence of BAC as a single copy means that the plasmid DNA must be extracted from a large volume of culture in order to obtain enough DNA for the sequence. In addition, the stability and maintenance fidelity of clones in a BAC library allow the identification of genomic differences among different strains of Legionella, and the identification of these genetic differences that may be responsible for the observed phenotypic variations between different strains. .

  The genomic DNA library described in the present invention indeed covers the genome of Legionella pneumophila strain Paris. However, although some regions could not be cloned into said library, due to lethality problems in Escherichia coli, these regions can easily be amplified and identified by those skilled in the art, using oligonucleotides specific for the sequences of ends of the different clones that form the contigs.

  Furthermore, the subject of the present invention is also a method for the isolation of a polynucleotide of interest present in a bacterium of the genus Legionella and absent in a bacterium of another genus, or present in a pathogenic bacterium of the genus Legionella and absent in a non-pathogenic bacterium of the genus Legionella, or present in a bacterium of the species Legionella pneumophila and absent in a bacterium of any other species of the genus Legionella, or present in a bacterium of the species Legionella pneumophila strain Paris and not present in a bacterium of the species Legionella pneumophila of any other strain, characterized in that it uses at least the BAC library deposited on November 19, 2003 (I-3138) at the CNCM according to the invention.

  Said method is preferably characterized in that it comprises the following steps: a) isolating at least one polynucleotide contained in a clone of said DNA library deposited at the CNCM on November 19, 2003, under the serial number I -3138; b) isolating: at least one genomic polynucleotide or cDNA of a second bacterium of another genus or of the genus Legionella, said second bacterium of the genus Legionella belonging to a strain different from the Paris strain or, alternatively, to the least one polynucleotide contained in a clone of a BAC-based DNA library prepared from the genome of a second bacterium of another genus or the genus Legionella, said second bacterium of the genus Legionella belonging to a strain different from the Paris strain; c) hybridizing the polynucleotide of step a) to the polynucleotide of step b); d) selecting the polynucleotides of step a) which did not form a hybridization complex with the polynucleotides of step b); and e) characterizing the selected polynucleotide.

  The polynucleotide of step a) can be prepared by digesting at least one BAC recombinant clone with an appropriate restriction enzyme, and optionally amplifying the resulting polynucleotide insert.

  Thus, the method of the invention enables those skilled in the art to perform comparative genomic studies between the different strains or species of the genus Legionella, for example between the pathogenic strains and their non-pathogenic equivalents.

  In particular, it is possible to study and determine the regions of polymorphism between said strains.

EXAMPLES

  Example 1: Materials and Methods 1. Construction of Banks Shotgun Bank of Small Fragments (Size 1, 5-2.5 kb) The chromosomal DNA of the strains studied was prepared by a conventional method including Proteinase K treatment and phenol extraction (9). About 36 μg of DNA was broken by nebulization (1 minute at 1 bar pressure) (4). The ends of the DNA fragments were made blunt by acting bacteriophage T4 DNA polymerase for 15 minutes at 37 ° C in the presence of the 4 nucleotides triphosphate. The enzyme was inactivated by 15 min incubation at 75 C. Adapters (Cat 408-18 invitrogen) were then ligated to these ends. After ligation, the chromosomal DNA fragments having a size between 1500 and 2500 base pairs were purified after agarose gel electrophoresis. The vector used for the construction of the library, pcDNA2.1 (Invitrogen), was digested with the BstX1 enzyme and purified by geneclean (BIO-101) after agarose gel electrophoresis. The chromosomal DNA and the purified vector were ligated by the action of bacteriophage T4 ligase. The ligation mixture was introduced by transformation into the strain Escherichia coli XL2-blue (Stratagene). About 4000 colonies are obtained per μl of the ligation mixture.

  Bank fragment means (size 5 to 10 kb) The bank was built by the technique of partial fill in 'in the vector pSYX34 (12). The chromosomal DNA of the L. pneumophila Paris strain was prepared by partial digestion with SauIIIA (Roche). After precipitation of the DNA with sodium acetate and the partial fill-in step with nucleotides A and G using the Klenow enzyme, the chromosomal DNA fragments having a size of between 5,000 and 10,000 pairs of bases were purified after electrophoresis on agarose gel and geneclean.

  The vector is prepared in the same way by partial digestion with the enzyme Salt, precipitation with sodium acetate and then reaction of partial fill-in with nucleotides C and T and purification on agarose gel and geneclean. The chromosomal DNA fragments and the purified vector were ligated by the action of bacteriophage T4 ligase. The ligation mixture was introduced by transformation into Escherichia coli strain XL10-Gold (Stratagene). About 4000 colonies are obtained per μl of the ligation mixture. Both ends of about 4000 fragments of this library were sequenced.

  Large fragment library (size 25 to 90 kb) The large fragment library was constructed as previously described (4) using the pIndigo BAC vector (Epicenter). Briefly, to avoid mechanical breakage of the DNA molecules the cells have been included in agarose blocks in which DNA extraction is directly performed. For the preparation of large fragments, we performed a partial digestion with HindIII (Roche) and separation by pulsed field electrophoresis. Size fragments between 40 and 80 and between 80 and 130 kb were cut from the gel, purified by agarase treatment and ligated with the vector. The ligation mixture was introduced by electroporation into Escherichia coli strain DH10B (Gibco BRL). 1300 colonies were stored. The plasmid DNAs from these 1300 colonies were extracted and both ends of the cloned fragments were sequenced.

  2. Preparation of Plasmids and Sequencing

  The plasmids were prepared by a semi-automatic preparation method developed in the GMP laboratory based on the alkaline lysis method (2). Chromosomal inserts were sequenced from both ends using T7 and universal primer according to the supplier's recommendations (Applied-Biosystems). The sequences were determined using 3700 automatic sequencers (Applied-Biosystem).

3. Assembly of the sequences.

  The sequences were assembled using the software package developed at the University of Washington, Phred, Phrap and Consed (5, 8). The finishing of the sequence was carried out using the CAATbox (7) software package. The finishing step is resequencing regions where the sequence is unsafe and sequencing regions between contigs. It was performed either by sequencing PCR products or by walking on clones of the library. Oligonucleotide sequences were defined using the consed and Primo software (8, 10).

4. Annotation of sequences.

  The identification of the coding phases (CDS) was carried out using the CAAT-box (7) software package. This program combines the results of different methods: - (i) the identification of open reading phases and their sorting according to their size; - (ii) analysis of the probability of being coding using the Genemark software (11); (iii) identifying a start of translation (initiation codon and ribosome binding sequence); and (iv) the% identity of the protein sequence deduced with the protein sequences contained in the sequence libraries using the BLASTP software.

  The functions of the proteins encoded by the identified coding phases were predicted by analyzing the similarity finding results in the non-redundant NCBI library (http://www.ncbi.nlm.nih.gov/BLAST/). using the BLASTP (1) software.

  5. Genome comparison identification of specific CDS strain of L. pneumophila strain Paris.

  The set of protein sequences deduced from the predicted coding phases of each genome was compared to the set of protein sequences possibly coded by the other genome using the BLASTP software. A 75% identity threshold over the entire length of the protein was retained to identify the specific proteins of an isolate. This very high value was chosen because it allows the best to discriminate the orthologous genes from the paralogs genes (6). For protein sequences for which sequence conservation is high (> 70%) the conservation of the nucleotide sequences of the genes will also be high and could give a signal under low stringency hybridization conditions. This eventuality will have to be taken into account in the analysis of the test result.

  Example 2: Deposit of biological material The following organizations were deposited on November 19, 2003 at the National Collection of Cultures of Microorganisms (CNCM), 25 rue du Docteur Roux, 75724 Paris Cedex 15, France, according to the provisions of the Budapest Treaty: Clone of a shotgun library, cloned into the pCDNA vector, of the genome of Legionella pneumophila strain Paris (Collection of Pasteur Institute CIP 107-629-T), registered under the deposit number I-3137. The insert of this clone has a size of 14.2 kb and contains a gene coding for an autotransporter named led0019AO7; BAC library of DNA (1248 clones) of the genome of Legionella pneumophila strain Paris (Collection of Pasteur Institute CIP 107-629-T), registered under the deposit number I-3138. Said BAC library (I-3138) was carried out in E. coli strain DH10B (Grant et al., PNAS, 87, 4645, 1990). The inserts of this library were cloned into the pBelo BAC-Kan vector (Mozo et al., Mol Gen. Genet., 1998, 258, 562-70) and have an average size of between 1.5 and 2.5. kb. All of these inserts correspond to a complete coverage of the genome.

  Example 3 Annotations of Sequences 1. Genes specific for L. pneumophila strain Paris with respect to L. pneumophila strain Philadelphia No significant identity between the nucleotide sequence of the L. pneumophila strain of the Paris strain and the genome of L. pneumophila strain Philadelphia .

  Table VII: Example of annotation of sequences in the case of nucleic acid and protein sequences of L. pneumophila strain Paris showing no significant identity% with respectively protein and nucleic acid sequences of L. pneumophila Philadelphia strain No. IPF of the gene No. IPF of the L. gene identity% identity of pneumophila strain sequence sequences L. pneumophila Philadelphia nucleotide protein strain Paris (highest score) 2043.1 - - - 2094.2 - _ _ 2039.1 - - _ 2051.2 3061.1 33 % not significant 3425.1 5305.1 32% not significant 2. Genes common to both L. pneumophila strains, strain Paris and Philadelphia strain, for which the% identity of the nucleic and protein sequences deduced is less than 75% Table VIII: Example of annotation of sequences in the case of protein sequences and nucleic acid genes common to both strains L. pneumophila strain Paris and Philadelphia strain for which the% of ide Nitity of the deduced nucleic and protein sequences is less than 75% IPF No. of gene No. IPF of L. gene% Identity% identity of pneumophila strain sequence sequences L. pneumophila Philadelphia protein nucleotidic strain best score) 2244.2 3793.1 63% 59% 258.2 1342.1 60% 59% 3. Genes common to L. pneumophila strain Paris and Philadelphia strain for which the% identity of the nucleic and protein sequences deduced is greater than 75% Table IX: Example of sequence annotation in the case of protein sequences and nucleic acid genes common to both strains L. pneumophila strain Paris and Philadelphia strain for which the% identity of the nucleic and protein deduced sequences is greater than 75% No. IPF of the gene TF No. of the gene of a% L. pneumophila L. pneumophila strain / o identity / o identity of the strain Paris Philadelphia sequence sequences (best score) protei Nucleotide samples 4629.2 133.1 100% 100% 6079.1 4147.1 90% 88% EXAMPLE 4 Example of sequence alignment Ci- after the sequence alignments conserved in the Paris and Philadelphia strains are presented. For each of the following six examples, we present an alignment of the nucleotide sequences as well as an alignment of the amino acid sequences. The alignment of the amino acid sequences is obtained by aligning the translated ORF sequence present in the Paris strain with the sequence resulting from the translation in the six phases of the contigs of the Philadelphia sequence. The sequence homology of these ORFs present in the two strains is very strong, both in amino acids and in nucleotides.

  TBLASTN 2.2.6 [Apr-09-2003] Query = 1764.3 CONTIG = Contig42 POSCDS1 = 13736 POSCDS2 = 14869 SENS = p, Seq Id: 555 (216 letters) Database: contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value LpPhiladelphia Contig49 433 e-123> LpPhiladelphia_Contig49 Length = 376826 Score = 433 bits (1114), Expect = e-123 Identities = 215/215 (100%) , Positives = 215/215 (100%) Frame = -2 Query: 1 HLALFDETYIKTILILLSICVLKKFILRYDMILNDIVLYDNFFMTFDYKDNFMSKGPYQS 60

  HLALFDETYIKTILILLSICVLKKFILRYDMILNDIVLYDNFFMTFDYKDNFMSKGPYQS

  Sbjct: 297565 HLALFDETYIKTILILLSICVLKKFILRYDMILNDIVLYDNFFMTFDYKDNFMSKGPYQS 297386 Query: 61 FANRLISALKDRGYTASRSPNGICIKTLAEFTGASEQICRRYIRGDALPDYEKVKQLAFH 120

  FANRLISALKDRGYTASRSPNGICIKTLAEFTGASEQICRRYIRGDALPDYEKVKQLAFH

  Sbjct: 297385 FANRLISALKDRGYTASRSPNGICIKTLAEFTGASEQICRRYIRGDALPDYEKVKQLAFH 297206 Query: 121 LQVNPGWLLFGEDENATTKKNEVDEKLLHYILKQSHHLYPISQGSNDDYADFVLGLIKEV 18 0

  LQVNPGWLLFGEDENATTKKNEVDEKLLHYILKQSHHLYPISQGSNDDYADFVLGLIKEV

  Sbjct: 297205 LQVNPGWLLFGEDENATTKKNEVDEKLLHYILKQSHHLYPISQGSNDDYADFVLGLIKEV 297026 Query: 181 KAIDTSENNLLKIIDLAIGSISSYEEKRKKHSHAV 215

KAIDTSENNLLKIIDLAIGSISSYEEKRKKHSHAV

  Sbjct: 297025 KAIDTSENNLLKIIDLAIGSISSYEEKRKKHSHAV 296921 Database: contigsLpPhiladelphia Posted date: Nov 20, 2003 10:38 AM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 0.402 0.321 0.139 Gapped KH 0.140 Lambda 0.0410 0.267 Matrix: BLOSUM62 Query = 1764.3 CONTIG = Contig42 POSCDS1 = 13736 POSCDS2 = 14869 SENS = p (1134 letters) Database: / home / Gmp / rusniok / projects / legionella / forBrevet191103 / contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching done Score E Sequences producing significant alignments: (bits) Value LpPhiladelphia Contig35 2248 0.0> LpPhiladelphia_Contig35 Length = 48622 Score = 2248 bits (1134), Expect = 0.0 Identities = 1134/1134 (100%) Strand = More / More Query: 1 atgatcagaaaaataatttatgttacaggtactcgtgccgattatggactgatgagagaa 60 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 l IIIIIIIIIII11111 1111111111111 Sbjct: 7091 atgatcagaaaaataatttatgttacaggtactcgtgccgattatggactgatgagagaa 7150 Query: 61 gtactaaaaagattacaccagtcagaagacattgacttatcgatttgtgtcactggtatg 120 IIIIIIIIIIIIIIII1111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIII Sbjct: 7151 gtactaaaaagattacaccagtcagaagacattgacttatcgatttgtgtctggtatg 7210 Query: 121 catcttgatgctttgtatggaaatacagttaacgaaattaaagcagatcagttctcaata 180 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbctu: 7211 catcttgatgctttgtatggaaatacagttaacgaaattaaagcaga tcagttctcaata 7270 Query: 181 tgcggcattattcctgttgatcttgccaatgctcagcatagttctatggcaaaagctatc 240 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7271 tgcggcattattcctgttgatcttgccaatgctcagcatagttctatggcaaaagctatc 7330 Query: 241 ggccatgaacttttgggattcaccgaggtattcgaaagtgaaactcctgatgtcgtttta 300 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7331 ggccatgaacttttgggattcaccgaggtattcgaaagtgaaactcctgatgtcgtttta 7390 Query: 301 ttgctgggagatcgaggagaaatgcttgctgcggccatagcagcgatacatttaaatatc 360 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7391 ttgctgggagatcgaggagaaatgcttgctgcggccatagcagcgatacatttaaatatc 7450 Query: 361 ccggttgtacatctgcacggaggagagcgctctggaaccgttgatgaaatggtaaggcat 420 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7451 ccggttgtacatctgcacggaggagagcgctctggaaccgttgatgaaatggtaaggcat 7510 Query: 421 gcgatttccaaattatctcattatcattttgtcgcaacagaggcatccaaacaacgattg 480 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7511 gcgatttccaaattatctcattatcattttgtcgcaacagaggcatccaaacaacgattg 7570 Query: 481 attagaatgggtgagaaagaagaaaccatttttcaggttggtgctccaggcttggatgaa 540 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7571 attagaatgggtgagaaagaagaaaccatttttcaggttggtgctccaggcttggatgaa 7630 Query: 541 atcatgcagtataaaacgtctacacgtgatgtgtttaatcaacgttatggatttgatcct 600 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7631 atcatgcagtataaaacgtctacacgtgatgtgtttaatcaacgttatggatttgatcct 7690 Query: 601 gacaaaaaaatctgtttattaatctatcacccggttgttcaagaagttgact cgattaaa 660 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7691 gacaaaaaaatctgtttattaatctatcacccggttgttcaagaagttgactcgattaaa 7750 Query: 661 attcaatttcaaagcgtgattcaggcagcactcgctacaaatttacagattatttgcctt 720 IIII 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III 1 1 1 1 1 1 1 1 111 111111IIIII Sbjct: 7751 attcaatttcaaagcgtgattcaggcagcactcgctacaaatttacagattatttgcctt 7810 Query: 721 gagcctaattccgatacgggtggtcatttaattcgagaagtgattcaggaatatattgat 780 III111111111111111111111111111111111111111111111111111111III Sbjct: 7811 gagcctaattccgatacgggtggtcatttaattcgagaagtgattcaggaatatattgat 7870 Query: 781 catcctgatgttagaattatcaagcacttacatcgtccggaatttattgattgtcttgca 84 0 III1111111111111111111111IIIIIII111111111111111111IIIIIIIIII Sbjct: 7871 catcctgatgttagaattatcaagcacttacatcgtccggaatttattgattgtcttgca 7930 Query: 841 aattctgatgtgatgctgggaaattccagtagtggcatcatagaggcagcctcatttaac 90 0 III11111111111II1111 1 IIIIII1111111111 11 1 1 1 1 11111111111 II Sbjct: 7931 aattctgatgtgatgctgggaaattccagtagtggcatcatagaggcagcctcatttaac 7990 Query: 901 ctgaacgtagttaatgttggaagcaggcaaaatttaagagaacgaagcgacaatgtcatt 960 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 7991 ctgaacgtagttaatgttggaagcaggcaaaatttaagagaacgaagcgacaatgtcatt 8050 Query: 961 gatgttgatgttacttatgatgctattttgactggtctaagagaagcgctaaataaaccc 1020 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 8051 gatgttgatgttacttatgatgctattttgactggtctaagagaagcgctaaataaaccc 8110 Query: 1021 aagataaaatactctaactgttatggggatggaaaaacgagtgaaaggtgttatcaattg 1080 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 8111 aagataaaatactctaactgttatggggatggaaaaacgagtgaaaggtgttatcaattg 8170 Query: 1081 ttaaaaactatccctttgcactcacaaatattgaataaatgc aatgcatactaa 1134 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 8171 ttaaaaactatccctttgcactcacaaatattgaataaatgcaatgcatactaa 8224 --------------------------------------- ------------------------ TBLASTN 2. 2.6 [Apr-09-2003] Query- 1864.3 CONTIG = Contig42 POSCDS1 = 77740 POSCDS2 = 79155 SENS = p , Seq Id: 622 (489 letters) Database: contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching.done Sequences producing significant alignments: LpPhiladelphia Contig49> LpPhiladelphia_Contig49 Length = 376826 Score = 1003 bits (2594), Expect = 0.0 Identities = 488/488 (100%), Positives = 488/488 (100%) Score E (bits) Value 1003 0.0 Frame = +2 Query: 1 KLSLPLIRLWQLSRSKHMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEH 60

  KLSLPLIRLWQLSRSKHMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEH

  Sbjct: 21029 KLSLPLIRLWQLSRSKHMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEH 21208 Query: 61 GYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEM 120

  GYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEM

  Sbjct: 21209 GYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEM 21388 Query: 121 SGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEE 18 0

  SGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEE

  Sbjct: 21389 SGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEE 21568 Query: 181 SGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVH 24 0

  SGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVH

  Sbjct: 21569 SGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVH 21748 Query: 241 SGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYS 30 0

  SGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYS

  Sbjct: 21749 SGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYS 21928 Query: 301 EFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPP 36 0

  EFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPP

  Sbjct: 21929 EFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPP 22108 Query: 361 LVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDK 42 0

  LVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDK

  Sbjct: 22109 LVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDK 22288 Query: 421 PAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYV 48 0

  PAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYV

  Sbjct: 22289 PAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYV 22468 Query: 481 LYSFSQKK 488 LYSFSQKK Sbjct: 22469 LYSFSQKK 22492 Database: contigsLpPhiladelphia Posted date: Nov 20, 2003 10:38 AM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 0.419 0.318 0.136 Gapped KH 0.140 Lambda 0.0410 0.267 Matrix: BLOSUM62 Query = 1864.3 CONTIG = Contig42 POSCDS1 = 77740 POSCDS2 = 79155 SENS = p (1416 letters) Database: / home / Gmp / rusniok / projects / legionella / forBrevet191103 / contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching done Score E Sequences producing significant alignments: (bits) Value LpPhiladelphia Contig49 2807 0.0> LpPhiladelphia_Contig49 Length = 376826 Score = 2807 bits (1416), Expect = 0.0 Identities = 1416/1416 (100%) Strand = More / More Query: 1 atgttcaaaccccaaggattgtatgattacatatgccaacagtggcaagaagagatattg 60 Sbjct: 21080 atgttcaaaccccaaggattgtatgattacatatgccaacagtggcaagaagagatattg 21139 Query: 61 ccaagtttatgtgactacataaaaatccctaataaatctcctcactttgatgcaaaatgg 120 1111111 1 1 1 1 11111111 1 1111111 1 1 1 1 1 1 1 1 1 1 1 1 111111111111111 1111 1 Sbjct: 21140 ccaagtttatgtgactacataaaaatccctaataaatctcctcactttgatgcaaaatgg 21199 Query: 121 gaagaacatggttatatggagcaggcagttaatcacattgccaattggtgtaagtcgcat 180 It 1111111111 II 1111111111 l 1 1 1 1 1 1 1 1 1 11111 111 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21200gaagaacatggttatatggagcaggcagttaatcacattgccaattggtgtaagtcgcat 21259 Query: 181 gctcccaaaggaatgactctggaaattgttcgcctgaaaaataggactccattactattt 240 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21260 gctcccaaaggaatgactctggaaattgttcgcctgaaaaataggactccattactattt 21319 Query: 241 atggaaattccaggccaaattgatgacactgtgttgctttatgggcacttggataaacaa 300 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21320 atggaaattccaggccaaattgatgacactgtgttgctttatgggcacttggataaacaa 21379 Query: 301 cctgagatgtcaggctggagtgacgatttacatccatggaaacccgtattgaaaaatgga 360 I11111111111111111111111111111111111111111111111111111111) 11 Sbjct: 21380 cctgagatgtcaggctggagtgacgatttacatccatggaaacccgtattgaaaaatgga 21439 Query: 361 ttgttatacggaagaggaggggcagatgatggatattctgcttatgcatcactcacggct 420 It 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21440 ttgttatacggaagaggaggggcagatgatggatattctgcttatgcatcactcacggct 21499 Query: 421 attcgcgccttggaacagcaaggtttgccatatcctcgttgtatatta atcatcgaagcg 480 Il 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21500 attcgcgccttggaacagcaaggtttgccatatcctcgttgtatattaatcatcgaagcg 21559 Query: 481 tgtgaggaaagtggcagttacgatttgcctttttatattgagttgctgaaagagcgtatt 540 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21560 tgtgaggaaagtggcagttacgatttgcctttttatattgagttgctgaaagagcgtatt 21619 Query: 541 ggtaaaccatcattggttatttgtcttgattccggagcaggtaattatgagcagttatgg 60 0 III 111111111111111111111111111111111111111111111111111111) 11 Sbjct: 21620 ggtaaaccatcattggttatttgtcttgattccggagcaggtaattatgagcagttatgg 21679 Query: 601 atgactacgtcattacgcggtaatttggtcggtaagttaactgttgaattaattaatgag 66 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21680 atgactacgtcattacgcggtaatttggtcggtaagttaactgttgaattaattaatgag 21739 Query: 661 g gcgttcattctgggagcgccagtggtatagtggcagacagtttcagagtagctcggcaa 720 1111111111111111111111111111 IIII11111111111III11111111111 I Sbjct: 21740 ggcgttcattctgggagcgccagtggtatagtggcagacagtttcagagtagctcggcaa 21799 Query: 721 ttgatcagcaggatagaggacgaaaacaccggagagataaaattacctcagttgtattgt 780 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 111111111111111111IIIIIIIIIIII11111 1111 11 Sbjct: 21800 ttgatcagcaggatagaggacgaaaacaccggagagataaaattacctcagttgtattgt 21859 Query: 781 gatattcctgatgagagaataaaacaagcgaaacaatgtgcggaaattctaggtgaacaa 840 1111111 IIII11111 IIIIIIIIIIII11111111111 January 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21860 gatattcctgatgagagaataaaacaagcgaaacaatgtgcggaaattctaggtgaacaa 21919 Query: 841 gtttatagcgaatttccatggatagattctgccaaacccgttattcaagacaaacagcaa 900 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 21920 gtttatagcgaatttccatggatagattctgccaaacccgttattcaagacaaacagcaa 21979 Query: 901 ttaatattaaacagaacatggcgccctgccttgacggtgactggtgcagatgggtttcca 960 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21980 ttaatattaaacagaacatggcgccctgccttgacggtgactggtgcagatgggtttcca 22039 Query: 961 gcgatagctgatgcagggaacgtaatgcgccctgttacgtctttgaaattatccatgcgc 1020 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 22040 gcgatagctgatgcagggaacgtaatgcgccctgttacgtctttgaaattatccatgcgc 22099 Query: 1021 cttccaccactggttgatccagaagcagcttctgttgctatggaaaaagccctgacccaa 1080 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 22100 cttccaccactggttgatccagaagcagcttctgttgctatggaaaaagccctgacccaa 22159 Query: 1081 aaccctccctataatgcaaaggttgattttaaaatacaaaatggagggtccaagggatgg 1140 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Scope: 22160 aaccctccctataatgcaaaggttgattttaaaatacaaaatggagggtccaagggatgg 22219 Query : 1141 aatgctcctttgctttccgattggttagcgaaagcggcatctgaagca 1,1 1 1,1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 22220 aatgctcctttgctttccgattggttagcgaatagcggcatctgaagcatcaatgatatat 22279 Query: 1201 tatgataaacctgctgcttacatgggagaggggggcaccattccatttatgagtatgcta 1260 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 22280 tatgataaacctgctgcttacatgggagaggggggcaccattccatttatgagtatgcta 22339 Query: 1261 ggcgagcaatttcccaaagcacaatttatgataactggtgttttaggcccccattccaat 1320 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 22340 ggcgagcaatttcccaaagcacaatttatgataactggtgttttaggcccccattccaat 22399 Query: 1321 gctcatggtccgaacgagttcttacatttggacatggtaaaaaaactcacctcatgtgtc 1380 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 22400 gctcatggtccgaac gagttcttacatttggacatggtaaaaaaactcacctcatgtgtc 22459 Query: 1381 tcgtacgttctttatagtttttcacagaaaaaataa 1416 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 22460 tcgtacgttctttatagtttttcacagaaaaaataa 22495

  -------------------------------------------------- -------------

  TBLASTN 2.2.6 [Apr-09-2003] Query = 1865.3 CONTIG = Contig42 POSCDS1 = 76674 POSCDS2 = 77765 SENS = p, Seq Id: 623 (367 letters) Database: contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching.done Sequences producing significant alignments: LpPhiladelphia Contig49> LpPhiladelphia_Contig49 Length = 376826 Score = 718 bits (1853), Expect = 0.0 Identities = 366/366 (100%), Positives = 366/366 (100%) Frame = +1 Query: 1 GNIMSPSIVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPLDIPFHGV 60

  GNIMSPSIVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPLDIPFHGV

  Sbjct: 20005 GNIMSPSIVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPLDIPFHGV 20184 Query: 61 SSGKLRRYFSLKNLLDPFKIVLGIIQSSLLFYKIKPDVVFSKGGFVAFPVVVGAWLNRIP 120

  SSGKLRRYFSLKNLLDPFKIVLGIIQSSLLFYKIKPDVVFSKGGFVAFPVVVGAWLNRIP

  Sbjct: 20185 SSGKLRRYFSLKNLLDPFKIVLGIIQSSLLFYKIKPDVVFSKGGFVAFPVVVGAWLNRIP 20364 Query: 121 VVAHESDMSPGLANRLSFPFVNKICLTFDAGKKYFKRQDKIEVTGTPIRQQLLTGNRMKG 18 0

  VVAHESDMSPGLANRLSFPFVNKICLTFDAGKKYFKRQDKIEVTGTPIRQQLLTGNRMKG

  Sbjct: 20365 VVAHESDMSPGLANRLSFPFVNKICLTFDAGKKYFKRQDKIEVTGTPIRQQLLTGNRMKG 20544 Query: 181 LELCGFNSSKPCLLVVGGSLGAGSINSCIRSALKQLTSEFQVIHLCGKGKLDSSLVGVEG 24 0

  LELCGFNSSKPCLLVVGGSLGAGSINSCIRSALKQLTSEFQVIHLCGKGKLDSSLVGVEG

  Sbjct: 20545 LELCGFNSSKPCLLVVGGSLGAGSINSCIRSALKQLTSEFQVIHLCGKGKLDSSLVGVEG 20724 Query: 241 YCQFEYANEELADLFAASSVVISRAGANSLYEILALGKPHILIPISSQVSRGDQIQNARY 30 0

  YCQFEYANEELADLFAASSVVISRAGANSLYEILALGKPHILIPISSQVSRGDQIQNARY

  Sbjct: 20725 YCQFEYANEELADLFAASSVVISRAGANSLYEILALGKPHILIPISSQVSRGDQIQNARY 20904 Query: 301 FQGLGISVVIQDELLKADVLLQAVQDVMRKKDEIDNKIKALKIESATDKIVAIIKEQAHV 36 0

  FQGLGISVVIQDELLKADVLLQAVQDVMRKKDEIDNKIKALKIESATDKIVAIIKEQAHV

  Sbjct: 20905 FQGLGISVVIQDELLKADVLLQAVQDVMRKKDEIDNKIKIKIESATDKIVAIIKEQAHV 21084 Query: 361 QTPRIV 366 QTPRIV Sbjct: 21085 QTPRIV 21102 Database: contigsLpPhiladelphia Posted date: Nov 20, 2003 10:38 AM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 0.399 0.321 0.139 Gapped KH 0.140 Lambda 0.0410 0.267 E-score (bits) Value 718 0.0 Matrix: BLOSUM62 Query = 1865.3 CONTIG = Contig42 POSCDS1 = 76674 POSCDS2 = 77765 SENS = p (1092 letters) Database: / home / Gmp / rusniok / projects / legionella / forBrevet191103 / contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching done Sequences producing significant alignments: LpPhiladelphia Contig49> LpPhiladelphia_Contig49 Length = 376826 Score = 2165 bits (1092), Expect = 0.0 Identities = 1092/1092 (100%) Strand = More / More Query: 1 atgagcccaagtattgtttttaccgggggaggaactgccggacatgtaacgcctaatatc 60 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 1111111 1 1 1 mgbt: 20014 atgagcccaagtattgtttttaccgggggaggaactgccggacatgtaacgcctaatatc 20073 Query: 61 gctttgattaaggaatttcgaaaagaaggctggaatgtagaatatatcggctctgtttcc 120 1 1 1 1 1 1 1 111111111111 1 1 11111111111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111 I Sbjct: 20074 gctttgattaaggaatttcgaaaagaaggctggaatgtagaatatatcggctctgtttcc 20133 Query: 121 ggaattgaaaaggagatgattgagccgctggacattccttttcatggggtcagtagcggt 180 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIII Sbjct: 20134 ggaattgaaaaggagatgattgagccgctggacattccttttcatggggtcagtagcgg t 20193 Query: 181 aaattgcgcaggtattttagtttgaagaacttgcttgatcctttcaaaattgttctggga 240 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20194 aaattgcgcaggtattttagtttgaagaacttgcttgatcctttcaaaattgttctggga 20253 Query: 241 attattcaatcttctttgctattttataaaatcaaacccgatgtggttttttcaaaaggt 300 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20254 Attattcaatcttctttgctattttataaaatcaaacccgatgtggttttttcaaaaggt 20313 Query: 301 ggctttgtagcctttcctgtggttgtaggcgcctggttaaatcgaattcctgttgtcgct 360 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20314 ggctttgtagcctttcctgtggttgtaggcgcctggttaaatcgaattcctgttgtcgct 20373 Query: 361 catgagtctgatatgagcccaggacttgcgaatcgcctatcctttcctttcgtcaataaa 420 11111111111111111111111111111111111 January 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct : 20374 catgagtctgatatgagcccaggacttgcgaatcgcctatcctttcctttcgtcaataaa 20433 Query: 421 atatgtcttacttttgatgctggcaaaaaatactttaagcgtcaggataaaatagaagtg 480 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20434 atatgtcttacttttgatgctggcaaaaaatactttaagcgtcaggataaaatagaagtg 20493 Score E {bits) Value 2165 0.0 Query: 481 acgggtactccaattcgtcaacagctattaactggaaatcgaatgaaaggattggagtta 540 11111111111111 1 1 1 1 1 1 1 1 1 1 1 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III Sbjct: 20494 acgggtactccaattcgtcaacagctattaactggaaatcgaatgaaaggattggagtta 20553 Query: 541 tgcggatttaattcctccaaaccttgcctgcttgtagtgggaggaagcttaggggctggt 600 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20554 tgcggatttaattcctccaaaccttgcctgcttgtagtgggaggaagcttaggggctggt 20613 Query : 601 tcaattaacagttgtattcgaagcgcattgaaacaattgacatcagaatttcaagtcatt 660 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct : 20614 tcaattaacagttgtattcgaagcgcattgaaacaattgacatcagaatttcaagtcatt 20673 Query: 661 catctttgtggcaagggaaaacttgattcttcattggttggtgtggagggatattgccaa 720 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20674 catctttgtggcaagggaaaacttgattcttcattgttggtgtggagggatattgccaa 20733 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20734 tttgaatacgccaatgaagaggggggtgtctgttcgctgcttcttctgtggtgatttct 20793 Query: 781 cgagcaggagctaattctttgtatgatatagcattaggaaaaccacatatcttaatt 840 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20794 cgagcaggagctaattctttgtatgaaatattagcattaggaaaaccacatatcttaatt 2 0853 Query: 841 ccaatctcttcacaagtaagcagaggagatcaaattcagaatgcaaggtacttccaggga 900 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20854 ccaatctcttcacaagtaagcagaggagatcaaattcagaatgcaaggtacttccaggga 20913 Query: 901 ttgggaataagcgttgtgattcaggacgagttattgaaagctgatgttctattacaggca 960 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20914 ttgggaataagcgttgtgattcaggacgagttattgaaagctgatgttctattacaggca 20973 Query: 961 gtacaggacgtaatgcgaaaaaaagatgaaatagataataaaatcaaagcattaaaaatt 1020 1111111111111111111111111111111111IIII111111111111111111IIII Sbjct: 20974 gtacaggacgtaatgcgaaaaaaagatgaaatagataataaaatcaaagcattaaaaatt 21033 Inquiry: 1021 1080 gagtctgccactgataagattgtggcaattatcaaggagcaagcacatgttcaaacccca 11111111111111111111111111111111111111111111111111111111111I Sbjct: 21034 21093 gagtctgccactgataagattgtggcaattatcaaggagcaagcacatgttcaaacccca Query: 1081 aggattgtatga 1092 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 21094 aggattgtatga 21105 ------------------------------ --------------------------------- TBLASTN 2. 2.6 [Apr-09-2003] Query- 2066.5 CONTIG = Contig46 POSCDS1 = 56766 POSCDS2 = 57173 SENS = p, Seq Id: 732 (150 letters) Database: contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching.done Sequences producing significant alignments: LpPhiladelphia Contig49> LpPhiladelphia_Contig49 Length = 376826 Score = 323 bits (828), Expect = 4e-90 Identities = 149/149 (100%), Positives = 149/149 (100%) Frame = +1 Query: 1 IMYLRLLALSALCFVTSPIWSFTCIYTLVKDNCWTDYDVTVDVIEDSTSKTLLTLTAPKG 60

  IMYLRLLALSALCFVTSPIWSFTCIYTLVKDNCWTDYDVTVDVIEDSTSKTLLTLTAPKG

  Sbjct: 89377 IMYLRLLALSALCFVTSPIWSFTCIYTLVKDNCWTDYDVTVDVIEDSTSKTLLTLTAPKG 89556 Query: 61 KSWARGTFNCEAAEGLRYVAQFSPVFWQNDVGKTYPALRNWYLPAKVNPGDLAWTIPVCF 120

  KSWARGTFNCEAAEGLRYVAQFSPVFWQNDVGKTYPALRNWYLPAKVNPGDLAWTIPVCF

  Sbjct: 89557 KSWARGTFNCEAAEGLRYVAQFSPVFWQNDVGKTYPALRNWYLPAKVNPGDLAWTIPVCF 89736 Query: 121 PADFAQVPFPPNVAGNCKCNFKNIPDPKL 149

PADFAQVPFPPNVAGNCKCNFKNIPDPKL

  : 89737 PADFAQVPFPPNVAGNCKCNFKNIPDPKL 89823 Database: contigsLpPhiladelphia Posted date: Nov 20, 2003 10:38 AM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 0.473 0.323 0.138 Gapped KH 0.140 Lambda 0.0410 0.267 Matrix: BLOSUM62 Query = 2066.5 CONTIG = Contig46 POSCDS1 = 56766 POSCDS2 = 57173 SENS = p (408 letters) Database: / home / Gmp / rusniok / projects / legionella / forBrevet191103 / contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching done Score E Sequences producing significant alignments: (bits) Value LpPhiladelphia Contig49 809 0.0> LpPhiladelphia_Contig49 Length = 376826 Score = 809 bits (408), Expect = 0.0 Identities = 408/408 (100%) E-score (bits) Value 323 4e-90 Strand = Plus / More Query: 1 gtgactagcccaatttggtctttcacatgcatctatactttggttaaagacaattgttgg 60 IIII111111111111111111111111111111111111III1111111111 1 1 1 1 1 1 Sbjct: 89419 gtgactagcccaatttggtctttcacatgcatctatactttggttaaagacaattgttgg 89478 Query: 61 actgattatgatgttactgtcgatgtcattgaagattctacgtcaaaaactttgttgaca 120 111111111111111111111111111111111111111111111111111111IIIIII Sbjct: 89479 actgattatgatgttactgtcgatgtcattgaagattctacgtcaaaaactttgttgaca 89 538 Query: 121 cttaccgctcccaaaggaaaatcatgggctagaggtactttcaattgtgaggctgctgaa 180 II111111IIIIIIIIIIIII111111111111111111IIIIIIIIIIII111111111 Sbjct: 89 539 cttaccgctcccaaaggaaaatcatgggctagaggtactttcaattgtgaggctgctgaa 89 598 Query : 181 gggttgagatatgtcgctcaattttcgcctgtcttttggcaaa atgatgttggaaaaact 240 111111111 11 1 1 1 1 1 III 1111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I IIIIIIIIII Sbjct: 89599 gggttgagatatgtcgctcaattttcgcctgtcttttggcaaaatgatgttggaaaaact 89658 Query: 241 tacccggcattaagaaattggtatttaccagcaaaagtgaatcctggagatttggcctgg 300 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 January 1 Sbjct: 89 659 tacccggcattaagaaattggtatttaccagcaaaagtgaatcctggagatttggcctgg 89718 Query: 301 actatcccggtttgttttccggcagattttgctcaagttccctttccacctaatgtagca 360 111111111111111111111111111111111111111111111III11111111111I Sbjct: 89719 actatcccggtttgttttccggcagattttgctcaagttccctttccacctaatgtagca 89778 Query: 361 ggaaactgtaagtgcaacttcaagaacattcctgatcccaagctttaa 408 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 89779 ggaaactgtaagtgcaacttcaagaacattcctgatcccaagctttaa 89826 ------------------------ --------------------------------------- TBLASTN 2. 2.6 [Apr-09-2003] Query = 3159.2 CONTIG = Contig46 POSCDS1 = 34563 POSCDS2 = 35318 SENS = p, Seq Id: 1433 (265 letters) Database: contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching.done Sequences producing significant alignments: LpPhiladelphia_Contig49> LpPhiladelphia_Contig49 Length = 376826 Score = 537 bits (1383), Expect = e-154 Identities = 264/264 (100%), Positives = 264/264 (100%) Frame = + 1 E-score (bits) Value 537 e-154 Query: 1 CVVESFFLILLFPMWKILYQLASPKNFYNYAGRLIPWLAVSALTTMAIGMVWGLVFAPPD 60

  CVVESFFLILLFPMWKILYQLASPKNFYNYAGRLIPWLAVSALTTMAIGMVWGLVFAPPD

  Sbjct: 67177 CVVESFFLILLFPMWKILYQLASPKNFYNYAGRLIPWLAVSALTTMAIGMVWGLVFAPPD 67356 Query: 61 YQQGDAYRIIFVHVPSAFLSMALYAWMGFLAILLLVWRIKMAGLLIHKVAQLGACMAFLA 120

  YQQGDAYRIIFVHVPSAFLSMALYAWMGFLAILLLVWRIKMAGLLIHKVAQLGACMAFLA

  Sbjct: 67357 YQQGDAYRIIFVHVPSAFLSMALYAWMGFLAILLLVWRIKMAGLLIHKVAQLGACMAFLA 67536 Query: 121 LITGSIWGKPMWGAWWVWDARLTSELILLLLYLAILATYQAVKNKEDGDKIIAILALVGL 18 0

  LITGSIWGKPMWGAWWVWDARLTSELILLLLYLAILATYQAVKNKEDGDKIIAILALVGL

  Sbjct: 67537 LITGSIWGKPMWGAWWVWDARLTSELILLLLYLAILATYQAVKNKEDGDKIIAILALVGL 67716 Query: 181 IDLPIIHYSVYWWNTLHQGATLSVFAKPKIALSMLYPLLITLLGFFLYSLWIILEKARNE 24 0

  IDLPIIHYSVYWWNTLHQGATLSVFAKPKIALSMLYPLLITLLGFFLYSLWIILEKARNE

  Sbjct: 67717 IDLPIIHYSVYWWNTLHQGATLSVFAKPKIALSMLYPLLITLLGFFLYSLWIILEKARNE 67896 Query: 241 VLFRERKQSWVKIQFEEESDESVF 264

VLFRERKQSWVKIQFEEESDESVF

  : 67897 VLFRERKQSWVKIQFEEESDESVF 67968 Database: contigsLpPhiladelphia Posted date: Nov 20, 2003 10:38 AM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 0.468 0.330 0.143 Gapped KH 0.140 Lambda 0.0410 0.267 Matrix: BLOSUM62 Query = 3159.2 CONTIG = Contig46 POSCDS1 = 34563 POSCDS2 = 35318 SENS = p (756 letters) Database: / home / Gmp / rusniok / projects / legionella / forBrevet191103 / contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching done Score E Sequences producing significant alignments: (bits) Value LpPhiladelphia Contig49 1499 0.0> LpPhiladelphia_Contig49 Length = 376826 Score = 1499 bits (756), Expect = 0.0 Identities = 756/756 (100%) Strand = More / More Query: 1 atgtggaagatattgtatcagttggcatcgccaaaaaatttttataactacgcgggacgt 60 1 1 1 1 1 1 IIIIIIIIIIII 1 1 1 1 1 1 1 111 11111111II11111 IIII IIII111111 Sbjct: 67216 atgtggaagatattgtatcagttggcatcgccaaaaaatttttataactacgcgggacgt 67275 Query: 61 ctcattccctggttggcagtcagtgctttgactaccatggccattggtatggtttgggga 120 Sbjct: 67276 ctcattccctggttggcagtcagtgctttgactaccatggccattggtatggtttgggga 67335 Query: 121 ttggtatttgctccaccagattatcagcaaggggatgcataccgaattatttttgttcat 180 11111111111111 11 1 1 1 1 1 1 1 1 II 1111111 IIIIIII1111111111111111 Title: 67336 ttggtatttgctccaccagattatcagcaaggggatgcataccgaattatttttgttcat 67395 Query: 181 gtacccagcgcttttttatcaatggcattgtatgcctggatggggtttctggccatttta 240 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Content: 67396 gtacccagcgcttttttatcaatggcattgtatgcctggatggggtttctggccatttta 67455 Query: 241 ttgttggtgtggcgtatcaaaatggcagggcttttgattcataaggtcgcgcaattaggt 300 11111111111111111111111111III II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sample: 67456 ttgttggtgtggcgtatcaaaatggcagggcttttgattcataaggtcgcgcaattaggt 67515 Query: 301 gcctgcatggcatttcttgctttaattacagggagcatttggggtaaacccatgtggggt 360 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 67516 gcctgcatggcatttcttgctttaattacagggagcatttggggtaaacccatgtggggt 67575 Query: 361 Sbjct 11111111111111111111111111111111111111111111111111111111111I gcctggtgggtatgggatgcccgcctgacctcagaattaatacttttgttgctctatctg 420: 67576 67635 gcctggtgggtatgggatgcccgcctgacctcagaattaatacttttgttgctctatctg Query: 421 gcaattctggctacctatcaagcggtaaaaaataaagaagatggagataaaataatagca 480 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 mgbt: 67636 gcaattctggctacctatcaagcggtaaaaaataaagaagatggagataaaataatagca 67695 Query: 481 attttagctttggtgggtttaattgatttaccaataattcattattcagtttattggtgg 540 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 67696 attttagctttggtgggtttaattgatttaccaataattcattattcagtttattggtgg 67755 Query: 541 aatactttacaccaaggtgcaactttatctgtgtttgccaaacccaaaattgctctcagt 600 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 67756 aatactttacaccaaggtgcaactttatctgtgtttgccaaacccaaaattgctctcagt 67815 Query: 601 atgttgtatccattgttaatcactttgctgggttttttcttgtattccttatggatcatt 660 Il 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 mgbt: 67816 atgttgtatccattgttaatcactttgctgggttttttcttgtattccttatggatcatt 67875 Query: 661 ttggaaaaagcacgtaatgaagtcttattcagggagagaaagcaatc atgggttaagatt 720 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 67876 ttggaaaaagcacgtaatgaagtcttattcagggagagaaagcaatcatgggttaagatt 67935 Query: 721 caatttgaggaagagtctgatgaatcagttttttga 756 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 67936 caatttgaggaagagtctgatgaatcagttttttga 67971 ------------------------------------- -------------------------- TBLASTN 2. 2.6 [Apr-09-2003] Query = 4774.1 CONTIG = Contig46 POSCDS1 = 50654 POSCDS2 = 50950 SENS = m, Seq Id: 2523 (103 letters) Database: contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching.done Sequences producing significant alignments: LpPhiladelphia Contig49> LpPhiladelphia_Contig49 Length = 376826 Score = 205 bits (522), Expect = 4e-55 Identities = 102/102 (100%), Positives = 102/102 (100%) Frame = -1 Query: 1 RRSKMPEIHTLDNPYITILTIFVLACFVGYYVVWKVTPALHTPLMSVTNAISSIIILGAL 60

  RRSKMPEIHTLDNPYITILTIFVLACFVGYYVVWKVTPALHTPLMSVTNAISSIIILGAL

  Sbjct: 83615 RRSKMPEIHTLDNPYITILTIFVLACFVGYYVVWKVTPALHTPLMSVTNAISSIIILGAL 83436 Query: 61 IAAGSELIGCITWLGGIAIFITSINIFGGFVVTQRMLRMYKK 102

  IAAGSELIGCITWLGGIAIFITSINIFGGFVVTQRMLRMYKK

  : 83435 IAAGSELIGCITWLGGIAIFITSINIFGGFVVTQRMLRMYKK 83310 Database: contigsLpPhiladelphia Posted date: Nov 20, 2003 10:38 AM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 0.442 0.330 0.144 Gapped KH 0.140 Lambda 0.0410 0.267 Matrix: BLOSUM62 Query = 4774.1 CONTIG = Contig46 POSCDS1 = 50654 POSCDS2 = 50950 SENS = m (297 letters) Database: / home / Gmp / rusniok / projects / legionella / for Brevet191103 / contigsLpPhiladelphia 51 sequences; 3,410,887 total letters Searching done Score E Sequences producing significant alignments: (bits) Value LpPhiladelphia Contig49 589 e-169> LpPhiladelphia_Contig49 Length = 376826 Score = 589 bits (297), Expect = e-169 Identities = 297/297 (100%) Strand = Plus / Minus E-score (bits) Value 205 4e-55 Query: 1 atgcctgaaattcatacacttgataatccttatattacaatattaaccattttcgtactg 60 IIIIIIIII1111111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I Sbjct: 83603 atgcctgaaattcatacacttgataatccttatattacaatattaaccattttcgtactg 83544 Query: 61 gcctgttttgtaggttattatgtggtttggaaagtaacaccggctttacatacaccccta 120 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I Sbjct: 83543 gcctgttttgtaggttattatgtggtttggaaagtaacaccggctttacatacaccccta 83484 Query: 121 180 1111111111 atgtcagtaaccaatgccatatccagtattattatacttggtgctttaattgctgcagga IIII11111111111111 III111111111111111111111111111 Sbjct: 83483 atgtcagtaaccaatgccatatccagtatta ttatacttggtgctttaattgctgcagga 83424 Query: 181 agtgaattgatcggatgcataacctggttaggtggcatagccatattcattacttcaatt 240 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 83423 agtgaattgatcggatgcataacctggttaggtggcatagccatattcattacttcaatt 83364 Query: 241 aatatttttggtggctttgtagtaactcaacgcatgcttcgcatgtataaaaaataa 297 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 83363 aatatttttggtggctttgtagtaactcaacgcatgcttcgcatgtataaaaaataa 83307 -------------------- ------------------------------------------- Example 5: Other examples of sequence alignment 4546.3 (Seq ID 2365) 3009.2 (Seq ID 1331) BLASTN 2.2.6 [Apr-09-2003] Query = Lp Paris Contig48_66441-70516 (4076 letters) Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig 51 sequences; 3,410, 887 total letters Searching.done Score E Sequences producing significant alignments: (bits) Value 37 1439 0.0 2862659 68> 37 Length = 67519 Score = 1439 bits (726), Expect = 0.0 Identities = 784/802 (97%), Gaps = 1/802 (0%) Strand = More / More Query: 3275 gcaaatatggtaaaaatgttgacattaattagtggagtatgagatatttattttgcgagg 3334 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1111111111111111 111111111111II Sbjct: 63920 gcaaatatggtaaaaatgttgacattaatcagtggagtatgagatatttattttgcgagg 63979 Query: 3335 ttggacttgctatgtgtcattccactgggtcaattggcgacacactgattggccctttct 3394 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 63980 ttggacttgctatgtgtcattccactgggtcaattggcgacacactgattggccctttct 64039 Query: 3395 attatcctgaaatcctgacaagagctctctatggcttaatctataagctgcttgtgatta 3454 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64040 Attatcctaaaaccctgacatgaactctctatggcttaatctataagctgcttgtgatta 64099 Query: 3455 atttcatcgcaatataagccattaaaataccgctaagtaactctattttttgccatactt 3514 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64100 atttcatcgcaatataagccattaaaataccactaagtaactctattttttgccatactt 64159 Query: 3515 tattttgagttaacaggtttgaaaaataacgagtagtcatcgttaatgaactgaaccaaa 3574 1 1 1 1 1 1 1 11111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64160 tattttgggttaataggtttgaaaaataacgagtagtcatcgttaatgaactgaaccaaa 64219 Query: 3575 tcatgctggcagaaattacccctgctaaaaaagccagtttatggtcaggatattgactgc 3634 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 64220 tcatgctggcagaaattacccctgctaaaaaagccagtttatggtcaggatattgactgc 64279 Query: 3635 tgccgctacccacaatcaccagggtgtctataatggcgtgaggattaagcagactaaacc 3694 1111111 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64280 tgccgctgcccacaatcaccagggtatctataatggcgtgaggattaa gcagactaaacc 64339 Query: 3695 ccagggcaaataaaatgatttgcattcttgtatgaggctgatgtgtttctacaacggttt 3754 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III 111 11111111111111111111 1111111111I Sbjct: 64340 ccagggcaaataaaatgatttgcattcttgtatgaggctgatgtgtttctacaacggttt 64399 Query: 3755 gtttgtttttggacagcgcgctttttaagttttttattgcataataaattaaaaaggcag 3814 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1111111111111111111111111111111111111111111I Sbjct: 64400 gtttgtttttggacaacgcgctttttaagttttttattgcataataaattaaaaaggcag 64459 1 1 1! 1 I l l l [I I, u l I! IIIII 500 1600 1500 2000 2500 3806 3508 4808 Query 0 568 1866 1588 _ ^ Y 5> 0 5> 58 2000 2500 3000 3508 4000 5> 158 5> 280 5> 180 Query 5cvring colors Query: 3815 agcctagccataccatccagatttgcaagtttggatgagccaaaagcaattgatgtaaac 3874 11111111111111111111111111111111111111111111II III 1 1 1 1 1 1 1 1 I Sbjct: 64460 agcctagccataccatccagatttgcaagtttggatgagccaaaagcaattgatgtaatc 64519 Query: 3875 cagcgacactgccgcacaccaaaatgacatcacagaaaaagcaaatgacggcagagagag 3934 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64520 cagcgacactgccgcacaccaaaatgacatcgcagaaaaagcaaatgacggcagagagag 64579 Query: 3935 cggcatgattttttcgcgcctgataagaaagacattttgcggacctaaggcca 3994 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64580 ccgcatgattttttcgcgcaccttgcctgataagaaaaacattttgcggacctaaggcca 64639 Query: 3995 ttatcaaagataatcccaagagtaatccattaaaataaatcaacataattgcatcaggat 4054 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64640 ttatcaatgataatcccaagagtaatccattaaaataaatcaacataattgcatcaggac 64699 Query: 4055 agtaaaaaaaaaggcgattata 4076 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 64700 agt-aaaaaaaaggcgattata 64720 Score = 957 bits ( 483), Expect = 0.0 Identities = 495/499 (99%) Strand = More / More Query: 1 ctacaaattttgcaaggttattaaatagtggttttcatctggcggcctattgtttttttg 60 Il 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 63429 ctacaaattttgcaaggtaattaaatagtggttttcatctggcggcctattgtttttttg 63488 Query: 61 ggaaagccataagcattctgccaattgatccatgattaaatgttcaacagccatgggatc 120 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 63489 ggaaagccataagcattctgccaattgatccatgattaaatgttcaacagccatgggatc 63548 Query: 121 ctggtatttttctattaacttggtgtaaacagtacgg atgccttgtggcctatcggtcgt 180 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III 111 111111111111 Reference: 63549 ctgatatttttctattaacttggtgtaaacagtacggatgccttgtggcctatcggtcgc 63608 Query: 181 tacttgttcgcgaacggcaagatgaagccccatatgaaggaagggattggtttcgcctaa 240 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III 111 11111111111111111111 11111111111 Sbjct: 63609 tacttgttcgcgaacggcaagatgaagccccatatgaaggaagggattggtttcgcctaa 63668 Query: 241 ttcaggataataagtatgttcaggaaaagattgaatttgttcaatgactttatggtattc 300 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 abct: 63669 ttcaggataataagtatgttcaggaaaagatggaatttgttcaatgactttatggtattc 63728 Query: 301 cggatgatcaagaatcacttgggcaatttctttttccaagggagaaagttcttttttatt 11111111111111111111111111 360) 111111111111111111111111111111111 Sbjct: 63729 cggatgatcaagaatcacttgggcaatttctttttccaagggagaaagttcttttttatt 63788 Query: 361 ctggtacttattccagctgataaaaaatagctgtcgagtttcttgt actgtatcgccgta 420 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 63789 ctggtacttattccagctgataaaaaatagctgtcgagtttcttgtactgtatcgccgta 63848 Query: 421 aaacataatggcccgattgatataaaatgatccattttaactgaataaaaaagtaacaac 480 111111111111111111111111111111111111111111111111111111111111 Sbjct: 63849 aaacataatggcccgattgatataaaatgatccattttaactgaataaaaaagtaacaac 63908 Query: 481 aatgttgatgtgcaaatat 499 1111111111111111111 Sbjct: 63909 aatgttgatgtgcaaatat 63927 Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig Posted date: Sep 10, 2003 12:44 PM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 1.37 0.711 1.31 Gapped Lambda KH 1.37 0.711 1.31 Matrix: blastn matrix: 1 -3 Alignment a portion of the contig48 (Seq Id 48) of the Paris strain with all the contigs of the Philadelphia strain.

  The positions of this fragment in the contig are indicated in the line beginning with Query =. In this example, the first position (noted 1 in the alignment) of the fragment is therefore the position 50760 in the contig48 of the Paris strain. This fragment ends at position 56335 in contig48. We must add 50760 to the position indicated by the alignment to have the position in the total sequence of the contig. The positions in the contig of the Philadelphia strain, they are unchanged.

  In this example, we can see that the regions of the Paris strain between positions 561 (+50760) and 2096 (+50760) and between 2622 (+ 50760) and 3981 (+50760) are absent from the Philadelphia strain. These regions therefore contain the following ORFs specific to the Paris strain: 322.3 (Seq ID 1466) 321.3 (Seq ID 1462) 3005.2 (Seq ID 1329) 5208.1 (Seq ID 2782) BLASTN 2.2.6 [Apr-09-2003] Reference Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Zhang Jinghui, Zheng Zhang, Miller Webb, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs ", Nucleic Acids Res. 25: 3389-3402.

  Query = Lp Paris Contig48_50760-56335 (5576 letters) Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig 51 sequences; 3,410, 887 total letters Searching.done Sequences producing significant alignments: 37 E-score (bits) Value 2892 0.0 Lp 9 2599 5000

----------------

2599 5999

I

Lp I t I. "put

  Scoring colors S? 9 wire 1 Ri S? 58 57188 5? 158 5? 289> 37 Length = 67519 Score = 2892 bits (1459), Expect = 0.0 Identities = 1561/1595 (97%) Strand = More / More Query: 3982 cttatggcaaatatttatccctcaaagcgtttctcaataagccattgttaccatgaacca 4041 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111111 1 1 1 1 1 1 1 Sbjct: 50163 cttatggcaaatatttatccctcaaaatgtttctcaataagtcattgttaccttgaacca 50222 Query: 4042 gggtaagctttaattttcttaaacaaaatggagtatttagtcctcccttagatggaagct 4101 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50223 gggtaagctttaattttcttaaacaaaatggagtatatagtcctctcttagatggaagct 50282 Query: 4102 ctttcactgctttgctgagcaaatatttgacgctcctcactgattaattcaatccatttt 4161 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50283 ctttcactgctttgctgagcagatatttgacgctcctcactgattaattcaatccatttt 50342 Query: 4162 ttaggtgtcatgtcgt tttgtatcaataagttgatcgctgcactaggatattgactttgt 4221 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50343 ttaggtgtcatgtcgttttgtatcaataagttgatcgctgcactaggatattgactttgt 50402 Query: 4222 gtaatgacaaaataaaagtaagcggtcaatttgcttctgcataaagcccaaccacttttt 4281 1 1 1 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50403 gtaatggcaaaataaaagtaagcggtcaatttgcttctgcataaagcccaaccacttttt 50462 Query: 4282 gcgacacattgttgcaaactagcaaattcaatttgatcttctttgactaattgttgcagc 4341 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1111111) 11111111111111111111111111111 Sbjct: 50463 gcgacacattgttgcaaactaggaaattcaatttgatcttctttgactaattgttgcagc 50522 Query: 4342 ttttgaatcgtgtcagggatacatgcatcaaaaaacaatgtggtcccttgctgtccccat 4401 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50523 ttttgaatcgtgttagggatgcatgcatc aaaaaataatgtggtcccttgctgtccccat 50582 Query: 4402 acgtcacttaatataattctttttaaaatgttcatgtcacaaatttgttgctcatgggga 4461 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1111 Sbjct: 50583 acgtcacttaatataattctttttaaaatgttcaagtcacaaatttgttgctcttgcgaa 50642 Query: 4462 ataggtttctcaattctatgtgttaccggttgccccaacatggaatgtgtccattgctga 4521 January 1 111111111111111111111111111111111 1111111111111111111I III Sbjct: 50643 ataggtttctcaattctatgtgttaccggttgccctaacatggaatgtgtccattgttga 50702 Query: 4522 taataagcccgaccgtaaattaatataccacccaaaataaaatcaaaggcagttggggct 4581 1 1 1 1 1 1 1 1 I11111111111111111111111111111111111111111111111111 Sbjct: 50703 taataagctcgaccgtaaattaatataccacccaaaataaaatcaaaggcagttggggct 50762 Query : 4582 gcataccaaagagcagtgaagaatttggatttgatgacgtccactttggggtagggatac 4641 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50763 gcataccaaagagcagtgaagaaattagatttgatgacgtcc actttggggtagggatac 50822 Query: 4642 tgatggttattggttttaatgatatgtttgcgatcgtattgcatttttaaaggttcatat 4701 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50823 tgatggttattggttttaatgatatgtttgcgatcgtattgcatttttaaaggttcatat 50882 Query: 4702 ttaaccaaggatttagcctggtattgattctggccaatacttatcgtttcttccttcttt 4761 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 50883 ttaaccagggatttagcttggtattgattctgaccaatacttatcgtttcttccttcttc 50942 Query: 4762 ggtattcctccatcgactattgctaaatgaaagttatgatttaaaacatgttcataaccc 4821 IIII 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct : 50943 ggtactcctccatcgactattgctaaatgaaagttatgatttaaaacatgttcataaccc 51002 Query: 4822 484 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 51003 agaaaatgacaatcaggatttttagataaggtatttgctaaatgttgtcgcaatgcctcc 51062 Query: 4882 ccgactttaatattaggatcataaaaatctggatgtttggctaaattcattacccaaaat 4941 I11111111111111111111111111111111111111111111111111111111111 Sbjct: 51063 ccgactttaatattaggatcataaaaatctggatgtttggctaaattcattacccaaaat 51122 Query: 4942 acattgactttattcttttcaccagcaggaatatctcgtaacatcattccccaacaatac 5001 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 51123 acattgactttattcttttcaccagcaggaatatctcgtaacatcattccccaacaatac 51182 Query: 5002 ccaataacttcgtcgtttttatccttggcaataaaacaaatagtctctttataatgtaac 5061 I 1 III 111 111111111111111111111111111111111111111111111111111 Sbjct: 51183 ccaataacttcgtcgtttttatccttggcaataaaacaaatagtctctttataatgtaac 51242 Query: 5062 attgaagataggacgatatcccctataaaaggcaaatcgccaaaatttgctccatgtgct 5121 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III Batch: 51243 attgaagataggacgatatcccctataaaaggcaaatcgccaaaatttgctccatgggct 51302 Query: 5122 aaagaatcgatacgtttaatttcacccattgctttattaagttcagcagtattattggga 5181 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 51303 aaagaatcgatacgtttaatttcccccctattaagttcagcagtattattggga 51362 Query: 5182 tctaaaatctgaacttctttgaagccatagggcttgccttccatcatttttaacgaaaaa 5241 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiu 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 I I111111111111111 III Title: 51423 ttaaaggtacattcgccatctaactttttgtggtgtttaattttaagaggattttgattt 51482 Query: 5302 ctgcaatttaacagatctgtccataattgatgaatgtaaagtaatctttcatcatttggt 5361 11111111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIIIIIIIIIIIIIIIIIiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 mgbt: 51543 gaggtatttcgcaaattgattaattgttgggtgaaacgatgcacatattctgtatggaga 51602 Query: 5422 taaatagcatggctactgaaatcaacaacaaactctgccgtcattaattttttgatttcg 5481 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 51603 taaatagcatggctactgaaatcaacaacaaactctgccgtcattaattttttgatttcg 51662 Query: 5482 ggtaagtgatattcaacaggatctgtatatgattttactattgcttctagtgaactccat 5541 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIII 1 1 1 1 1 1 1 1 1 1 Sbjct: 51663 gataagtgatattcaacaggatctgtatatgattttactattgcctctaatgaactccat 51722 Query: 5542 ttgcgttcaagtacatc gatttttgaatacgacat 5576 1111111111111111111111111111111111I Sbjct: 51723 ttgcgttcaagtacatcgatttttgaatacgacat 51757 Score = 930 bits (469), Expect = 0.0 Identities = 543/569 (95%), Gaps = 9/569 (1%) Strand = Plus / More Query: atggcgaaatcattgtcgcaattagattctgctaatttgctcccctgttttaacatggaa 1 60 1 1 1 1 1 1 1 1 1 IIIIIIIIIIIII II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II Sbjct: 46540 atggcgaaaccattgtcgcaattggactctgctaatttgctcccctgttttaacatagag 46599 Query: 61 caagcagaacgcattggaaaacaaatcaataagctcttacagcatgagttttgcgaggaa 120 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 111111111111 Sbjct: 46600 caagcagaacgcattggaaaacaaatcaataaactcttacagcatgaattttgcgaggaa 46659 Query: 121 aacatcaatccaaagaaatttgcctctatcagtcacaatatcctgcccaaaattatgaca 180 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 46660 aacatcaatccaaagaaatttgcctctatcagtcacaatatcctgcccaaaattatgaca 46 719 Query: 181 gaaacatttttaggagtaaccccgccagaaaactggcagcaattaagcgacgatattata 240 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III111I1I1II1111111111111111 11111111 Sbjct: 46720 gaaacatttttaggagtaacccctccagaaaactggcagcaattaagcgacgatattata 46779 Query: 241 aaaaactgcatcgcaaacaagaatctatgcaaaaaagcagctcgcaaagagctggaagaa 300 111111111111111111II III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111111 Sbjct: 46780 aaaaactagcatcgcaaacaagaatctatgcaaaaaagcagctcgcaaagagttggaagaa 46839 Query: 301 tgcatcaaaccgagaattcctttgatcctgatacaatttggcccctggcttgctcaaaat 360 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 111111 Sbjct: 46840 tgcatcaaaccgagaattcctttgatcctgatacaatttggcccctggcttgcccaaaat 46899 Query: 361 tgtccacaattgaataagtctttgattgaacaatggccaaataaacaggctactctcaaa 420 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 111111111 Sbctu: 46900 tgtccacaattgaataagtctttgattgaacaatggccaaataa acaggccactctcaaa 46959 Query: 421 aagataattaatgaaaacaaaagtgccgagtaatcgagacaggcttaattacgagagtta 480 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111IIIIII III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 46960 aagataattaatgaaaacaaaagtgctgagtaatcgaggcaggcttaattacgagagtta 47019 Query: 481 tgcctgataaaaccacatttatttacctaat ttcatcaaatataactcacc 531 IIII IIIIIIII 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIIIIIIIIIII III Sbjct: 47020 tgccggataaaacaacatttatttacctaattcacctaacttcatcaaatataacttacc 47079 Query: 532 gatatgatctacaaccaagttcttaaaac 560 January 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 47080 gatatgatctacaaccaggttcttaaaac 47108 Score = 656 bits (331), Expect = 0.0 Identities = 423/451 (93%), Gaps = 2/451 (0%) Strand = More / More Query: 2172 tatatggccgataaaatttgccagggtcaataaatagtattctgatggttaggtaataaa 2231 1 1 1 1 1 1 (IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII III III 1 1 1 1 1 1 1 Sbjct: 47927 tatatgaccgataaaatttgccagggtcagtaaatagtattctgatggctagataataaa 47986 Query: 2232 tgat gaagagttcttttggtgaaatgaataaaagaccccttttttattgagcgactctta 2291 1 1 1 1 1 1 1 (IIIIIIIII IIIIIIIIIIIIIIII II IIIIIIIIIIIIIIIIIIIII Sbjct: 47987 tgatgaaaagttcttttgatgaaatgaataaaagaacc-ttttttattgagcgactctta 48045 Query: 2292 aaaa-gccatttgctttattctgtgcttttggcaagtgacatgatcgcattcaggttttg 2350 IIII 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIIIIIIIIIII III IIIIIIIIIII IIII Sbjct: 48046 aaaaagccatttgctttatcctgtgcttttggcaagcagtatggtcgcattcaggctttg 48105 Query 2351 tttacatgctaggtgtggttttttcccgaggcggttgtgagtttgataccataggtttta 2410 IIIIIIIIIIIIIIII IIIIIIIII (IIIIIIIIIII 1 IIIIIIIIIIIIIIIIII Sbjct: 48106 tttacatgctaggtgtagttttttcctgaggcggttgtgggcttgataccataggtttta 48165 Query: 2411 ttgaataggcgccgcttgggaaaaaacaattgtcagtaaggattgcccctgtaatcagat 2470 IIIIIIII IIII 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 48166 ttgaatagacgccacttgggaaaaaacaattgtcggcaaggattgcccctgtaatcagct 48225 Query: 2471 gggtaagccgattggcttcggcacatctcgaatcagtgacaacctctttcgctttttcat 2530 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111111111111111IIII Sbjct: 48226 gggtaagccgattggcttcggcacatctcgaatcagtggcaacctctttcgctttttcat 48285 Query: 2531 ctttatttcgcataacaatcctgtgaagttaatctttgcagaggacaccatgatggtttc 2590 I11111111111111111111111111111111111111111111111 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 48286 ctttatttcgcataacaatcctgtgaagttaatctttgcagaggacactatgatggtttc 48345 Query: 2591 atgtcatacaaacgaagcaaccggataccga 2621 111111111111111111111111 111111 Sbjct: 48346 atgtcatacaaacgaagcaaccgggtaccga 48 376 Score = 147 bits (74), Expect = 9e35 Identities = 98/106 (92%) Strand = Plus / Query More : 2097 2156 acctttctggagtttcccaactacaagatgatactgcgttataataactccatttattat IIIII II IIII 111111111111111111111 111111111111111111111111 Sbjct: 44922 accttcctggcgtttcccaactacaagatgatcctacgttataataactccatttattat 44981 Query: actggggctatcgagtatatggccgataaaatttgccagggtcaat 2157 2202 1 1111111111 111111111 1111111111111111111111 Sbjct: 44982 gccggggctatcgggtatatggctgataaaatttgccagggt caat 45027 Score = 109 bits (55), Expect = 2e-23 Identities = 64/67 (95%) Strand = Plus / More Inquiry: 3653 3712 111111111111111111111111111111111 cgaatccttacaggaaaacgaagcttatggaagtccaacaaggaagaggtagtaaattca 11111111111 1111111111 III Sbjct: 48378 48437 cgaatccttacaggaaaacgaagcttatggaaggccaacaaggaacagggagtaaattca Inquiry: 3713 3719 1111111 taacgcc Sbjct : 48438 taacgcc 48444 Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig Posted date: Sep 10, 2003 12:44 PM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda KH 1.37 0.711 1.31 Gapped Lambda KH 1.37 0.711 1.31 Matrix: blastn matrix: l -3 Alignment of a portion of the contig45 (Seq Id 45) of the Paris strain with all the contigs of the Philadelphia strain.

  The positions of this fragment in the contig are indicated in the line beginning with Query. In this example, the first position (noted 1 in the alignment) of the fragment is therefore the position 44722 in the contig45 of the Paris strain. This fragment ends at position 52680 in contig45. We must add 44722 to the position indicated by the alignment to have the position in the total sequence of the contig. The positions in the contig of the Philadelphia strain, they are unchanged.

  In this example, we can see that the region of the Paris strain between positions 1333 (+44722) and 6899 (+44722) is absent from the Philadelphia strain. This region therefore contains the following ORFs specific to the Paris strain: 4927.1 (Seq ID 2623) 413.5 (Seq ID 2069) 415.2 (Seq ID 2087) 417.3 (Seq ID 2102) BLASTN 2.2.6 [Apr-09-2003] Reference Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Zhang Jinghui, Zheng Zhang, Miller Webb, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs ", Nucleic Acids Res. 25: 3389-3402.

  Query- Lp Paris Contig45_44722-52680 (7959 letters) Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig 51 sequences; 3,410, 887 total letters Searching.done Sequences producing significant alignments: E-score (bits) Value 48 49 1943 94 0.0 2nd-18 Lp 2500 5000 7588 48 49 Lp Scoring MEMEMM coloring S> 8 5> 58 5> 108 8> 158 5 > 200> 48 = Length 263 853 Score = 1943 bits (980), Expect = 0.0 Identities = 1040/1060 (98%) Strand = Plus / Minus Inquiry: 6900 6959 attctaatggtggccagaggcagaatcgaactgccgacacgaggattttcagtcctctgc Sbjct: 55098 55039 attctaatggtggccagaggcagaatcgaactgccgacacgaggattttcagtcctctgc Inquiry: 6960 7019 tctaccgactgagctatctggccactcaaggcttgctattaaactccgagatcgactttg Sbjct: 55038 tctaccgactgagctatctggccactcaaggcttattctattaaactccgagatcgactttg 54979 Query: 7020 agtcaagtgttgattaagttttttttgaaaataattttttttggtaggctatggcaatct 7079 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I Sbjct: 54978 agtcaagtgttgattaagttttttttgaaaataattttttttggtaggctatggcaattt 54919 Query: 7080 ctgctcctagaaaagcgttgtttttgataagctcaatattagcttccaggctcttgcctg 7139 11111111111111 111111111 1 11111111111111111111111 1 1 111 111 111 I Sbjct: 54918 ctgctcctagaaaagcgttgtttttgataagctcaatattagcttccaggctcttgcccg 54859 Query: 7140 cagttaattcagcaatacgttttaacaggaagggggttaatgattttccgctcatgtgtt 7199 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 54858 cagttaattcagcaatacgttttaacaggaagggggttaatgattttccgctcatgtgtt 54799 Query: 7200 tggcttcttcatgagcctgttttatgtatggactgatttcctcatcagatagttccgctg 7259 1111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111111 IIII Sbjct: 54798 tggcttcatcatgagcctgttttatgtatggactgatttcctcatcggatagttcggctg 54739 Query: "7260 atactggaatggggtttgcgacgactattccgtttttcatgttcaatttctgttgaattg 7319 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIII 1 1 1 1 1 11111111111111 Item number: 54738 atactggaatggggtttgcgacgactattccatttttcatattcaatttctgttgaattg 54679 Query: 7320 acatgagatttgctacttcctcgaccgaatttaagcgttgtgggactggtattccactcg 7379 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIII II IIII IIII 1111 11111 11111111 1 1 1 Sbjct: 54678 acatgagatttgctacttcctcggccgagtttaagcgttgtggaactggtattccactcg 54619 Query: 7380 atctgctgtaaaaagcagggaattcgtctgtggcataacctatgaccggcaccccaaacg 7439 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 54618 atctgctataaaaagcagggaattcgtctgtggcataacctatgaccggcaccccaaacg 54559 Query: 7440 tttcaagaacttccaatgtttttggtaagtcgagaatcgattttgcgccagaacagacta 7499 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 54558 tttcaagaacttccaatgtttttggtaagtcgagaatcgattttgcgccagaacagacta 54499 Query: 7500 cggtaactggcgtattggatagttctataagatcagctgaaatatcaaaactcattgtca 7559 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I11111111111111111111111111111 11 IIII Sbjct: 54498 cggtaactggcgtattggatagctctataagatcagctgaaatatcaaaactcatcgtca 54439 Query: 7560 cgtcttgatgaacaccacctatac ctccggtgacaaatagggggagcctagccatatggg 7619 1 1 111111111111111111111111111111111111111111111 1111111 1 1 1 1 1 Sbjct: 54438 cgtcttgatgaacaccacctatacctccggtgacaaatagggggagcttagccatatggg 54379 Query: 7620 cacagaacatggttgctgctaccgttgtgctggcagtcactttacgagataatacaaaag 7679 111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1111111111111111111111111111 11111I Sbjct: 54378 cacaaaacatggttgctgctaccgtcgtgctggcagtcactttacgagataatacaaaag 54319 Query: 7680 aaatgtctctgcgagaggcttttattacttctttttgcagcgcgagatgctccataactt 7739 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111 Sbjct: 54318 aaatgtctctgcgagaggcttttattacttctttttgaagcgcgagatgttccataactt 54259 Query: 7740 cttgagttaaaccaatacggattttcccttggtgcatcgctatagtagctggaatggcgc 7799 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 54258 cttgagttaaaccaacacggattttcccttggtgcatcgctatagtagctggaatggcgc 54199 2862659 78 Query: 7800 c ttgtctacgaataatattttcaacttctattgccgtagttaaattatcagggtagggca 7859 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II1111111111111111111111 111111111I Sbjct: 54198 cttgtctacgaataatattttcaacctctattgccgtagttaaattatcagggtagggca 54139 Query: 7860 ttccatgagagataatggtcgactcaagagcaacaattgggtttttatcattgatagcat 7919 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct : 54138 54079 ttccatgagagataatggtcgactcaagagcaacaattgggtttttatcattgatagcat Query: 7920 ccagtacttcttcgttaaattccaacaagtcatgaaacat 7959 I111111111111111111111111111111111111111 Sbjct: ccagtacttcttcgttaaattccaacaagtcatgaaacat 54078 54039> 49 Length = 376 826 Score = 93.7 bits (47), Expect = 2e-18 Identities = 102/119 (85%), Gaps = 1/119 (0 %) Strand = More / More Query: 1215 atttgccctgtgtattgtttagtgttggtcgagcggttcactctctgtgaaacccggta 1274 1 1 1 1 1 1 1 1 1 1 1 I 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11 Sbjct: 207683 atttgccctgtctttggttta gtgttgaacgagcggctcactcaaagatgaaacctggcc 207742 Inquiry: 1275 1332 AAA ccgtaaagctcgaagaagggggcaaatcaatcgttataaggcaaacgatcccgcc 1II 111111IIIIII 111111111111111111111111111111IIII II IIII Sbjct: 207743 207801 aaagccataaagctcgaagtagggggcaaatcaatcgttataaggcaaacgatctcgcc Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig Posted date: September 10, 2003 12:44 PM Number of letters in file: 3,410,887 Number of sequences in database: 51 Lambda KH 1.37 0.711 1.31 Gapped Lambda KH 1.37 0.711 1.31 Matrix: blastn matrix: 1 -3 Alignment of a portion of the contig39 (Seq Id 39) of the Paris strain with all of the contigs of the Philadelphia strain.

  The positions of this fragment in the contig are indicated in the line beginning with Query =. In this example, the first position (noted 1 in the alignment) of the fragment is therefore the position 3990 in the contig39 of the Paris strain. This fragment ends at position 8972 in the contig39. We must add 3990 to the position indicated by the alignment to have the position in the total sequence of the contig. The positions in the contig of the Philadelphia strain, they are unchanged.

  In this example, we can see that the region of the Paris strain between positions 1264 (+3990) and 4465 (+3990) is absent from the Philadelphia strain. This region therefore contains the following ORFs specific to the Paris strain.

  3396.1 (Seq ID 1588) 3395.2 (Seq ID 1587) 3394.1 (Seq ID 1586) BLASTN 2.2. 6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI- BLAST: Nucleic Acids Res. 25: 3389-3402.

  Query- Lp Paris Contig39_3990-8972 (4983 letters) Database: / local / http / htdocs / IPF_Gmp / legionella / blastdb / contig 51 sequences; 3,410, 887 total letters Searching.done Sequences producing significant alignments: E-score (bits) Value 38 49 2123 0.0 638 0.0> 38 Length = 17003 Score = 2123 bits (1071), Expect = 0.0 Identities = 1215/1263 (96%) Strand = Plus / Minus Query: 1 ctttggttctacatgagcttgcctgagatgtttgcccttatcgattgcaacaatttttac 60 11111111111 111111111111111111111111111111IIIIIIII1111111111 Sbjct: 12277 ctttggttctacatgagcttgcctgagatgtttgcccttatcgattgcaacaatttttac 12218 Query: 61 gccagttgtgagcgtttgtttcgtcctgatttaaaggacgtccccatcgtggtgctatcc 120 1111111111111111111111111111111111111111111 1111111111 1 111 111 Sbjct: 12217 gccagttgtgagcgtttgtttcgtcctgatttaaaggacgtccccatcgtggtgctatcc 12158 Query: 121 aataatgatggctgttgtatcgcacgctcgaatgaagccaaagcattgggcattgccatg 180 11111 111111111 11111111111111111111111 1111111111111 111111111 Sbjct: 12157 aataacgatggctgttgtatcgcacgctcgaatgaagccaaagcattgggcattgccatg 12098 500 1000 1500 2960 2500 3800 3580 4000 4509 1800 1500 2800 2500 3000 3500 4000 4500 1 1 1 1_1 _! __ I 1 _ J _ _ I 1 1! I I E I. _ i E I I i i. . . ## EQU1 ## ## EQU1 ## 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 12097 ggcgagccgtacttcaaaattaaacatttgtgcaaacagcatggagtgaaagctttttcc 12038 Query : 241 tcaaattatacgctgtatggcaacatgagtcatcgtgtgatgtgcactattgaagaagcc 300 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 12037 tcaaattatacgctgtatggcaacatgagtcatcgtgtgatgtgcactattgaagaagcc 11978 Query: 301 tggccccatatagaagtttactcgattgatgaagcgtttcttgatttaaggagtttaccg 360 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11977 tggccccatatagaagtttactcgattgatgaagcgtttcttgatttaaggagtttaccg 11918 Query: 361 gttgatagccatgattcgttttgcgagcagttacaaaagaaaatcttgaagcacacagga 420 1 1 1 1 1 1 1 1 1 I111111 1111111111111111111111111111111111111111111 Sbjct: 11917 gttgatagctatgattcgttttgcgagcagttacaaaagaaaatcttgaagcacacagga 11858 Query: 421 atacccacttccatcggtattggacctactaaaacactagctaaagccgccaatcattta 480 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11857 atacccacttccatcggtattggacctactaaaacactagctaaagccgccaatcattta 11798 Query: 481 tgcaaaaaagtttataaaatccctgtgtttaatatcacctcgaatcgtgggcggttattg 540 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11797 tgcaaaaaagtttataaaattcctgtgtttaatatcacctcgaatcgtgggcggttattg 11738 Query: 541 caacagatttccgttggggacatttggggagtagggcggcaatgggccaataaattaatt 600 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11737 caacagatttccgttggggacatttggggagtagggcggcaatgggccaataaattaatt 11678 Query: 601 tcgcgaggcattcatacggcttatgatttggcaatgacc aatcctcaccttctgaagaaa 660 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11677 tcgcgaggcattcatacggcttatgatttggcaatgaccaatcctcaccttctgaagaaa 11618 Query: 661 tgttttaacgtcgtgttgatgcgtaccgccatggagcttcaaggaattgcttgtggcggt 720 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II 11 IIIIIIIIIIIIIIIIII IIIIII Sbjct: 11617 tgttttaacgccgtgttgatgcgaactgctatggagcttcaaggaattgcttgtggcggt 11558 Query: 721 ttagaggcaatagagcctaagcaaagtattatgtcatctaaaagttttggtcagatgcaa 780 1 1 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11557 ttagaggtaatagagcctaagcaaagtattatgtcatccaaaagttttggtcagatgcaa 11498 Query: 781 actcaacttgcttcgattgaggaatcaatcagtagccattgtgcccgtgcggtggagaaa 840 1 1 1 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 111 111111111111 Subject: 11497 actcaaattgcttcgattgaggaatcaatcagtagccattgtgctcgtgcggtggagaaa 11438 Query: 841 atgcgtcgccagcaattggtggcgaagcgcctggttgtatttgtgcatacgaaccgattt 900 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11437 atgcgtcgccaacaattggtggcgacgcgtctggttgtatttgtgcatacgaaccgattt 11378 Query: 901 cgcgaagatttggcacagcactttcagtccatcgaatttaagctgattaatcctacagat 960 11 1 1 1 1 1 1 1 1 1 1 1 11111111111111111111111111111111111111111111I Sbjct: 11377 cgggaagatttggctcagcactttcagtccatcgaatttaagctgattaatcctacagat 11318 2862659 81 Query: 961 gatttgcgcttaattaccaaaatggccaagcgatgtctgcaacgcatttttaaaccaggg 1020 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11111 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 11317 gatttgcgcttaattaccaaaatagccaaaagatgtctgcaacgcatttttaaaccaggg 11258 Query : 1021 tattactataaaaaggcaggagtatgtcttgaggacttaattcccaaaaacccacgacag 1080 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIIIIII IIIIIIIIIII IIIII IIIIIIIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII 198 Query: 1081 ctggatatgttttatcaaccaagtgacgagcatctaaaccacacggaacaattgatggcg 1140 1 1 1 1 1 1 1 1 1 1 1 1 (IIIIIIIIIIII IIIIIIIIIII IIIII IIIIIIIIIIIII Sbjct: 11197 ctggatatgtttcatcaaccaagtgatgagcatctaaaacacaccgaacaattgatgggt 11138 Query: 1141 gtctttgaccaaatcaatcaaaaatacggacgaagtacaatccgcctcgcggcagagggt 1200 IIIIIIIIIIIIIIIIIIIIIII II III (III II II II 1 II 11 II II Sbjct: 11137 gtctttgaccaaatcaatcaaaagtatggaagaagcacgattcggttagccgccgaaggc 11078 Query 1201 tattcaaaaccttgggcgatgcgtgctgaactgaaatcgcctgcctataccacacgatgg 1260 11111111111 IIII IIIIIIIIIIII 11111111 1 1 1 1 1 11111111 1 1 1 1 1 1 Sbjct: 11077 tattcaaaaccctgggagatgcgtgctgagctgaaatcacctgcttataccacgcgatgg 11018 Query: 1261 tct 1263 III Sbjct: 11017 tct 11015> 49 Length = 376 826 Score = 638 bits (322) , Expect = 0.0 Identities = 469/518 (90%) Strand = More / More Query: 4466 gaacaataatcactgataaaaagatcttgagcaaaagtctcaaaatcaaaatagcagatc 4525gaacaataatcactaataaaaagatcccgagcaaaagcctcaaaatcaaaatagcagctc 203834 Query: 4526 aaactatccggcatttgatgggcataacagtcatcaaataattgcctggcaaaatcaacc 4585 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II 111111111111111 Sbjct : 203835 aaactatccggtatttgatgggcataacagtcatcaaataactgtctggcaaaatcaacc 203894 Query: 4586 tctgaatcataacaaccttggtaatgatcctccaacatggtttgtgcatcatctaccgag 4645 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 IIIIIIII Sbjct: 203895 tctgaatcatagcaaccttggtaatgatcctccaacatggtttgtgcatcttctaccgaa 203954 Query: 4646 taatcacagagcagggctaatcctaactctccgtgttcttgaatgaatgaagcatattcc 4705 11111 11111 11111111 1111 111111 1 1 1 1 1 1 1 1 1 1 1 IIIIIIIIIII III Sbjct: 203955 taatcgcagagaagggctaagcctagctctccatgttcttgaataaatgaagcatactcc 204014 Query: 4706 acaatgttgcttattccttcatattcatgaattctcatgctgccgaaaccttcataatcg 4765 IIIII II 1 1 1 1 1 1 II II 11111 III 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 20401 5 acaatattacttattgactcgtactcatggattttgatgctgccgaatccttcataatcg 204074 Query: 4766 tggatggcaaattcctcagcattggtttctgggctattatccaacatttcccagatttct 4825 Il 1 1 1 1 1 1 IIII 1 1 1 1 1 1 1 1 1 1 II IIIII 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 204075 tgtatggcatattcttcagcattgggctcagggctgttatccagcatttcccagatttct 204 134 Query: 4826 ttcatgatgtcatcttcgctttgagtagcatctatccatacaccatgcagtatggcgttg 4885 1 III IIIIIIIIIIIIIIIII II IIIIIIIIIII IIIIIIIIIII IIIII III Sbjct: 204135 tccataatgtcatcttcgctttgtgtggcatctatccaaacaccatgcaggatggcattg 204194 Query: 4886 ttgtaagaggctaaacaggcgacgtagattgaaggggtgtccatgggattatctccttgt 4945 11111 11111111111 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 Sbjct: 204195 ttgtatgaggctaaacacgcgacgtagattgaaggggtgtccatgggattatttccttgt 204254 Inquiry: 4946 attaagggagctatcccacacgggagcttgctcccgtg 4983 11111111111 11111111111111111 1111111 1 Sbjct: 204,255 attaagggagcaatcccacacgggagcttactcccgtg 204292 Database: / local / http / htdocs / IPF_Gmp / l egionella / blastdb / contig Posted date: Sep 10, 2003 12:44 PM Number of letters in database: 3,410,887 Number of sequences in database: 51 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix: 1 -3

Example 6: RESULTS

  See below Tables V, VI, I and II below.

  Bibliography 1. Altschul, S. F., T. L. Madden, A. Schaffer, A. Zhang, Z. Zhang, W. Miller, and D. J. Lipman. 1997. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. [Review] [90 refs]. Nucleic Acids Research. 25: 3389-402.

  2. Aurell, H., J. Etienne, F. Forey, M. Reyrolle, P. Girardo, P. Farge, B. Decludt, Campese C., F. Vandenesch and S. Jarraud. 2003. Legionella pneumophila serogroup 1 strain Paris: Endemic distribution throughout France. J Clin Microbiol. 41: 3320-3322. 3. Birnboim, H. C. 1983. A rapid alkaline extraction method for the isolation of plasmid DNA. Methods Enzymol. 100: 243-255.

  4. Buchrieser, C., Rusniok C., Frangeul L., Couve E., Billault A., Kunst F., Carniel E., and Glaser P. Yersinia pestis and Yersinia pseudotuberculosis strains. Infect. Immun. 67: 4851-4861.

  5. Ewing, B., and P. Green. 1998. Base-calling of automated sequencer traces using phred. II. Error probabilities. Genome Res. 8: 186-194.

  6. Fitch, W. S. 1970. Distingishing homologous from analogous proteins. Syst. Zool. 19: 99-113.

  7. Frangling L, Glaser P, Rusniok C, Buchrieser C, Duchaud E, Dehoux P and Kunst F. 2004. CAAT-Box, Contig-Assembly and Annotation toolbox for genome sequencing projects. Bioinformatics. in press.

  8. Gordon, D., Abajian C., and P. Green. 1998. Consed: a graphical tool for sequence finishing. Genome Res. 8: 195-202.

  10. Li, P., K. C. Kupfer, C. J. Davies, D. Burbee, G. A. Evans, and H. R. Garner. 1997. PRIMO: A primer design program that uses basic quality statistics for automated broad-scale DNA sequencing. Genomics. 40: 476-485.

  11. Lukashin, A. V., and M. Borodovsky. 1998. GeneMark.hmm: new solutions for gene finding. Nucleic Acids Res. 15: 1107-1115.

  12. Xu, S.Y., and Fomenkov, A. 1994. Construction of pSC101 derivatives with Camr and Tetr for selection or LacZE for blue / white screening. Biotechniques 17: 57.

  Table III: Correspondence of the numbers assigned to the contigs with the numbers of the SEQ IDs identified in the sequence list Contig1 SEQ ID No. 1 Contig29 SEQ ID No. 29 Contig2 SEQ ID No. 2 Contig3O SEQ ID No. 30 Contig3 SEQ ID No. 3 Contig3l SEQ ID No. 31 Contig4 SEQ ID No. 4 Contig32 SEQ ID No. 32 Contig5 SEQ ID No. 5 Contig33 SEQ ID No. 33 Contig6 SEQ ID No. 6 Contig34 SEQ ID No. 34 Contig7 SEQ ID No. 7 Contig35 SEQ ID No. 35 Contig8 SEQ ID No. 8 Contig36 SEQ ID No. 36 Contig9 SEQ ID No. 9 Contig37 SEQ ID No. 37 Contigo SEQ ID No. 10 Contig38 SEQ ID No. 38 Contig1 SEQ ID No. 11 Contig39 SEQ ID No. 39 Contigl2 SEQ ID No. 12 Contig40 SEQ ID No. 40 Contigl3 SEQ ID No. 13 Contig4l SEQ ID No. 41 Contigl4 SEQ ID No. 14 Contig42 SEQ ID No. 42 Contigl5 SEQ ID No. 15 Contig43 SEQ ID No. 43 Contigl SEQ ID No. 16 Contig SEQ ID No. 47 Contigl SEQ ID No. 17 Contig SEQ ID No. 45 Contigl SEQ ID No. 18 Contig SEQ ID No. 46 Contigl SEQ ID No. 19 Contig SEQ ID No. 47 Contig S EQ ID No. 20 Contig48 SEQ ID No. 48 Contig2l SEQ ID No. 21 Contig49 SEQ ID No. 49 Contig22 SEQ ID No. 22 Contig50 SEQ ID No. 50 Contig23 SEQ ID No. 23 Contig5l SEQ ID No. 51 Contig24 SEQ ID No. 24 Contig52 SEQ ID No. 52 Contig25 SEQ ID No. 25 Contig53 SEQ ID No. 53 Contig26 SEQ ID No. 26 Contig54 SEQ ID No. 54 Contig27 SEQ ID No. 27 Contig55 SEQ ID No. 55 Contig28 SEQ ID No. 28 Contig56 SEQ ID No. 56

Table IV

  Correspondence between contigs of Legionella pneumophila Philadelphia strain and sequence numbering in Contig sequence sequence of Philadelphia strain Contig1 Contig2 Contig3 Contig4 Contig5 Contig6 Contig7 Contig8 Contig9 Contig10 Seq Id SEQ ID N 3456 SEQ ID N 3457 SEQ ID N 3458 SEQ ID N 3459 SEQ ID N 3460 SEQ ID N 3461 SEQ ID N 3462 SEQ ID N 3463 SEQ ID N 3464 SEQ ID N 3465 Contig11 SEQ ID N 3466 Contigl2 SEQ ID N 3467 Contigl3 SEQ ID No 3468 Contigl4 SEQ ID N 3469 Contigl5 SEQ ID N 3470 Contigl SEQ ID N 3471 Contigl SEQ ID N 3472 Contigl SEQ ID N 3473 Contigl SEQ ID N 3474 Contig2O SEQ ID N 3475 Contig2 SEQ ID N 3476 Contig SEQ ID N 3477 Contig SEQ ID N 3478 Contig SEQ ID N 3479 Contig SEQ ID N 3480 Contig26 SEQ ID N 3481 Contig27 SEQ ID N 3482 Contig28 SEQ ID N 3483 Contig29 SEQ ID N 3484 Contig3O SEQ ID N 3485 Contig3l SEQ ID N 3486 Contig32 SEQ ID N 3487 Contig33 SEQ ID N 3488 Contig34 SEQ ID N 3489 Contig35 SEQ ID N 3490 Contig36 SEQ ID N 3491 Contig37 SEQ ID N 3492 Contig38 SEQ ID N 3493 Contig39 SEQ ID N 3494 Contig4O SEQ ID N 3495 Contig4l SEQ ID N 3496 Contig42 SEQ ID N 3497 Contig43 SEQ ID N 3498 Contig44 SEQ ID N 3499 Contig45 SEQ ID N 3500 Contig46 SEQ ID N 3501 Contig47 SEQ ID No. 3502 Contig48 SEQ ID No. 3503 Contig49 SEQ ID No. 3504 Contig50 SEQ ID No. 3505 Contig5l SEQ ID No. 3506 Table V: Surface Proteins of Legionella pneumophila strain Paris Surface proteins specific to the Paris strain are indicated in characters fat.

  SEQ ID IPF Annotation / similarity with other proteins 3410 94.7 Surface protein, Streptococcus sp.

  and Pseudomonas sp., Rtx toxin 704 202.3 Bordetella sp. and Coxiella burnetii 746 209.2 Surface Protein of Wolbachia sp.

  Surface protein of Mycoplasma hominis, Streptococcus 2751 514.5 Protein similar to 440.4 3192 627.1 Surface protein of Streptococcus pyogenes (collagen-like) 3218 663.2 Lipopolysaccharide biosynthesis, 0-antigen acetylase Pseudomonas aeruginosa 3221 667.3 Surface antigen of Trypanosoma cruzi 3222 668.4 lcE of Legionella pneumophila 3317 803.3 Flagellar protein (L-ring protein) 3324 817.7 Surface protein of Mycoplasma hominis 136 1115.4 Rtx toxin of Magnetococcus sp., putative lipoprotein of Leptospira kirschneri 171 1171.3 Surface-type protein excluding Salmonella typhimurium 310 1391.1 Transporter of Coxiella burnetii protons 337 1429.4 Rtx toxin, Bacillus cereus surface protein 481 1653.3 Yersinia pestis plasminogen activator, cell envelope protease 527 1724.3 Hydrolase cell envelope of Pseudomonas putida 652 1910.6 Protein similar to 440.4 664 1933.4 Protein simi 440.4 893 2343.2 Surface antigen of Rickettsia sp.

  972 2448.3 Hypothetical protein of Coxiella burnetii, periplasmic protein 1148 2727.2 Surface protein of Spirochetes 1298 2968.3 FimV, assembly of Legionella pneumophila pili 1361 3059.2 Legionella pneumophila 1503 3271.3 0-antigen acetylase of Pseudomnas aeruginosa 1521 3299.3 Agglutinin, adhesin, protein Protein Surface area of Brucella melitensis 1576 3374.1 Magnetospirillum magnetotacticum surface antigen 1651 3496.2 Plasmodium lophurae rich histidine-rich glycoprotein 1755 3636.1 Legionella pneumophila pal lipoprotein 1847 3780.2 Plasmodium falciparum surface protein 1877 3827.2 0-Pseudomnas aeruginosa antigen acetylase 2224 4347.2 Protein the outer membrane of Burkholderia fungorum, surface antigen of Rickettsia sp.

  2406 4608.1 Plasmodium-infected erythrocyte antigen 2843 5349.3 Anaplasma marginale major surface protein, hypothetical Plasmodium falciparum 2930 protein 5526.2 Adhesin, Escherichia col / 3037 virulence protein 5739.3 Pseudomonas putida-excluded surface-type protein, Enterococcus faecalis , Rtx toxin 3139 6037.1 Surface antigen of Entamoeba histolytica and Plasmodium falciparum 3157 6079.1 Surface antigen of Trypanosoma cruzi 3165 6097.1 Protein RtxA of Legionella pneumophila 3181 6131.1 Adhesin / surface protein of Pseudomonas putida, Enterococcus faecalis, Rtx toxin Table V: Proteins involved in the biosynthesis of polysaccharides in the cell envelope of Legionella pneumophila SEQ ID IPF Annotation / similarity with other proteins 1126 269.1 Heptosyl transferase, biosynthesis of lipopolysaccharides in Coxiella burnetii 3218 663.2 0-acetyltransferase, modification of lipopolysaccharides in Vibrio cholera e 288 1360.6 Protein involved in the biosynthesis of lipopolysaccharides in Methanosarcina 632 1882.2 Polysaccharide deacetylase of Coxiella burnetii 917 2371.1 Rickettsia conorii CapM protein, glycosyltransferase 1503 3271.3 Pseudomonas aeruginosa O antigen acetylase, modification of lipopolysaccharides 1555 3348.2 Predicted xylanase / chitin deacetylase of Cytophaga hutchinsonii 1877 3827.2 Acetylase of Pseudomonas aeruginosa O antigen, modification of lipopolysaccharides 1928 3923.2 Potential nucleoside-diphosphate-sugar epimerase of Thermoanaerobacter tengcongensis 1963 3980.1 Phosphopantethein adenylyltransferase of Ralstonia metallidurans, biosynthesis of lipopolysaccharides 2204 4323.1 Nucleoside diphosphate pyrophosphorylase sugar 2212 4334.1 Polysaccharide deacetylase, xylanaselchitine deacetylase 2243 4371.1 Polysaccharide deacetylase, xylanaselchitine deacetylase 2324 4488.1 Aminotransferase, lipopolysaccharide synthesis 2378 45 67.2 WciT of Streptococcus pneumoniae, biosynthesis of polysaccharides 2410 4616.2 Biosynthesis of O antigen, hypothetical protein of Coxiella burnetii 2411 4618.1 Biosynthesis of lipopolysaccharides, glycosyltransferase SEQ ID No. ORF Contig Direction Position Specific to% homology Presence in Specific Signal Position Paris / ORFs L. 1 2 P Philadelphia conserved longbeachae Legionella SEQ ID No. 3098 5906. 1 Contig29 m 2 541 + SEQ ID No. 3097 5905.1 Contig29 P 747 1703 97% SEQ ID No. 3181 6131.1 Contig3l P 1 2313 + SEQ ID No. 3180 6130. 1 Contig32 m 74 1048 - + SEQ ID No. 3179 6128.1 Contig32 m 1045 2223 - + SEQ ID No. 3178 6125.1 Contig32 m 2799 3074 + SEQ ID No. 3177 6123. Contig32 m 3005 3130 + + SEQ ID No. 3176 6122.1 Contig32 P 3158 3457 + + SEQ ID No. 3175 6121.1 Contig33 P 1 570 + SEQ ID No. 1494 3257. 2 Contig33 P 933 1391 - + SEQ ID No. 1495 3258.2 Contig33 P 1363 2307 + SEQ ID No. 659 1924.4 Contig33 m 2329 2898 + SEQ ID No. 658 1923. 2 Contig33 m 2892 3113 - + + SEQ ID No. 657 1920.3 Contig33 m 3738 4808 + SEQ ID No. 2987 5626.2 Contig33 m 4971 5936 + SEQ ID No. 3122 5987. 1 Contig33 m 5866 6501 + + SEQ ID No. 3089 5898.2 Contig34 m 2 862 + + + SEQ ID No. 2792 523.2 Contig34 m 1137 2051 + 94% SEQ ID No. 2795 524. 2 Contig34 P 2016 3128 98% SEQ ID No. 2804 526.2 Contig34 P 3100 3735 97% SEQ ID No. 2812 528.2 Contig34 m 3861 4526 99% SEQ ID No. 2816 529. 2 Contig34 m 4519 4866 100% SEQ ID No. 1736 3609. 1 Contig34 P 5143 5745 99% SEQ ID No. 1737 3610. 1 Contig34 P 5784 6974 99% + + SEQ ID No 1738 3611. 2 Contig34 m 7103 7888 98% SEQ ID No. 1739 3612. 2 Contig34 m 8026 8814 96% SEQ ID No. 1740 3613. 3 Contig34 P 9024 10349 97% SEQ ID No. 1651 3496.2 Contig 36 P 96 590 100 % SEQ ID No. 1650 3494.2 Contig 36 P 706 1026 + 100% SEQ ID No. 789 216. 2 Contig 36 P 1033 2307 100% SEQ ID No. 782 215. 1 Contig 36 p 2289 2777 100% SEQ ID No. 773 214. 1 Contig 36 p 2823 3278 100% SEQ ID No. 765 213. 1 Contig 36 p 3226 4227 100% SEQ ID No. 759 212. 1 Contig36 p 4308 4799 100% SEQ ID No. 755 211. 1 Contig 36 p 4667 5851 100% SEQ ID No. 746 209.2 Contig 36 m 5843 6589 + 100% SEQ ID No. 2930 5526.2 Contig 36 m 6590 7255 + 100% SEQ ID No. 1037 2549.3 Contig36 p 7391 8842 99% + SEQ ID No. 1530 331. 2 Contig36 m 8894 10513 100% SEQ ID No. 1542 333. 3 Contig36 p 10752 14054 - 100% SEQ ID No. 3021 5690. 2 Contig36 p 14241 14747 + 100% SEQ ID No. 2651 4972. 3 Contig 36 p 14883 15563 100% SEQ ID No. 2649 4969. 3 Contig 36 p 15689 16312 + SEQ ID No. 2648 4968. 2 Contig 36 p 16308 16703 100% SEQ ID No. 2597 4883. 2 Contig37 p 189 647 100% SEQ ID No. 2598 4884.1 Contig37 p 629 1198 99% SEQ ID No. 2599 4885.2 Contig 37 p 1299 1742 - 100% SEQ ID No. 2968 5592. 2 Contig 37 p 1743 2447 100% SEQ ID No. 753 2106.2 Contig 37 p 2608 3153 - 100% SEQ ID No. 752 2104.1 Contig 37 p 3175 3564 - 100% SEQ ID No. 130 1106.5 Contig 37 p 3626 7762 - 99% SEQ ID No. 489 1663. 6 Contig 37 p 7788 12056 - 99% SEQ ID No. 2971 5596. 3 Contig 37 p 12164 12550 - 100% SEQ ID No. 2970 5595. 2 Contig37 p 12544 13098 100% SEQ ID No. 2969 5593. 1 Contig 37 m 12853 13182 98% SEQ ID No. 2305 4468. 2 Contig 37 p 13110 15197 - 99% + SEQ ID No. 2304 4466. 3 Contig 37 p 15176 16408 100% + SEQ ID No. 2303 4465. 3 Contig 37 m 15697 16179 100% SEQ ID No. 2302 4464. 1 Contig 37 p 16396 16731 - 100% SEQ ID No. 2301 4463. 2 Contig 37 p 16754 17416 99% SEQ ID No. 2300 4462 3 Contig 37 p 17413 18021 - 99% SEQ ID No. 3084 5892. 1 Contig 37 p 18006 18314 100% SEQ ID No. 3085 5894. 3 Contig 37 p 18311 19153 100% SEQ ID No. 3086 5895. 3 Contig 37 p 19163 19450 - 100% SEQ ID No. 187 1199. 4 Contig 37 p 19451 19795 100% SEQ ID No. 188 1201. 1 Contig 37 P 19786 20454 - 100% SEQ ID No. 189 1202.2 Contig 37 p 20459 20884 - - 100% - SEQ ID No. 2073 4133.1 Contig 37 p 20866 21078 - + _ SEQ ID No. 2074 4134.1 Contig37 p 21059 21334 100% - SEQ ID No. 2075 4135.1 Contig37 p 21381 21788 100% SEQ ID No. 2076 4136. 1 Contig37 p 21789 22130 - - 99% SEQ ID No. 2077 4138.1 Contig 37 p 22137 22697 - - 100% - SEQ ID No. 2078 4139.1 Contig 37 p 22698 23012 - - 100% - SEQ ID No. 2079 4140.1 Contig 37 p 22960 23430 - 99% SEQ ID No. 2080 4141. 1 Contig 37 p 23421 23987 100% SEQ ID No. 2081 4142.3 Contig 37 p 23941 24357 - - 100 % - SEQ ID No. 2082 4143.3 Contig 37 p 24358 24873 - 100% SEQ ID No. 2083 4144. 3 Contig 37 p 24855 25061 - + SEQ ID No. 2084 4145. 3 Contig 37 p 25049 25495 100% SEQ ID No. 2085 4148. 3 Contig 37 p 25483 26826 99% SEQ ID No. 2086 4149.1 Contig 37 p 27019 27390 100% - SEQ ID No. 2088 4151.1 Contig 37 P 27411 27812 100% - SEQ ID No. 2089 4153.1 Contig 37 p 27826 28449 + - SEQ ID No. 2090 4154.2 Contig 37 p 28468 29460 - 99% - SEQ ID No. 2941 5540.1 Contig 37 p 29461 29862 - - 99% + SEQ ID No. 2940 5539.1 Contig 37 m 29484 29870 98% + SEQ ID No. 2939 5538. 2 Contig 37 m 29929 30444 - - 99% SEQ ID No. 3087 5896. 1 Contig 37 m 30492 30977 - + SEQ ID No. 3088 5897. 1 Contig 37 p 30844 31131 + SEQ ID No. 3173 6119.1 Contig39 m 1 531 + - SEQ ID No. 2988 5630.1 Contig39 p 577 1083 - 91% SEQ ID No. 3048 5774. 2 C ontig39 p 1095 2222 - 79% + SEQ ID No. 741 2080.3 Contig39 p 2669 3373 - 94% - SEQ ID No. 1955 397.2 Contig39 p 3491 4015 - - 100% + SEQ ID No. 1962 398. 2 Contig39 p 3990 5279 - - 96% + SEQ ID No. 1586 3394. 1 Contig39 p 6091 6318 - + + SEQ ID No. 1587 3395.2 Contig39 m 6445 7326 + + SEQ ID No. 1588 3396.1 Contig39 p 7740 8249 + + SEQ ID No. 1589 3397. 1 Contig39 m 8412 8972 - - 89% SEQ ID No. 1590 3398.1 Contig39 m 8984 9424 87% - SEQ ID No. 1591 3399.1 Contig39 m 9506 9724 92% + SEQ ID No. 3106 5935. 1 Contig39 p 9719 9898 87% + SEQ ID No. 1593 3401. 2 Contig39 p 10196 10510 + SEQ ID No. 1594 3402.2 Contig39 m 10565 11563 - 95% - SEQ ID No. 1595 3404.2 Contig39 m 11457 12302 91% SEQ ID No. 1596 3406. 2 Contig39 p 12883 13545 + + SEQ ID No. 2832 5322. 1 Contig39 m 13558 13917 - + SEQ ID No. 2831 5321. 1 Contig39 m 13921 14205 - + SEQ ID No. 2615 4914. 2 Contig39 p 14302 14595 + + + SEQ ID No 2614 4913. 2 Contig39 m 14931 15887 + + SEQ ID No. 3226 677. 6 Contig39 m 16069 18072 + - 95% SEQ ID No. 3225 675. 6 Contig39 m 18045 18512 - 89% + SEQ ID No. 3224 673. 3 Contig39 m 18568 20133 - - 97% + SEQ ID No. 1712 3575.2 Contig39 m 20124 21500 + 98% - SEQ ID No. 1711 3574.1 Contig39 m 21501 22601 95% SEQ ID No. 116 1089. 2 Contig39 m 22468 25227 - 96% SEQ ID No. 118 1090.1 Contig39 m 25228 25578 - 87% - SEQ ID No. 119 1091.2 Contig39 m 25532 26836 + 95% SEQ ID No. 120 1092.3 Contig39 m 26788 27693 98% - SEQ ID No. 2684 5031.2 Contig39 m 27551 28276 - 97% + SEQ ID No. 2685 5032.1 Contig39 m 28200 28625 - 98% + SEQ ID No. 2686 5033 1 Contig39 m 28574 28948 + - 99% + SEQ ID No. 2829 5319. 1 Contig39 m 29202 29537 97% + SEQ ID No. 2828 5318. 2 Contig39 m 29538 30179 96% SEQ ID No. 2072 4132. 3 Contig39 m 30161 30625 - 99% SEQ ID No. 2071 4131.3 Contig39 m 30592 31416 + - 94% - SEQ ID No. 3049 5776.1 Contig39 m 31406 31666 - + + SEQ ID No. 2070 4130. 2 Contig39 m 31603 32019 + + _ SEQ ID No. 2068 4129.1 Contig39 m 31995 32513 + + - SEQ ID No. 2067 4128.1 Contig39 m 32401 32640 - + SEQ ID No. 2066 4127. 1 Contig39 m 32613 33146 + + SEQ ID No. 2065 4126. 2 Contig39 m 32977 33888 + + SEQ ID No. 2064 4123. 2 Contig39 p 34046 34300 75% SEQ ID No. 3230 682. 2 Contig39 p 34304 35275 - + SEQ ID No. 3229 681. 3 Contig39 m 35343 36095 + + SEQ ID No. 3228 680. 3 Contig39 m 36188 36706 - + SEQ ID No. 3227 678. 3 Contig39 m 36741 37847 + + SEQ ID No. 2639 4955. 4 Contig39 m 37811 39142 - 85% SEQ ID No. 2638 4954. 2 Contig39 m 39111 39632 93% SEQ ID No. 2637 4952. 1 Contig39 m 39610 40287 - 81% + SEQ ID No. 2636 4951. 2 Contig39 m 40214 40783 90% SEQ ID No. 2858 5382. 1 Contig39 p 40834 41157 - + + SEQ ID No. 2515 4764. 2 Contig39 p 41153 41398 - + + SEQ ID No. 2514 4763. 2 Contig39 m 41667 42947 - + SEQ ID No. 609 1847. 3 Contig39 p 43268 45091 - 97% SEQ ID No. 1718 3588. 2 Contig39 p 45192 45809 - 98% SEQ ID No. 1717 3586. 2 Contig39 p 46123 47250 - 88% SEQ ID No. 207 1229. 3 Contig39 p 47244 47789 - 95% + SEQ ID No. 206 1227. 1 Contig39 p 48300 49013 - - 95% SEQ ID NO: ID No. 926 2383. 4 Contig39 p 49143 49373 + + SEQ ID No. 309 1390. 5 Contig39 p 49497 49979 - - 96% + SEQ ID No. 310 1391. 1 Contig39 p 50090 50704 97% SEQ ID No. 311 1392 2 Contig39 m 50780 51103 + SEQ ID No. 1716 3584.1 Contig39 m 51193 51399 - + SEQ ID No. 260 131.2 Contig39 m 51668 52141 + SEQ ID No. 3172 6117. 1 Contig39 p 52705 55920 + SEQ ID No. 3047 577.2 Contig39 p 56130 57014 - + SEQ ID No. 1816 3729.1 Contig39 m 57019 57618 - + SEQ ID No. 1817 3730. 1 Contig39 m 57909 58367 + + SEQ ID No. 1818 3731. 1 Contig39 m 58368 58904 - + SEQ ID No. 1819 3732. 1 Contig39 p 59289 60173 + SEQ ID No. 1820 3734.1 Contig39 p 60441 61568 + SEQ ID No. 1821 3735.2 Contig39 p 61850 63517 + + SEQ ID No. 3079 5874. 1 Contig4O m 2 553 - + SEQ ID No. 3185 615.5 Contig4O p 534 1337 + SEQ ID No. 1176 2767.1 Contig4O m 2006 3424 + + SEQ ID No. 1969 399. 2 Contig4O m 3481 5943 + + SEQ ID No. 1978 400.1 Contig4O m 5934 6746 - + SEQ ID No. 1985 401.2 Contig4O p 6795 8066 - + SEQ ID No. 1993 402. 2 Conti g4O p 8321 9913 + + + SEQ ID No. 760 2120. 2 Contig4O p 10617 11687 - 97% + SEQ ID No. 107 1075. 3 Contig4O p 11840 13171 - 99% SEQ ID No. 106 1074. 3 Contig4O p 13158 15182 98% SEQ ID No. 761 2121. 2 Contig 400 p 15227 15976 + 97% SEQ ID No. 1175 2765. 2 Contig 400 m 16013 16903 95% + SEQ ID No. 1174 2763. 2 Contig4O m 16914 17111 - + + SEQ ID No 1173 2761. 1 Contig 400 p 17411 17758 - 100% SEQ ID No. 1172 2760. 1 Contig 410 p 17730 17999 - + SEQ ID No. 1170 2759. 1 Contig4O p 17938 18912 - 98% SEQ ID No. 1169 2757. 1 Contig4O p 18913 19374 - - 98% SEQ ID No. 1168 2755. 1 Contig40 p 19564 21600 - 98% + SEQ ID No. 1167 2754. 2 Contig4O m 21696 22277 - 99% SEQ ID No. 1166 2753. 1 Contig4O m 22278 22781 - 98% + SEQ ID No. 1165 2752. 1 Contig4O m 22782 23303 + - 100% SEQ ID No. 1164 2751. 1 Contig4O m 23593 24363 99% SEQ ID No. 3351 859. 2 Contig4O p 24703 26091 - 99% + SEQ ID No. 3350 858. 2 Contig4O p 26045 26566 97% SEQ ID No. 371 1493. 6 Contig4O p 26618 31495 - - 99% + SEQ ID No. 509 1697 2 Contig4O p 31501 32064 - 98% SEQ ID No. 510 1698. 2 Contig4O m 32095 33180 96% SEQ ID No. 2882 5429. 1 Contig4O p 33195 33449 97% SEQ ID No. 1047 2562. 2 Contig4O p 33385 33834 - 95% + SEQ ID No. 1046 2560. 3 Contig4O p 33902 34498 - - 99% SEQ ID No. 1044 2559. 3 Contig4O p 34609 35655 - - 99% SEQ ID No. 2881 5428. 1 Contig4O p 35656 36054 - 100% SEQ ID No. 2880 5427. 1 Contig4O p 36055 36756 100% SEQ ID No. 2879 5426. 2 Contig4O p 36750 37220 - 100% SEQ ID No. 1010 2504. 4 Contig4O p 37208 38215 - - 99% SEQ ID No. 1009 2501. 2 Contig4O p 38209 39480 + - 99% SEQ ID No. 1572 3367. 1 Contig4O p 39438 40316 98% SEQ ID No. 3241 699. 3 Contig4O m 40345 41484 - - 96% SEQ ID No. 3243 701. 2 Contig4O m 41465 42997 - 96% SEQ ID No. 3244 702. 2 Contig4O m 42928 43755 - 96% SEQ ID No. 1571 3365. 2 Contig4O m 43915 44994 95% SEQ ID No. 1570 3363. 2 Contig4O m 44988 45944 99% SEQ ID No. ID No. 1569 3362. Contig4O p 46177 46929 - 97% SEQ ID No. 1568 3360. 1 Contig4O p 46986 47717 + 89% + SEQ ID No. 1 84 1190. 4 Contig 400 m 47773 49917 + 96% SEQ ID No. 1566 3359. 2 Contig40 m 50090 52309 99% SEQ ID No. 3026 5701. 2 Contig4O m 52481 53623 99% SEQ ID No. 2799 5250. 2 Contig40 m 53596 54588 - 100% SEQ ID No. 1029 2535. 2 Contig4O m 54563 55675 100% SEQ ID No. 1030 2536. 2 Contig40 p 55808 57139 95% SEQ ID No. 2349 4523. 1 Contig40 p 57063 57629 - 96% SEQ ID No 2350 4524. 1 Contig4O p 57787 58506 + 91% SEQ ID No. 2351 4525. 2 Contig4O m 58554 60278 98% SEQ ID No. 2730 5094. 2 Contig40 p 60305 61030 - 98% SEQ ID No. 2729 5093. 3 Contig4O p 61021 61755 98% SEQ ID No. 2728 5092. 3 Contig40 p 61746 62498 - 98% + SEQ ID No. 2800 5253. 1 Contig40 m 62587 63249 99% SEQ ID No. 2472 4705. 3 Contig4O p 63281 64168 98% SEQ ID No. 2473 4706. 3 Contig 400 p 64231 64728 - 97% SEQ ID No. 2474 4709. Contig4O p 64725 65897 99% SEQ ID No. 2475 4710. Contig40 p 66072 66860 + 98% SEQ ID No. 2476 4711. 1 Contig4O p 66832 67404 - 98% SEQ ID No. 2477 4712. Contig40 p 67379 68674 97% SEQ ID No. 2801 5254. 1 Contig40 p 68650 69366 - 99% SEQ ID No. 2802 5255. 1 Contig40 p 69367 70545 + 99% SEQ ID No. 2658 4987. 2 Contig4O p 70541 71938 99% + SEQ ID No. 2584 4865. 2 Contig40 m 72015 72449 100% SEQ ID No. 3074 5857. 1 Contig 40 m 72492 72932 - 97% SEQ ID No. 3073 5856. 1 Contig40 m 72914 73102 + SEQ ID No. 3080 5875.1 Contig4lm 1 303 + SEQ ID No. 1882 3837.3 Contig4l p 521 2047 - 92% SEQ ID No. 1881 3835. 2 Contig4l p 2208 2951 96% SEQ ID No. 1051 2569. 3 Contig4l p 3162 3887 95% SEQ ID No. 1050 2568. 1 Contig4l m 3950 4378 98% + SEQ ID No 1049 2567. 2 Contig4l m 4563 5330 99% SEQ ID No. 1880 3834.1 Contig4l p 5573 6613 - 96% + SEQ ID No. 1879 3832.1 Contig4l p 6654 7868 97% SEQ ID No. 1878 3830.2 Contig4l 7864 8817 - 96% + SEQ ID No. 1549 334. 5 Contig4l 8929 11910 - - 97% SEQ ID No. 1557 335.1 Contig4l 12010 12723 98% SEQ ID No. 1567 336.1 Contig4l 12734 13735 - 99% SEQ ID No. 1574 337. 2 Contig4l 13745 15148 - 92% + SEQ ID No. 1583 339. 4 Contig4l 15296 15880 + + SEQ ID No. 1597 341.6 C ontig4l 16002 16445 + + + SEQ ID No. 2856 5380.3 Contig4l 16574 17140 - - 97% SEQ ID No. 2263 4395.2 Contig 41 17210 19366 - 99% SEQ ID No. 2264 4396. 1 Contig4 19330 19821 - 98% SEQ ID No. 2265 4398.2 Contig4l 20000 21013 - 99% SEQ ID No. 2996 5644.3 Contig4l 21132 22817 + 98% SEQ ID No. 2619 4919.1 Contig4l 23043 24431 99% SEQ ID No. 2618 4918. 2 Contig4l 24412 25359 - 99% SEQ ID No. 2995 5642.1 Contig4l 25302 26252 - 99% + SEQ ID No. 1911 3895.2 Contig4l 26209 27321 + - 99% SEQ ID No. 1910 3892.3 Contig4l 27384 28613 99% SEQ ID No. 2784 5216. 2 Contig4l 29032 29880 - 97% SEQ ID No. 3375 891.3 Contig 41 29993 31594 - 98% + SEQ ID No. 3374 889.1 Contig 41 31734 32231 + - 99% SEQ ID No. 3373 888.3 Contig4 32336 33607 99% SEQ ID No. 3444 986. 3 Contig4l 33608 33868 100% SEQ ID No. 3445 989.3 Contig4l 34035 35312 - 98% + SEQ ID No. 3447 991.2 Contig4l 35832 36698 - + SEQ ID No. 3400 925. 3 Contig4l 36685 38610 - - 99% SEQ ID No. 84 1040. 3 Contig41 38592 39653 96% SEQ ID No. 85 1041.3 C ontig4l 40023 42467 - 99% SEQ ID No. 939 2406.3 Contig4l 42737 43828 - - 97% SEQ ID No. 938 2404.2 Contig4l 43795 44931 98% SEQ ID No. 937 2402. 3 Contig4l 44912 46285 - - 100% SEQ ID No. 2687 5037. 1 Contig4l 46971 47156 - + SEQ ID No. 2688 5038. 1 Contig4l 47157 47501 100% + SEQ ID No. 2689 5039. 2 Contig4l 47465 47713 - 100% SEQ ID No. 2690 5040. 2 Contig4l 47714 49393 + 99% SEQ ID No. 173 1174.2 Contig4l 49394 50734 - 98% SEQ ID No. 174 1176.5 Contig4l p 51021 52868 98% + SEQ ID No. 1048 2565.4 Contig4l m 52865 53674 - - 97% SEQ ID No. 1205 2815. 2 Contig4l m 53870 55639 - + SEQ ID No. 1206 2816. 2 Contig4l p 56182 58359 + 99% SEQ ID No. 1207 2818. 1 Contig4l m 58410 59606 98% SEQ ID No. 1209 2820. 1 Contig4l m 59607 60461 - 98% SEQ ID No 1210 2822. 1 Contig4l p 60447 62309 + 97% SEQ ID No. 763 2127. 2 Contig4l p 62316 62687 - 99% SEQ ID No. 764 2129. 1 Contig4l p 62699 63313 98% SEQ ID No. 766 2130. 1 Contig4l p 63314 63889 + 98% SEQ ID No. 767 2132. 2 Contig4l p 63867 64478 98% S EQ ID No. 768 2133. 1 Contig4l m 64548 64796 98% + SEQ ID No. 769 2135. 1 Contig4l p 64932 65342 + 99% SEQ ID No. 770 2136. 1 Contig4l p 65284 66171 100% SEQ ID No. 771 2137 1 Contig4l p 66209 66487 - 100% SEQ ID No. 772 2138. 2 Contig4l p 66491 67009 100% SEQ ID No. 774 2140. 2 Contig4l p 66999 67553 - 98% SEQ ID No. 412 1552. 3 Contig4l p 67559 69124 - 100% SEQ ID No. 413 1555. 2 Contig4l p 69211 70080 99% SEQ ID No. 414 1556. 2 Contig4l p 70081 71469 - 100% SEQ ID No. 1211 2824. 1 Contig4l p 71460 71903 - 100% SEQ ID No. 4,989,910. 4 Contig. P. 72529 74787 98% + SEQ ID No. 3388 909. 2 Contigyl m 74894 75811-98% SEQ ID No. 758 2119. Contig 4 p 75964 77661 + 98% SEQ ID No. 1212 2826. 1 Contig4l p 78109 79644 - 99% + SEQ ID No. 1213 2827. 3 Contig4l p 79904 82522 99% + SEQ ID No. 1214 2828. 3 Contig4l p 82606 82911 + SEQ ID No. 2927 5521.1 Contig42 p 297 830 100% SEQ ID No. 2926 5520.1 Contig42 p 831 1391 + + + SEQ ID No. 1793 3684. 2 Contig42 p 1367 2128 - 100% + SEQ ID No. 1794 3685. 1 Contig42 p 2210 2536 100% SEQ ID No. 1795 3686. 1 Contig42 p 2533 4083 100% SEQ ID No. 1796 3687.1 Contig42 p 4196 5224 - 100% SEQ ID No. 1797 3688.1 Contig42 m 5536 5817 100% SEQ ID No. 3298 776.3 Contig42 m 6700 8211 100% SEQ ID No. 3299 778. 2 Contig42 m 8247 9074 - 100% + SEQ ID No. 3300 779. 4 Contig42 p 9150 10607 - 99% SEQ ID No. 2062 4119. 2 Contig42 p 10583 11368 100% SEQ ID No. 2061 4118. 3 Contig42 p 11344 12006 100% SEQ ID No. 2060 4116. 3 Contig42 p 12007 12717 100% SEQ ID No. 2059 4115. 1 Contig42 p 12639 13736 100% SEQ ID No 555 1764. 3 Contig42 p 13730 14869 - 100% SEQ ID No. 556 1765. 4 Contig42 p 14850 15467 - 100% SEQ ID No. 592 1818. 4 Contig42 p 15448 16980 - 100% SEQ ID No. 2058 4113. 1 Contig42 p 17043 17633 100% SEQ ID No. 2057 4112. 1 Contig42 p 17634 18518 - 100% SEQ ID No. 2056 4111. 2 Contig42 p 18460 19557 - 100% SEQ ID No. 2920 5500. 1 Contig42 p 19572 21095 - 100 % SEQ ID No. 2918 5499. 1 Contig42 p 21199 22125 100% SEQ ID No. 2917 5498. 1 Contig 42 p 22116 23102 - 100% SEQ ID No. 2916 5497. 1 Contig42 p 23074 24090 + 100% SEQ ID No. 3171 6110. 1 Contig42 p 24187 24447 100% + SEQ ID No. 2915 5496. 2 Contig42 p 24434 24973 100 % + SEQ ID No. 2646 4965. 2 Contig42 p 24949 25446 100% + SEQ ID No. 2647 4966. 2 Contig42 m 25547 27379 100% + SEQ ID No. 666 1935. 4 Contig42 m 27346 28494 100% + SEQ ID No 665 1934. 4 Contig42 m 28475 29512 - 100% + SEQ ID No. 2530 4782. 3 Contig42 m 29466 30560 - 100% SEQ ID No. 2932 5528. 2 Contig42 m 30570 31292 - 100% + SEQ ID No. 2705 5060 2 Contig42 p 31581 33122 - 100% + SEQ ID No. 2706 5061. 4 Contig42 p 33331 35037 100% + SEQ ID No. 2091 4156. 3 Contig42 p 34991 35854 100% SEQ ID No. 2092 4157. 2 Contig42 p 35845 37275 - 100% SEQ ID No. 2093 4158. 1 Contig42 p 37269 38429 + 100% + SEQ ID No. 2094 4159. 1 Contig42 m 38443 39345 100% SEQ ID No. 287 1359. 2 Contig42 p 40114 41187 - 100% SEQ ID No. 2095 4160. Contig42 m 41300 42163 100% SEQ ID No. 2096 4161.

  3 Contig42 m 42188 43207 100% SEQ ID No. 2934 5530. 2 Contig42 p 43383 44126 - 100% SEQ ID No. 2803 5256. 2 Contig42 p 44544 44879 - 100% SEQ ID No. 1877 3827. 2 Contig42 m 45005 46999 100 % SEQ ID No. 1876 3826. 1 Contig42 m 47150 48148 - 100% SEQ ID No. 977 2457. 2 Contig42 m 48149 48919 100% SEQ ID No. 976 2456. 2 Contig42 p 48965 49921 100% SEQ ID No. 1875 3824 2 Contig42 p 49884 51209 - 100% SEQ ID No. 1874 3822. 2 Contig42 p 51526 52095 - 100% SEQ ID No. 1873 3821. 1 Contig42 p 52422 53600 - 100% + SEQ ID No. 880 2320. 3 Contig42 p 53588 55039 - 99% SEQ ID No. 879 2319. 3 Contig42 m 55138 56562 - 100% SEQ ID No. 941 2409. 3 Contig42 p 56686 57420 + 100% SEQ ID No. 943 2410. 2 Contig42 p 57574 58845 + 100% SEQ ID No. 1196 2795. 1 Contig42 p 58861 59223 - 100% SEQ ID No. 2866 540. 3 Contig42 p 59184 59567 - 100% SEQ ID No. 2862 539. 3 Contig42 p 59488 60189 100% SEQ ID No. 2855 538 1 Contig42 p 60700 61350 - 99% + SEQ ID No. 2850 537. 2 Contig42 p 61594 62016 + 100% + SEQ ID No. 1 082 262. 3 Contig42 m 62121 63479 - 100% SEQ ID No. 1089 263. 1 Contig42 m 63539 65284 100% + SEQ ID No. 1093 264. 2 Contig42 m 65185 66576 - 100% + SEQ ID No. 3331 829. 2 Contig42 p 66690 68411 + 100% SEQ ID No. 1195 2794. 2 Contig42 m 68614 70335 100% SEQ ID No. 1194 2793. 1 Contig42 m 70547 71560 100% SEQ ID No. 1193 2792. 1 Contig42 p 71391 71660 - + + SEQ ID No. 1192 2791. 1 Contig42 p 71734 74157 - 100% SEQ ID No. 1191 2788. 1 Contig42 p 74393 75838 - 100% SEQ ID No. 1190 2785. 1 Contig42 p 75829 76677 - 100% SEQ ID No. 623 1865. 3 Contig42 p 76665 77765 - 100% SEQ ID No. 622 1864. 3 Contig42 p 77689 79155 - 100% SEQ ID No. 1189 2784. 3 Contig42 p 79238 79564 + - 100% SEQ ID No. 2569 4841. 2 Contig42 p 79724 80797 - 100% SEQ ID No. 2568 4837. 1 Contig42 p 80754 81683 - 100% SEQ ID No. 2567 4836. 1 Contig42 p 81668 82159 - 100% SEQ ID No. 2566 4835. 4 Contig42 m 82095 82778 - 100 % SEQ ID No. 2565 4834. 4 Contig42 p 82282 82476 - 100% + SEQ ID No. 3001 5650. 3 Contig42 p 82949 8365 6 100% SEQ ID No. 3000 5649. 1 Contig42 p 83688 85022 - 100% SEQ ID No. 2999 5648. 1 Contig42 m 84306 84641 100% SEQ ID No. 2998 5647. 1 Contig42 p 85391 85759 - 100% SEQ ID No 2997 5645. 2 Contig42 p 85779 88058 100% SEQ ID No. 3170 6108. 1 Contig42 p 88359 88874 - + SEQ ID No. 342 1440.2 Contig43 p 2 1249 + - 100% SEQ ID No. 70 1021.3 Contig43 p 1363 4413 - 100% SEQ ID No. 1519 3295.2 Contig43 p 4645 7437 100% SEQ ID No. 531 1733. 3 Contig43 p 7541 8806 + - 100% SEQ ID No. 1518 3291. 2 Contig43 p 8871 9356 - 100% + SEQ ID No. 1517 3290. 1 Contig43 m 9457 10470 99% + SEQ ID No. 1516 3288. 3 Contig43 p 10583 11272 - 97% SEQ ID No. 1515 3285. 3 Contig43 p 11250 12326 - 95% SEQ ID No. 2358 4533. 2 Contig43 m 12519 18197 + + SEQ ID No. 2505 475. 1 Contig43 p 18407 18700 + SEQ ID No. 2498 474. 2 Contig43 p 18701 19033 + + SEQ ID No. 2049 4101. 1 Contig43 p 19176 19379 + SEQ ID No. 2047 4098.1 Contig43 p 19655 20044 + SEQ ID No. 2046 4097.1 Contig43 p 20045 20302 - + SEQ ID No. 2045 4096 1 Contig43 m 20278 20760 + SEQ ID No. 983 2464.2 Contig43 m 20673 21026 + SEQ ID No. 982 2462.2 Contig43 p 21047 21406 - + SEQ ID No. 981 2461. 2 Contig43 p 21548 21760 + SEQ ID No. 2809 5273.1 Contig43 m 21791 22153 + SEQ ID No. 980 2460.3 Contig43 m 22069 23802 + 99% SEQ ID No. 1463 3212. 2 Contig43 m 23799 24497 + - 98% SEQ ID No. 74 1028. 3 Contig43 m 24521 25792 - 97% SEQ ID No. 76 1030. 3 Contig43 m 25732 26601 - 96% SEQ ID No. 77 1032. 3 Contig43 p 26819 27790 - - 99% SEQ ID No. 78 1034. 3 Contig43 p 27791 28777 + 96% SEQ ID No. 762 2122 2 Contig43 p 28807 30006 + 98% SEQ ID No. 293 1367. 3 Contig43 m 30046 30639 + - 97% SEQ ID No. 295 1369. 2 Contig43 m 30471 30911 - 97% SEQ ID No. 294 1368. 2 Contig43 p 30475 30666 96% + SEQ ID No. 296 1370. 5 Contig43 m 31018 31629 - 99% SEQ ID No. 1071 2599. 4 Contig43 m 31671 33359 - 99% + SEQ ID No. 1073 2600. 4 Contig43 m 33387 34418 - 99% + SEQ ID No. 1464 3217. 3 Contig43 m 34496 35749 96% SEQ ID No. 1465 3218. 1 Contig43 p 35810 3 6511 + + SEQ ID No. 1467 3221. 1 Contig43 P 36457 37890 100% SEQ ID No. 1468 3223. 1 Contig43 p 37875 38759 98% + SEQ ID No. 1469 3224. 3 Contig43 P 38946 41255 + 100% + SEQ ID No. 491 1666. 3 Contig43 p 41339 43054 96% + SEQ ID No. 1348 304. 2 Contig43 m 43061 45910 95% + SEQ ID No. 1324 300. 2 Contig43 P 46000 47781 98% SEQ ID No. 593 1819. 6 Contig43 m 48139 52452 95% + SEQ ID No. 974 2450. 3 Contig43 m 52511 54343 98% SEQ ID No. 340 1438. 4 Contig43 p 54447 56333 98% SEQ ID No. 2783 521. 2 Contig43 m 56667 58832 - 98% SEQ ID No. 2776 520. 1 Contig43 m 59041 59676 99% + SEQ ID No. 2771 519. 3 Contig43 m 59604 61277 100% SEQ ID No. 1235 2869. 1 Contig43 m 61278 61583 - 100% SEQ ID No. 1234 2868 1 Contig43 P 61643 63514 + 98% SEQ ID No. 1233 2866. 1 Contig43 p 63598 64923 - 97% + SEQ ID No. 1052 2570. 2 Contig43 m 64993 66153 + 99% SEQ ID No. 1053 2571. 2 Contig43 m 66126 67073 - 97% SEQ ID No. 1232 2863. 1 Contig43 m 67045 67788 - 94% SEQ ID No. 1231 2862. 1 Contig43 m 67685 68956 9 6% SEQ ID No. 156 1148. 2 Contig43 m 69161 71929 - 98% SEQ ID No. 541 1746. 2 Contig43 p 71971 72792 - 91% SEQ ID No. 542 1747. 2 Contig43 m 73047 73409 100% + SEQ ID No 1230 2861. 1 Contig43 P 73575 74438 - 97% SEQ ID No. 969 2443. 2 Contig43 p 74407 75246 95% + SEQ ID No. 968 2442. 2 Contig43 m 75266 76591 99% SEQ ID No. 2502 4746. 1 Contig43 m 76572 76862 + 97% SEQ ID No. 2503 4748. 1 Contig43 m 76881 77648 - 99% SEQ ID No. 2504 4749. 2 Contig43 m 77687 79966 - 98% SEQ ID No. 1442 3172. 2 Contig43 m 80019 80918 99% SEQ ID No. 3066 5824. Contig43 m 80785 81201 SEQ ID No. 1443 3173. Contig43 p 81385 81654 + 98% SEQ ID No. 1444 3174. Contig43 p 81648 82529 96% SEQ ID No. 1445 3175. 1 Contig43 p 82516 83301 - - 94% SEQ ID No. 1446 3177. 1 Contig43 p 83277 83762 98% SEQ ID No. 1447 3178. 1 Contig43 p 83973 84629 - 98% SEQ ID No. 1448 3179. 1 Contig43 p 84611 86452 + - 99% SEQ ID No. 3169 6107. 1 Contig43 m 86295 86489 + + SEQ ID No. 261 1314. 3 Contig43 m 86777 88240 + - 99% S EQ ID No. 1450 3181. 2 Contig43 m 88225 89379 - 99% SEQ ID No. 2762 5167. 4 Contig43 m 89396 89701 + SEQ ID No. 3168 6106.1 Contig43 m 89715 89972 + SEQ ID No. 1275 2938.3 Contig44 p 205 3858 98 % + SEQ ID No. 1274 2934. 1 Contig44 m 3925 5202 97% + SEQ ID No. 1273 2933.2 Contig44 m 5328 6305 - - 94% SEQ ID No. 1272 2932.2 Contig44 m 6328 8805 + SEQ ID No. 2833 5324. 1 Contig44 m 8763 9419 + SEQ ID No. 946 2414.2 Contig44 m 9382 10485 - + SEQ ID No. 945 2413.1 Contig44 m 10652 10867 + SEQ ID No. 944 2412. 2 Contig44 m 11014 12684 - 97% SEQ ID No. 1074 2602. 2 Contig44 m 12685 13578 100% SEQ ID No. 1075 2604. 3 Contig44 m 13579 15414 99% + SEQ ID No. 3281 755. 3 Contig44 m 15517 16344 - - 97% SEQ ID No. 3280 754. 2 Contig44 m 16437 17450 - 98% SEQ ID No. 3279 753. 2 Contig44 p 17613 18584 + 98% SEQ ID No. 1270 2929. 1 Contig44 p 18836 19348 - - 99% SEQ ID No. 1269 2928. 2 Contig44 m 19362 20231 - 99% SEQ ID No. 1268 2926. 1 Contig44 p 20406 20564 + + SEQ ID No. 1267 2925. 1 Contig44 p 20 611 22620 - 99% SEQ ID No. 1266 2924. 3 Contig44 m 22704 24785 - 96% + SEQ ID No. 3065 5823. 2 Contig44 p 24801 26072 + 99% SEQ ID No. 845 226. 4 Contig44 m 26153 27034 - - 96% + SEQ ID No. 1634 3466. 1 Contig44 p 27076 27321 - + SEQ ID No. 3064 5822. 1 Contig44 p 27230 27472 - + + SEQ ID No. 826 223. 1 Contig44 m 27631 28530 - + SEQ ID No. 822 222.1 Contig44 p 28556 29101 - + SEQ ID No. 817 221.1 Contig44 p 29082 29993 + SEQ ID No. 812 220. 1 Contig44 p 29972 30685 - + SEQ ID No. 649 1906. 2 Contig44 m 31080 32615 99% SEQ ID No 648 1905. 2 Contig44 m 32600 33892 - 99% SEQ ID No. 349 1454. 2 Contig44 m 34019 35995 - - 100% SEQ ID No. 2846 536. 3 Contig44 p 36111 38714 - 98% SEQ ID No. 2835 533. 2 Contig44 p 38923 39735 - - 96% SEQ ID No. 2830 532. 2 Contig44 m 39785 40900 + - 99% SEQ ID No. 784 2151. 2 Contig44 p 41026 42417 96% SEQ ID No. 1456 3196. 3 Contig44 p 42479 43987 - - 99% + SEQ ID No. 884 2324. 4 Contig44 p 44152 45291 98% + SEQ ID No. 3063 5821. 1 Contig44 p 45218 45577 + + SEQ ID No. 883 2323. 2 Contig44 m 45462 46322 97% + SEQ ID No. 882 2322. 2 Contig44 m 46545 47288 98% SEQ ID No. 1457 3198. 1 Contig44 m 47234 47797 - 100% SEQ ID No. 1458 3199. 1 Contig44 m 48054 49808 - 97% SEQ ID No. 3218 663. 2 Contig44 p 49960 51945 98% SEQ ID No. 3219 665. 2 Contig44 m 51996 52349 - 98% SEQ ID No. 3220 666. 2 Contig44 p 52242 52985 - - 100% SEQ ID No. 1459 3201. 1 Contig44 p 53078 55018 + 100% SEQ ID No. 3196 632. 2 Contig44 p 54982 55926 98% SEQ ID No. 3197 633. 3 Contig44 p 55984 57357 - 100% SEQ ID No. 2805 5266. 2 Contig44 m 57427 60807 - 89% + SEQ ID No. 3029 5719. 2 Contig44 p 60988 61779 - - 98% SEQ ID No. 1300 297. 2 Contig44 p 61710 62090 - - 99% SEQ ID No 1289 296. 1 Contig44 p 62252 62626 + 99% SEQ ID No. 1281 295. 1 Contig44 p 62864 63349 - - 100% SEQ ID No. 1276 294. 1 Contig44 p 63372 64055 99% + SEQ ID No. 1271 293. 2 Contig44 p 64030 65301 98% + SEQ ID No. 1263 292. 1 Contig44 p 65323 65865 99% + SEQ ID No. 1255 291. 4 Contig44 p 65866 67161 - - 99% SEQ ID No. 66 1011. 5 Contig44 p 67175 69529 - - 98% SEQ ID No. 65 1010. 2 Contig44 p 69530 70564 - - 97% SEQ ID No. 64 1009. 2 Contig44 p 70565 71083 98% SEQ ID No. 63 1006.3 Contig44 p 71092 71754 + 96% SEQ ID No. 1742 3617.2 Contig44 p 71658 72077 - 100% SEQ ID No. 1743 3618.2 Contig44 p 72070 74055 + 99% SEQ ID No. 318 1402. 2 Contig44 p 74062 75576 100% SEQ ID No. 317 1400. 2 Contig44 p 75570 77072 99% SEQ ID No. 1744 3619. 1 Contig44 p 77256 77771 100% SEQ ID No. 1745 3621. 2 Contig44 p 77720 79261 99% SEQ ID No. 530 1730 3 Contig44 p 79326 81956 99% SEQ ID No. 1927 3920. 1 Contig44 p 81957 82331 100% SEQ ID No. 1926 3919. 1 Contig44 p 82297 83229 98% SEQ ID No. 1925 3917. 1 Contig44 p 83374 83652 + SEQ ID No. 3113 5957.1 Contig44 p 83695 84627 + SEQ ID No. 1924 3916.3 Contig44 p 84579 85955 97% SEQ ID No. 1017 2517. 2 Contig44 p 86081 87181 + 95% SEQ ID No. 1018 2518. 4 Contig44 m 87240 87869 99 % SEQ ID No. 1020 2520. 4 Contig44 m 87791 88135 98% SEQ ID No. 2691 5041. 2 C ontig44 p 88262 88798 100% SEQ ID No. 2692 5042. 1 Contig44 m 88860 89207 98% + SEQ ID No. 2693 5043. 3 Contig44 p 88939 90213 + 98% SEQ ID No. 2708 5064. 2 Contig44 p 90483 91244 97% + SEQ ID No. 2707 5062. 3 Contig44 p 91473 92150 94% SEQ ID No. 3062 5818. 1 Contig44 m 91982 92296 + + SEQ ID No. 2142 4232. 3 Contig44 m 92543 93277 97% SEQ ID No. 2141 4231. 2 Contig44 p 93455 94969 97% + SEQ ID No. 3399 923. 3 Contig44 m 95217 97235 97% + SEQ ID No. 3398 922. 2 Contig44 m 97211 98074 + 98% SEQ ID No. 3397 921. 3 Contig44 m 98064 98678 98% SEQ ID No. 3061 5816. 1 Contig44 m 98666 99019 99% SEQ ID No. 3338 84. 4 Contig44 m 99038 100735 96% SEQ ID No. 3327 82. 2 Contig44 m 101521 101775 100% + SEQ ID No. 1157 2741. 2 Contig44 m 102053 102259 + SEQ ID No. 1158 2742. 2 Contig44 p 102309 102515 + SEQ ID No. 3305 79. 1 Contig44 p 102657 102878 + SEQ ID No. 3292 77. 1 Contig44 p 103230 103448 + + SEQ ID No. 3031 5720.1 Contig45 p 1 204 + + SEQ ID No. 3032 5723.1 Contig45 p 218 523 + SEQ ID No 3033 5724. 2 Contig45 p 651 2195 89% + SEQ ID No. 513 1703. 1 Contig45 m 2232 3020 98% SEQ ID No. 514 1704.4 Contig45 m 3189 5213 97% SEQ ID No. 636 1887.2 Contig45 m 5447 7078 90% SEQ ID No. 637 1889. 2 Contig 45 m 7392 8750 91% + SEQ ID No. 1614 3432. 2 Contig45 p 8936 10051 95% SEQ ID No. 1613 3431. 3 Contig45 p 10009 11346 98% SEQ ID No. 839 2250. 2 Contig45 p 11577 12230 + 95% + SEQ ID No. 1611 3429. 1 Contig45 p 12616 14904 95% + SEQ ID No. 1610 3428. 1 Contig45 m 15087 15905 96% SEQ ID No. 1609 3426. 1 Contig45 m 16078 16782 97% SEQ ID No. 1608 3423. 3 Contig 45 m 17254 18540 91% SEQ ID No. 1607 3421. 2 Contig45 p 18675 20015 96% + SEQ ID No. 1605 3419. 3 Contig45 m 20115 20882 92% + SEQ ID No. 2788 5224. 2 Contig45 p 21155 21526 + SEQ ID No. 1216 2830.3 Contig45 p 21481 22104 + + SEQ ID No. 1217 2831.1 Contig45 p 22331 23041 82% - SEQ ID No. 1218 2833.1 Contig45 p 23134 24129 91% SEQ ID No. 508 1695.2 Contig45 m 24311 25426 92% - SEQ ID No. 507 1693.2 Contig45 p 25663 25947 91% SEQ ID No. 1219 2835. 1 Contig45 p 26014 26910 + 91% SEQ ID No. 1220 2838.1 Contig45 p 26911 28107 92% - SEQ ID No. 1222 2840.1 Contig45 p 28121 29647 91% SEQ ID No. 1223 2841.4 Contig45 p 29814 31133 95% - SEQ ID No. 288 1360.6 Contig45 m 31446 32963 96% - SEQ ID No. 289 1361.3 Contig45 p 33558 34631 98% SEQ ID No. 246 1286. 3 Contig45 p 34628 36538 98% SEQ ID No. 245 1284.2 Contig45 p 36772 37059 96% - SEQ ID No. 244 1283.2 Contig45 p 37016 38341 98% SEQ ID No. 1224 2847. 4 Contig45 p 38461 39105 95% + SEQ ID No. 1225 2848. 4 Contig45 m 39163 39426 + + SEQ ID No. 1226 2849. 1 Contig45 p 39757 40530 93% + SEQ ID No. 711 2029. 2 Contig45 m 41434 42672 95% + SEQ ID No. 710 2027. 2 Contig45 m 42859 44145 + SEQ ID No. 709 2026. 1 Contig45 p 44695 44994 80% + SEQ ID No. 2102 417. 3 Contig45 m 45095 45925 + SEQ ID No. 2087 415.2 Contig45 p 46532 47668 - + SEQ ID No. 2069 413.5 Contig45 m 48015 50384 + SEQ ID No. 2623 4927. 1 Contig45 m 50814 51575 + + SEQ ID No. 2624 4929. 2 Contig45 m 517 54 52683 - 98% SEQ ID No. 2626 4930. 2 Contig45 m 52692 52979 100% SEQ ID No. 2404 4604. 3 Contig45 m 53037 53615 - 99% SEQ ID No. 3306 790. 3 Contig45 m 53670 56318 95% + SEQ ID No. 1259 2915. 2 Contig45 m 56619 59432 - 97% + SEQ ID No. 1915 390. 2 Contig45 p 59678 60028 - 99% SEQ ID No. 1907 389.3 Contig45 p 59965 61974 98% - SEQ ID No. 1258 2914.1 Contig45 p 61952 62623 - 97% SEQ ID No. 482 1655. 2 Contig45 p 62532 62795 - 100% SEQ ID No. 483 1657. 1 Contig45 p 62789 63544 - - 98% SEQ ID No. 3035 5730. 1 Contig45 m 63648 63923 97 % SEQ ID No. 484 1658. 2 Contig45 p 63762 65222 - 98% + SEQ ID No. 153 1142. 4 Contig45 m 65328 66779 + 99% SEQ ID No. 1257 2911. 3 Contig45 m 66824 67198 - - 99% SEQ ID No. 795 2169. 2 Contig 45 p 67426 67854 + 97% SEQ ID No. 796 2170. 1 Contig 45 p 68018 68461 + - 97% SEQ ID No. 3449 993. 2 Contig 45 m 68458 69726 - 99% SEQ ID No. 3448 992 2 Contig45 p 68996 69385 100% + SEQ ID No. 3450 994. 2 Contig45 m 69800 72601 + - 99% SEQ ID No. 1256 2910. 1 Contig45 p 72535 74043 - 98% SEQ ID No. 1254 2909. 1 Contig45 p 74272 75552 - 98% SEQ ID No. 1253 2908. 2 Contig45 p 75581 76588 98% + SEQ ID No. 1252 2906. 2 Contig45 p 76746 77390 - 97% SEQ ID No. 1251 2905. 2 Contig45 p 77708 79522 98% + SEQ ID No. 241 1279. 3 Contig45 p 79527 80066 - - 96% SEQ ID No. 240 1278. 2 Contig45 m 80071 81282 99% SEQ ID No. 754 2108. 2 Contig45 p 81438 82382 - 99% SEQ ID No. 102 1069. 2 Contig45 p 82510 83586 + SEQ ID No. 101 1067.1 Contig45 p 83801 84055 + SEQ ID No. 100 1066.2 Contig45 m 84221 85126 94% SEQ ID No. 1735 3608. 1 Contig 45 m 85559 85888 - - 100% + SEQ ID No. 1734 3607. 2 Contig 45 m 85993 87189 - - 97% SEQ ID No. 2763 5173. Contig45 m 87262 89307 96% SEQ ID No. 1842 3765. 1 Contig45 m 89250 90209 - 98% SEQ ID No. 958 2429. 2 Contig45 m 90197 91141 - 99% SEQ ID No. 957 2428. 2 Contig45 P 91233 91619 - + SEQ ID No. 956 2427. 4 Contig45 m 91643 92011 - + SEQ ID No. 1841 3764. 3 Contig45 p 92316 92675 - + + SEQ ID No. 1840 3763. 1 Contig45 p 92636 93379 - + SEQ ID No. 1839 3761. 1 Contig45 P 93268 93459 + + SEQ ID No. 1838 3760. 3 Contig45 m 93555 95363 + 99% SEQ ID No. 2032 4075. 3 Contig45 m 95380 95859 - - 98% SEQ ID No 2033 4076. 1 Contig45 m 96123 96674 - 95% + SEQ ID No. 534 1737. 2 Contig45 P 96822 97934 + SEQ ID No. 533 1735.1 Contig45 P 98103 98318 - + + SEQ ID No. 532 1734.2 Contig45 p 98319 98483 + + SEQ ID No. 2034 4078.1 Contig45 m 98517 99893 - - 97% SEQ ID No. 2036 4080. 2 Contig45 p 100247 101554 + - 97% SEQ ID No. 2764 5174.

* 2 Contig45 m 101564 102016 + 99% + SEQ ID No. 496 1675. 3 Contig45 m 102037 102357 99% SEQ ID No. 495 1673. 5 Contig45 P 102412 104136 - 97% SEQ ID No. 492 1669. 3 Contig45 m 104200 105201 - - 98% SEQ ID No. 493 1670. 3 Contig45 p 105391 106725 96% SEQ ID No. 2135 4222. 3 Contig45 m 106907 107263 - 97% SEQ ID No. 2134 4221. 3 Contig45 p 107390 107692 - 97% SEQ ID No. ID No. 2133 4220. 2 Contig 45 m 107870 108175 + SEQ ID No. 1884 384. 3 Contig 45 m 108189 109274 - + SEQ ID No. 502 1685. 3 Contig45 m 109460 110584 - 98% SEQ ID No. 3390 914. 3 Contig45 m 110599 112401 - 98% SEQ ID No. 3391 915. 3 Contig45 m 112344 113216 + - 97% SEQ ID No. 2765 5176. 1 Contig45 m 113642 113920 + + SEQ ID No. 2766 5177. 2 Contig45 P 114007 114765 - - 99% SEQ ID No. 3036 5735. 2 Contig45 p 114761 115966 + 98% SEQ ID No. 2972 5598. 2 Contig45 P 116104 117363 + - 99% SEQ ID No. 3166 6098. 1 Contig45 p 117531 117845 + SEQ ID No. 2256 4387. 3 Contig45 P 117746 118360 93% SEQ ID No. 2257 4388. 1 Contig45 m 118391 119 677 100% SEQ ID No. 87 1044. 3 Contig45 119649 120962 - 99% SEQ ID No. 86 1042. 5 Contig45 121153 122400 100% SEQ ID No. 2973 5600. 2 Contig45 122515 122787 - - 100% SEQ ID No. 3082 588. 3 Contig45 122879 123670 - - 96% SEQ ID No. 3076 587. 2 Contig45 123642 124427 - 98% SEQ ID No. 3072 585. 2 Contig45 124480 124830 - - 99% SEQ ID No. 3068 583. 2 Contig45 125324 125962 98% SEQ ID No. 3165 6097. 1 Contig45 126102 134465 + SEQ ID No. 3164 6094.1 Contig46 94 366 + SEQ ID No. 2413 4620.1 Contig46 136 441 + SEQ ID No. 2411 4618. 1 Contig46 588 1376 - 100% SEQ ID No. 2410 4616.2 Contig46 1343 2314 + 99% SEQ ID No. 3012 5672.1 Contig46 2296 2640 + + + SEQ ID No. 2409 4615. 3 Contig46 2641 3060 100% + SEQ ID No. 2907 5479.2 Contig46 3146 3784 - 100% SEQ ID No. 1830 3747.2 Contig46 3742 4659 + 100% SEQ ID No. 1831 3748.1 Contig46 4653 6005 - - 100% SEQ ID No. 1832 3750. 2 Contig46 6131 7858 + - 100% SEQ ID No. 1833 3752.2 Contig46 7797 8543 + 100% SEQ ID No. 1834 3753.2 Contig46 8556 10478 + 100% SEQ ID No. 1835 3754.2 Contig46 10557 11339 + 100% SEQ ID No. 1836 3756. 2 Contig46 11314 12657 - 100% SEQ ID No. 2306 4469. 2 Contig46 12750 13640 100% SEQ ID No. 3308 793.2 Contig46 13696 14010 - 100% + SEQ ID No. 3309 794.2 Contig46 13863 14069 + + SEQ ID No. 3310 795.2 Contig46 14074 14865 100% SEQ ID No. 2308 4470. 1 Contig46 14843 15916 100% SEQ ID No. 352 1457. 2 Contig46 15855 16466 98% SEQ ID No. 351 1456.2 Contig46 16467 17201 - - 100% SEQ ID No. 350 1455.2 Contig46 17189 17725 + 100% SEQ ID No. 2309 4471.3 Contig46 17679 18281 + 100% SEQ ID No. 3116 5978. 2 Contig46 18245 18802 - - 100% SEQ ID No. 3095 5903. 2 Contig46 18786 19751 - 100% + SEQ ID No. 3024 5696. 2 Contig46 20113 20913 - 100% + SEQ ID No. 3023 5695. 1 Contig46 20906 21688 - - 100% SEQ ID No. 3022 5694. 2 Contig46 p 21689 22165 + 100% SEQ ID No. 2912 5489. 2 Contig46 p 22170 22781 + 100% SEQ ID No. 2219 4341. 3 Contig46 p 22769 23065 - 100% + SEQ ID No. 2220 4342. 1 Contig46 p 23446 23700 - + SEQ ID No. 2221 4344. 1 Contig46 p 23660 24961 100% SEQ ID No. 2222 4345. 1 Contig46 p 24955 25716 - 100% SEQ ID No. 366 1484. 2 Contig46 m 25905 26603 - - 100% SEQ ID No. 367 1485. 4 Contig46 m 26579 27880 + - 100% SEQ ID No. 2573 4848. 3 Contig46 m 27829 28851 + 100% SEQ ID No. 2572 4847. 2 Contig46 p 29223 29828 - 100% + SEQ ID No. 123 1096. 3 Contig46 p 30003 31439 - - 100% SEQ ID No. 122 1094. 1 Contig46 m 31483 31767 - - 100% SEQ ID No. 121 1093. 3 Contig46 m 31987 32967 - 100% SEQ ID No. 2376 4564. 2 Contig46 p 32890 33672 - 100% SEQ ID No. 1069 2597. 4 Contig46 p 33657 34349 - - 100% SEQ ID No. 1433 3159. 2 Contig46 p 34524 35318 + 100% SEQ ID No. 1432 3158. 1 Contig46 p 35182 35460 - + SEQ ID No. 1431 3157. 1 Contig46 p 35466 35897 + 100% SEQ ID No. 1430 3153. 3 Contig46 p 35885 37846 + 100% SEQ ID No. 1429 3152. 1 Contig46 p 37789 38376 + 100% SEQ ID No. 744 2085. 2 Contig46 p 38340 38777 + 100% SEQ ID No. 743 2083. 2 Contig46 p 38725 39456 + 100% SEQ ID No. 742 2082. 2 Contig46 p 39407 39649 - 100% SEQ ID No. 614 1853. 2 Contig46 p 39690 40109 + - 100% SEQ ID No. 3454 998. 3 Contig46 m 40865 42739 - - 100% + SEQ ID No. 3455 999. 2 Contig46 p 42796 43959 - 100% + SEQ ID No. 58 1000. 2 Contig46 p 43955 44752 100% + SEQ ID No. 406 1542. 2 Contig46 p 44743 45813 - - 100% SEQ ID No. 404 1539. 2 Contig46 m 45979 46878 + - 100% + SEQ ID No. 209 1230. 2 Contig46 p 47057 48649 100% SEQ ID No. 210 1231. 3 Contig46 m 48715 49140 - 100% + SEQ ID No. 2522 4773. 3 Contig46 m 49233 50660 + - 100% SEQ ID No 2523 4774. 1 Contig46 m 50654 50962 100% SEQ ID No. 2524 4775.

  2 Contig46 m 50943 52103 - 100% SEQ ID No. 2525 4776. 3 Contig46 m 52470 53033 100% SEQ ID No. 3163 6093. 1 Contig46 m 53278 53583 100% + SEQ ID No. 728 2060. 3 Contig46 p 53835 54983 100 % SEQ ID No. 729 2062. 2 Contig46 m 55045 55689 + 100% + SEQ ID No. 731 2065. 2 Contig46 p 56118 56603 - 100% SEQ ID No. 730 2064. 3 Contig46 m 56324 56575 - 100% SEQ ID No 732 2066. 5 Contig46 p 56724 57173 - 100% + SEQ ID No. 733 2067. 5 Contig46 p 57300 58376 - 100% SEQ ID No. 2026 4068. 2 Contig46 p 58873 60171 - 100% SEQ ID No. 2025 4067. 2 Contig46 m 59556 59759 100% + SEQ ID No. 2190 4303. 1 Contig46 m 60495 61640 99% SEQ ID No. 2189 4302. 1 Contig46 m 61621 62454 100% SEQ ID No. 2188 4301. 1 Contig46 m 62455 63360 100% SEQ ID No. 332 1420. 2 Contig46 m 63415 64569 - 100% SEQ ID No. 333 1421. 3 Contig46 p 64694 67030 - 100% SEQ ID No. 2888 5446. 3 Contig46 p 67332 68681 - 100% SEQ ID No. 2889 5447. 1 Contig46 p 68866 69651 100% SEQ ID No. 600 1834. 4 Contig46 p 69560 70978 100% SEQ ID No. 3117 5979. 1 Contig46 m 70998 71240 100% + SEQ ID No. 2890 5448. 1 Contig46 p 71292 71837 - 100% SEQ ID No. 2380 4571. 2 Contig46 p 71819 72220 100% SEQ ID No. 1055 2576. 2 Contig46 m 72302 73279 + 100% SEQ ID No. 1056 2578. 2 Contig46 m 73534 74286 100% + SEQ ID No. 2381 4572. 2 Contig46 m 74477 75556 100% SEQ ID No. 2382 4573. 4 Contig46 m 75541 77133 + 100% + SEQ ID No. 3096 5904. 2 Contig46 p 77481 78152 - 100% SEQ ID No. 2673 5010. 2 Contig46 p 78136 79059 + 100% SEQ ID No. 2674 5015. 2 Contig46 p 79272 79613 100% SEQ ID No. 2896 5460. 1 Contig46 p 79588 80679 + 99% SEQ ID No. 1959 3974. 2 Contig46 p 80784 81344 100% SEQ ID No. 1958 3972. 2 Contig46 p 81539 82297 100% + SEQ ID No. 1957 3971. 2 Contig46 m 82354 82878 100 % SEQ ID No. 1956 3970. 1 Contig46 m 82868 83266 - 100% SEQ ID No. 1954 3969. 1 Contig46 m 83279 83998 + 100% SEQ ID No. 1953 3968. 1 Contig46 p 84058 84474 - 100% SEQ ID No. 1952 3967. 1 Contig46 p 84548 85108 + 100% SEQ ID No. 1951 3966. 1 Contig46 p 85386 86165 - 100% SEQ ID No. 1950 3965. 1 Contig46 p 86726 87241 100% SEQ ID No. 1949 3964. 1 Contig46 p 87172 88179 100% SEQ ID No. 1948 3962. 2 Contig46 p 88158 88514 100% SEQ ID No. 2897 5462. 2 Contig46 p 88889 90562 99% SEQ ID No. 3205 643. 3 Contig46 p 90559 92034 100% SEQ ID No. 3206 644. 2 Contig46 m 92079 93134 100% SEQ ID No. 3207 645. 4 Contig46 m 93128 93838 100% SEQ ID No. 3208,647. 5 Contig46 p 94033 94683 100% SEQ ID No. 2579 4859. 2 Contig46 p 94693 95967 99% + SEQ ID No. 2581 4860. 1 Contig46 p 95971 96123 + + SEQ ID No. 2924 5515. 2 Contig46 p 96370 97125 99% SEQ ID No. 1939 3942. 2 Contig46 p 97130 98077 99% SEQ ID No. 3191 623. 2 Contig46 p 98038 99210 - 98% SEQ ID No. 3190 622. 3 Contig46 m 99282 101681 + 99% SEQ ID No. 2923 5514. 2 Contig46 m 101816 102838 89% + SEQ ID No. 2865 5398. 3 Contig46 p 103240 104304 99% SEQ ID No. 1697 3555. 2 Contig46 p 104305 104856 99% SEQ ID No. 1696 3554. 4 Contig46 p 104831 105469 99% SEQ ID No. 642 1895. 6 Contig46 p 105421 106050 96% SEQ ID No. 643 1896. 5 Contig46 p 106051 108150 + 99% SEQ ID No. 1695 3551. 1 Contig46 p 108590 109123 + 100% SEQ ID No. 1694 3550. 1 Contig46 p 109101 110219 98% SEQ ID No. 1693 3548. 2 Contig46 p 110195 111667 97% + SEQ ID No. 1692 3547. 1 Contig46 p 111746 112207 99% SEQ ID No. 1691 3545. 1 Contig46 p 112319 113317 98% SEQ ID No. 370 1490. 4 Contig46 p 113424 116225 99% SEQ ID No 369 1488. 2 Contig46 m 114650 114994 98% + SEQ ID No. 830 2233. 3 Contig46 p 116207 116686 + 98% SEQ ID No. 829 2232. 1 Contig46 m 116985 117551 98% SEQ ID No. 242 1280. 3 Contig46 m 117725 119929 98% + SEQ ID No. 292 1366. 3 Contig46 m 120156 123287 97% + SEQ ID No. 1750 3629. 2 Contig46 p 123454 124431 99% SEQ ID No. 1455 3193. 2 Contig46 p 124409 125110 98% SEQ ID No. 1454 3191. 1 Contig46 m 125166 126344 97% + SEQ ID No. 1453 3190. 1 Contig46 m 126503 127390 94% SEQ ID No. 788 2159. 2 Contig46 p 127607 128428 99% SEQ ID No. 455 1615. 2 Contig46 p 128397 130232 - 99% + SEQ ID No. 790 2160. 2 Contig46 p 130192 1311 84 - 98% + SEQ ID No. 2111 418. 4 Contig46 m 131572 132249 + 100% SEQ ID No. 2116 419. 2 Contig46 p 132432 133271 - 98% SEQ ID No. 2128 421. 2 Contig46 p 133283 134725 99% + SEQ ID No. 2132 422. 3 Contig46 p 134726 135649 98% SEQ ID No. 605 1841. 2 Contig46 p 135667 137343 98% SEQ ID No. 1452 3186. 2 Contig46 m 137322 140789 - 99% + SEQ ID No. 1451 3184 3 Contig46 m 140860 142122 - 99% SEQ ID No. 89 1048. 3 Contig46 m 142126 143316 99% SEQ ID No. 88 1047. 2 Contig46 m 143301 144233 + 98% SEQ ID No. 886 2330. 2 Contig46 p 144380 146443 98% SEQ ID No. 887 2333. 3 Contig46 p 146545 148728 98% SEQ ID No. 2683 5030. 2 Contig46 p 148587 149702 - 99% SEQ ID No. 1931 3927. 2 Contig46 p 149681 151072 - 98% SEQ ID No. 469 1636. 2 Contig46 p 151141 154593 99% SEQ ID No. 1930 3925. 2 Contig46 m 154679 155944 - 99% + SEQ ID No. 1929 3924. 2 Contig46 p 156244 157134 - 98% SEQ ID No. 243 1282. 3 Contig46 p 157074 158642 97% SEQ ID No. 1928 3923. 2 Contig46 p 158658 160574 - 99% SEQ ID No. 2570 4844. 2 Contig46 m 160720 161328 - 93% + SEQ ID No. 2571 4845. 4 Contig46 m 161597 163333 96% + SEQ ID No. 2161 4255. 1 Contig46 m 163658 164020 100% + SEQ ID No. 2160 4254. 2 Contig46 p 163752 164525 96% + SEQ ID No. 2159 4253. 1 Contig46 m 164822 166306 100% SEQ ID No.873 2309. 2 Contig46 p 166657 167811 + 97% SEQ ID No. 872 2308. 2 Contig46 p 168348 168671 + + SEQ ID No 3162 6089. 1 Contig46 m 168652 169203 + SEQ ID No. 3120 5985.1 Contig47 m 21 398 + SEQ ID No. 3083 5890.1 Contig47 m 596 778 - + + SEQ ID No. 1768 3653. 3 Contig47 m 801 1010 + SEQ ID No 1769 3655.1 Contig47 m 1280 1993 + + SEQ ID No. 2733 510.2 Contig47 m 1971 2675 + + SEQ ID No. 2726 509. 1 Contig47 m 2774 3367 + SEQ ID No. 2713 507.3 Contig47 m 3397 3723 - 93% SEQ ID No 2704 506.3 Contig47 p 4108 4518 + + SEQ ID No. 2697 505. 3 Contig47 m 4559 5503 - + + SEQ ID No. 1770 3657.1 Contig47 m 5811 6452 - + SEQ ID No. 1771 3658.1 Contig47 P 6810 7100 + + SEQ ID No. 3417,948. 3 Contig47 P 7066 7596 + SEQ ID No. 3416 947.3 Contig47 m 7565 7927 + SEQ ID No. 3415 946.3 Contig47 m 7965 8639 - + SEQ ID No. 1772 3659. 2 Contig47 m 8757 9299 - + + SEQ ID No. 1774 3661. 4 Contig47 m 9263 10255 + + SEQ ID No. 2984 5620. 3 Contig47 P 10879 11130 96% SEQ ID No. 786 2153. 3 Contig47 P 11124 11363 + + SEQ ID No. 2163 426. 3 Contig47 p 11669 12370 - + + SEQ ID No. 2156 425. 1 Contig47 m 12661 12954 + + SEQ ID No. 2148 424. 1 Contig47 m 12935 13252 - 96% SEQ ID No. 2140 423. 2 Contig47 m 13262 14566 + + SEQ ID No. 2985 5621. 1 Contig47 m 14589 15851 + + SEQ ID No. 2986 5623. 2 Contig47 m 16093 17499 + + SEQ ID No. 1909 3891. 2 Contig47 m 17492 18145 + + SEQ ID No. 1908 3890. 2 Contig47 P 18284 19642 + + SEQ ID No. 1906 3889.1 Contig47 m 19632 20417 + - SEQ ID No. 1905 3888.1 Contig47 m 20390 20593 + SEQ ID No. 1904 3887. 1 Contig47 m 20607 21833 + SEQ ID No. 1903 3884. 2 Contig47 p 22460 22942 - 96% + SEQ ID No. 338 1432. 3 Contig47 P 23126 24049 - 98% SEQ ID No. 337 1429. 4 Contig47 m 24232 25806 + + + SEQ ID No. 2868 5404. 2 Contig47 m 26133 27047 + SEQ ID No. 2867 5402. 1 Contig47 P 27185 28633 86% + SEQ ID No. 1028 2533. 3 Contig47 P 28867 29787 - - 84% SEQ ID No. 1027 2530. 3 Contig47 p 29880 31814 - - 95% SEQ ID No. 1733 3602. 2 Contig47 P 31894 33795 - - 87% SEQ ID No. 1732 3601. 1 Contig47 P 33973 35130 - + SEQ ID No. 1731 3600.2 Contig47 P 35321 36292 + - SEQ ID No. 975 2453.4 Contig47 p 36235 39030 + SEQ ID No. 480 1652. 4 Contig47 39121 39687 - 91% SEQ ID No. 481 1653.3 Contig47 39802 40740 + 96% SEQ ID No. 3148 606.3 Contig47 40856 42601 + 95% + SEQ ID No. 3174 612.2 Contig47 42746 44959 - 96% SEQ ID No. 740 2079. 2 Contig47 45270 46547 - 93% + SEQ ID No. 739 2078. 2 Contig47 46681 46965 + + SEQ ID No. 1783 3673. 2 Contig47 47107 48360 94% SEQ ID No. 3057 5809. 1 Contig47 48148 48435 79% + SEQ ID No. 2617 4917. 2 Contig47 48380 49735 94% + SEQ ID No. 2616 4916. 2 Contig47 49917 50837 95% SEQ ID No. 3004 5655. 2 Contig47 50958 51446 99% SEQ ID No. 3003 5654.2 Contig47 51771 52181 - 94% + SEQ ID No. 2628 4935.2 Contig47 52309 53451 - 97% SEQ ID No. 2627 4934.3 Contig47 53749 54948 98% SEQ ID No. 3056 5808. 1 Contig47 55003 55581 - 97% SEQ ID No. 3427 964.3 Contig47 55765 57123 - 90% + SEQ ID No. 3421 953.2 Contig47 57651 59225 89% SEQ ID No. 3420 952. 1 Contig47 59202 60149 - 98% SEQ ID No. 3419 950. 2 Contig47 60306 61823 85% SEQ ID No. 1493 3252.1 Contig47 62076 63032 - 98% + SEQ ID No. 1492 3251.1 Contig47 62996 63430 - 99% SEQ ID No. 3383 901.2 Contig47 63514 64692 - 87% + SEQ ID No. 3384 903. 2 Contig47 64977 66098 - 94% + SEQ ID No. 3385 905 2 Contig47 66185 67045 + + SEQ ID No. 1491 3250.1 Contig47 67309 67623 - - 96% + SEQ ID No. 1489 3249.2 Contig47 67801 68496 - - 98% SEQ ID No. 418 1562.3 Contig47 68820 69641 - 97% + SEQ ID No 3161 6087. 1 Contig47 69577 69876 + + SEQ ID No. 417 1560.2 Contig47 69761 70600 + SEQ ID No. 1488 3248.1 Contig47 70560 71483 - + SEQ ID No. 1487 3246. 2 Contig47 71805 73802 95% SEQ ID No. 619 1861 2 Contig47 73905 74735 96% + SEQ ID No. 618 1860. 2 Contig47 75237 76346 92% SEQ ID No. 1546 3336.2 Contig47 76579 77034 + - 93% + SEQ ID No. 1547 3337.2 Contig47 77247 77543 90% + SEQ ID No. 1548 3338.1 Contig47 p 77766 78158 - + + SEQ ID No. 1550 3341. 2 Contig47 p 78359 81394 + + SEQ ID No. 1551 3343. 1 Contig47 m 81608 82249 + + SEQ ID No. 1552 3345. 2 Contig47 m 82458 84782 98% + SEQ ID No. 1062 2585. 2 Contig47 p 84972 86738 + 95% + SEQ ID No. 422 1567. 2 Contig47 m 86827 88173 92% + SEQ ID No. 421 1566. 3 Contig47 m 88505 89068 + SEQ ID No. 490 1664. 2 Contig47 m 89346 90161 87% + SEQ ID No. 2818 5297. 2 Contig47 p 90488 91873 + + SEQ ID No. 2345 4519. 3 Contig47 p 92237 93889 97% SEQ ID No. 3438 979. 3 Contig47 p 93871 95094 94% SEQ ID No 3439 980. 1 Contig47 p 95095 95814 98% SEQ ID No. 3440 981. 2 Contig47 p 95787 96434 84% SEQ ID No. 2344 4517. 2 Contig47 p 96391 97248 92% SEQ ID No. 2558 4819. 2 Contig47 p 97143 98192 93% SEQ ID No. 2560 4821. 2 Contig47 p 98266 99219 94% SEQ ID No. 2575 4850. 2 Co ntig47 p 99385 101181 93% + SEQ ID No. 2576 4851. 2 Contig47 p 101415 101942 94% SEQ ID No. 897 2347. 2 Contig47 p 101957 103012 92% + SEQ ID No. 896 2346. 1 Contig47 p 103046 103429 91% + SEQ ID No. 895 2345. 2 Contig47 m 103536 103991 96% + SEQ ID No. 275 1336. 3 Contig47 m 104195 105385 98% SEQ ID No. 2136 4225. 1 Contig47 p 105500 105769 94% + SEQ ID No. 881 2321. 3 Contig47 m 105652 106263 98% SEQ ID No. 2871 5412. 1 Contig47 p 106268 107311 97% SEQ ID No. 2395 4591. 2 Contig47 p 107343 107822 94% SEQ ID No. 2394 4590. 1 Contig47 p 107862 108332 100 % SEQ ID No. 2392 4589. 1 Contig47 m 108456 109088 96% + SEQ ID No. 2391 4588. 2 Contig47 m 109240 109881 99% + SEQ ID No. 2390 4587. 2 Contig47 p 109974 110486 97% + SEQ ID No. 2872 5413. 1 Contig47 p 110505 110849 100% + SEQ ID No. 949 2419. 3 Contig47 p 110960 111712 98% SEQ ID No. 948 2418. 2 Contig47 p 111783 112523 + 97% SEQ ID No. 947 2415. 2 Contig47 m 112603 113577 95% SEQ ID No. 2103 4170. 1 Contig47 m 113730 116510 97% SEQ ID No. 2101 4168. 2 Contig47 p 116698 117213 - 98% + SEQ ID No. 2529 4780. 2 Contig47 m 117261 117761 95% + SEQ ID No. 2528 4779. 1 Contig47 P 118015 118479 97% SEQ ID No. 2527 4778. 1 Contig47 p 118604 119269 88% + SEQ ID No. 2526 4777. 2 Contig47 p 119435 120775 96% + SEQ ID No. 2873 5417. 1 Contig47 m 120900 121331 99% SEQ ID No. 2233 4357. 3 Contig47 m 121371 122663 97 % SEQ ID No. 2234 4358. 2 Contig47 m 122641 123207 96% SEQ ID No. 2964 5586. 1 Contig47 m 123420 123806 96% SEQ ID No. 998 2485. 3 Contig47 p 123935 124582 97% SEQ ID No. 629 1878. 3 Contig47 p 124766 125719 98% SEQ ID No. 628 1875. 2 Contig47 P 125840 127069 + SEQ ID No. 2236 4363. 2 Contig47 p 127205 127927 98% SEQ ID No. 2717 5076. 2 Contig47 m 127987 128469 87% SEQ ID No. 2718 5077. 3 Contig47 m 128463 129851 99% SEQ ID No. 1767 3652. 2 Contig47 m 129748 130578 98% SEQ ID No. 1766 3651. 1 Contig47 m 130551 131399 98% SEQ ID No. 1765 3650. 1 Contig47 m 131389 132657 97% SEQ ID No. 1011 2506. 2 Contig47 m 132564 133 628 98% SEQ ID No. 1012 2508. 3 Contig47 m 133619 134782 98% SEQ ID No. 1763 3647. 2 Contig47 m 134722 134958 + SEQ ID No. 264 1320. 3 Contig47 m 134959 137187 97% SEQ ID No. 1762 3645 3 Contig47 m 137198 137989 94% SEQ ID No. 3055 5807. 1 Contig47 m 137956 138348 99% SEQ ID No. 2471 4704. 2 Contig47 m 138309 139100 98% SEQ ID No. 2470 4703. 2 Contig47 p 139054 139539 + SEQ ID No. 2469 4702. 1 Contig47 p 139494 140090 94% SEQ ID No. 2468 4701. 2 Contig47 m 140087 140926 93% SEQ ID No. 2507 4752. 2 Contig47 m 141084 142007 98% SEQ ID No. 2508 4754. 1 Contig47 p 142255 143601 97% + SEQ ID No. 2509 4755. 2 Contig47 m 143628 144191 98% SEQ ID No. 2024 4066. 2 Contig47 p 144222 144818 96% SEQ ID No. 2023 4065. 3 Contig47 P 144790 146553 98% SEQ ID No. 2022 4063. Contig47 m 146659 148047 97% SEQ ID No. 2021 4061. 1 Contig47 m 148048 148587 99% SEQ ID No. 2020 4060. 1 Contig47 m 148533 149945 - 97% SEQ ID No. 488 1661. 3 Contig47 p 149794 150489 98% SEQ ID No. 487 1660. 2 Contig47 p 150510 150761 89% + SEQ ID No. 485 1659. 4 Contig47 p 150829 154725 96% + SEQ ID No. 835 2242. 1 Contig47 m 154849 155424 98% + SEQ ID No. 312 1394. 2 Contig47 m 155492 155962 + SEQ ID No 313 1396. 3 Contig47 p 156048 157058 98% SEQ ID No. 314 1397. 2 Contig47 p 157308 157814 99% SEQ ID No. 1867 3811. 1 Contig47 m 157863 158390 + SEQ ID No. 1866 3810. 1 Contig47 p 158615 159328 97% SEQ ID No. 587 1807. 3 Contig47 m 159379 160806 100% SEQ ID No. 586 1806. 2 Contig47 p 160979 161524 99% SEQ ID No. 585 1805. 3 Contig47 m 161682 162344 98% SEQ ID No. 2368 4551 2 Contig47 m 162316 162594 100% SEQ ID No. 2369 4552. 4 Contig47 p 162799 163758 89% + SEQ ID No. 2844 5354. 3 Contig47 p 164077 164319 + 98% + SEQ ID No. 356 1467. 5 Contig47 p 164422 165021 98% SEQ ID No. 355 1466. 2 Contig47 p 165058 165801 98% SEQ ID No. 2430 4645. 2 Contig47 p 165886 167118 99% SEQ ID No. 2429 4644. 3 Contig47 m 167115 168464 95% + SEQ ID No. 2126 4206. 2 Contig47 p 168685 171516 97% + SEQ ID No. 2125 4205. 2 Contig 47 p 171437 172408 91% + SEQ ID No. 2124 4203. 2 Contig47 p 172808 174076 100% SEQ ID No. 2123 4200. 2 Contig47 m 174124 174822 99% + SEQ ID No. 301 1377. 5 Contig47 m 175216 177651 97% + SEQ ID No. 302 1378. 5 Contig47 m 177711 178910 98% + SEQ ID No. 2843 5349. 3 Contig47 p 179148 181841 + + SEQ ID No. 2286 4431. 2 Contig47 p 181989 184718 91% + SEQ ID No. 2746 5129. 4 Contig47 m 185037 188228 + 99% SEQ ID No. 2589 4873. 3 Contig47 m 188249 189448 98% SEQ ID No. 2588 4872. 3 Contig47 m 189409 190986 + 98% SEQ ID No. 3160 6086. 1 Contig47 m 191153 191521 98% SEQ ID No. 3016 5685. 2 Contig47 m 191522 192799 98% SEQ ID No. 3017 5686. 2 Contig47 p 192951 193427 98% SEQ ID No. 3018 5687. 1 Contig47 p 193621 193965 99% + SEQ ID No. 3019 5688. 2 Contig47 p 194152 194715 79% + SEQ ID No. 2958 5569.

  1 Contig47 m 194808 195188 + 98% + SEQ ID No. 2957 5566. 1 Contig47 p 195344 195577 + + SEQ ID No. 99 1065. 3 Contig47 m 195618 196814 - 96% SEQ ID No. 98 1063. 1 Contig47 m 197173 198501 - 98% + SEQ ID No. 2664 4998. 2 Contig47 m 198880 200607 - 96% + SEQ ID No. 2663 4995. 1 Contig47 p 200711 201430 - 98% + SEQ ID No. 1604 3418. 1 Contig48 p 1 852 - 96 % + SEQ ID No. 723 2053.2 Contig48 p 913 1896 + - 98% + SEQ ID No. 2379 457.2 Contig48 p 2184 3791 - 94% SEQ ID No. 2362 454.1 Contig48 p 3988 5505 - 93% SEQ ID No. 2354 453. 3 Contig48 p 5528 6304 - 98% + SEQ ID No. 1603 3417. 1 Contig48 p 6528 7109 - 100% SEQ ID No. 1602 3416. 1 Contig48 m 7125 7490 - - 100% SEQ ID No. 1601 3415. 2 Contig48 m 7689 8420 - - 97% SEQ ID No. 1782 3671. 2 Contig48 m 8410 9171 - 96% SEQ ID No. 1781 3670. 2 Contig48 p 9712 10764 - 97% + SEQ ID No. 1780 3669. 1 Contig48 m 10859 11821 - 99% SEQ ID No. 1779 3667. 1 Contig48 p 12363 12653 100% + SEQ ID No. 1778 3666. 2 Contig48 p 12768 14036 + SEQ ID No. 1777 366 5.1 Contig48 p 14015 14953 + SEQ ID No. 1776 3664.1 Contig48 p 15069 16226 - + SEQ ID No. 1775 3663. 1 Contig48 p 16350 17441 + SEQ ID No. 900 2351. 2 Contig48 p 17599 18432 94% SEQ ID No. 899 2350. 2 Contig48 m 17731 18108 83% + SEQ ID No. 901 2352. 2 Contig48 p 18433 19479 88% SEQ ID No. 902 2353. 3 Contig48 m 19451 20626 - 95% SEQ ID No. 2153 4247. 2 Contig48 p 20746 21615 76% + SEQ ID No. 111 1080. 2 Contig48 p 21518 22444 + SEQ ID No. 112 1081.2 Contig48 m 22650 23873 + + SEQ ID No. 2154 4248.1 Contig48 p 24264 24533 + SEQ ID No. 2155 4249. 1 Contig48 p 24436 25785 - 96% SEQ ID No. 2157 4250. 1 Contig48 m 25684 26193 + + SEQ ID No. 2158 4251. 2 Contig48 m 26261 27592 + + SEQ ID No. 639 1891. 2 Contig48 m 27597 28370 + SEQ ID No 756 2112.2 Contig48 p 28628 30067 + SEQ ID No. 3337 838.3 Contig48 m 30280 31686 - 99% + SEQ ID No. 3339 840. 2 Contig48 p 31793 32653 - 95% SEQ ID No. 3340 841. 3 Contig48 p 32857 33192 - 100% SEQ ID No. 806 2193. 4 Contig48 p 33494 34777 - 100% SEQ ID No. 807 2195. 1 Contig48 p 34920 36389 - 99% SEQ ID No. 808 2196. 1 Contig 48 p 36362 37102 - 99% SEQ ID No. 809 2197. 1 Contig 48 p 37090 37314 - + + SEQ ID No. 810 2198. 1 Contig48 m 37352 37684 - - 99% SEQ ID No. 811 2199. 2 Contig48 m 37725 38468 98% SEQ ID No. 1197 2799. 1 Contig48 m 38556 38960 - 99% + SEQ ID No. 1198 2800. 1 Contig48 p 39290 40063 - 97% + SEQ ID No. 689 1986. 2 Contig 48 p 40082 41437 - 97% + SEQ ID No. 688 1983. 1 Contig48 p 41412 42260 - - 99% SEQ ID No. 2035 408. 3 Contig48 p 42286 43932 + - 99% SEQ ID No. 2042 409. 2 Contig48 p 43914 45074 - 98% SEQ ID No. 2048 410. 1 Contig48 p 45028 45756 - 99% SEQ ID No. 2063 412. 3 Contig48 p 45684 46946 + 98% SEQ ID No. 919 2373. 2 Contig48 p 47260 48243 + 99% SEQ ID No. 920 2374. 2 Contig48 p 48553 49464 - + + SEQ ID No. 590 1815. 2 Contig48 p 49732 50319 + SEQ ID No. 591 1817.2 Contig48 p 50616 51212 - 98% + SEQ ID No. 2782 5208.1 Contig48 p 51661 52008 + SEQ ID No. 1329 3005.2 Contig48 p 51996 52523 + SEQ ID No. 1462 321. 3 Contig48 p 53567 54463 + SEQ ID No. 1466 322.3 Contig48 p 54569 54796 - + + SEQ ID No. 1472 323.2 Contig48 m 54848 56335 - 97% + SEQ ID No. 719 2044.2 Contig48 p 57557 59509 98% SEQ ID No 523 172. 1 Contig48 m 59557 59775 - + SEQ ID No. 537 174.1 Contig48 p 60382 61275 - 96% SEQ ID No. 551 176.1 Contig48 m 61299 62291 96% + SEQ ID No. 566 178.1 Contig48 p 62390 62704 - 100% + SEQ ID No. 574 179. 1 Contig48 m 62747 63022 - - 95% SEQ ID No. 581 180. 1 Contig48 m 63013 63207 + + SEQ ID No. 594 182. 3 Contig48 m 63200 64855 99% SEQ ID No. 1330 3008.1 Contig48 m 64939 65592 98% - SEQ ID No. 1059 2580.2 Contig48 m 65564 66331 - 99% - SEQ ID No. 1057 2579.2 Contig48 m 66441 66896 - - 98% SEQ ID No. 1331 3009.2 Contig48 m 67167 68123 + + + SEQ ID No. 2365 4546. 3 Contig48 p 68632 69690 - + SEQ ID No. 916 2369. 3 Contig48 m 69875 70516 + - 100% SEQ ID No. 917 2371.1 Contig48 m 70539 71579 - - 97% - SEQ ID No. 918 2372.3 Contig48 m 71633 72022 - - 97% SEQ ID No. 2364 4542. 4 Contig48 p 7 2350 73981 + - 99% SEQ ID No. 503 1689. 3 Contig48 p 74054 75268 + 100% SEQ ID No. 505 1691.3 Contig48 p 75250 76881 - 99% - SEQ ID No. 546 1752.2 Contig48 p 76882 77436 + 100% - SEQ ID No. 545 1750.3 Contig48 p 77589 78464 - - 97% - SEQ ID No. 1243 2884.1 Contig48 m 78487 78768 - - 94% + SEQ ID No. 152 114.2 Contig48 p 79316 79507 - + + SEQ ID No. 157 115. 2 Contig48 p 79533 80096 + SEQ ID No. 163 116.1 Contig48 p 80429 80992 + SEQ ID No. 3159 6083.1 Contig48 p 81259 81510 + + SEQ ID No. 170 117. 1 Contig48 p 81479 81859 + + SEQ ID No. 176 118.1 Contig48 p 81813 82490 + + SEQ ID No. 183 119.1 Contig48 p 82812 83327 + - SEQ ID No. 194 121.1 Contig48 m 83648 84016 - + SEQ ID No. 3043 5765. 1 Contig48 m 84091 84564 + SEQ ID No. 199 122.3 Contig48 m 84504 85001 + 100% - SEQ ID No. 687 1979.1 Contig48 m 85012 85803 - 99% SEQ ID No. 686 1978. 1 Contig48 m 85785 86507 - 97% SEQ ID No. 685 1976.2 Contig48 m 86408 88291 98% - SEQ ID No. 793 2166.2 Contig48 m 88413 90341 97% + SEQ ID No. 794 21 67. 2 Contig48 m 90554 92077 99% SEQ ID No. 1242 2882. 2 Contig48 p 92029 92766 + - 99% SEQ ID No. 3044 5766.1 Contig48 p 92800 93363 + 98% - SEQ ID No. 278 1341.2 Contig48 p 93650 94402 - 98% + SEQ ID No. 277 1339. 2 Contig48 m 94458 95033 - 100% SEQ ID No. 276 1338. 3 Contig48 p 95203 97308 - 98% SEQ ID No. 3282 757.1 Contig48 p 97275 97922 99% - SEQ ID No. 3283 758.1 Contig48 p 97900 98550 - 98% + SEQ ID No. 3284 760. 2 Contig48 p 98779 100542 99% + SEQ ID No. 1741 3614. 3 Contig48 m 100655 101728 99% SEQ ID No. 2119 4194. 3 Contig48 p 101959 103278 99% + SEQ ID No. 3330 825. 4 Contig48 m 103305 104558 + 98% SEQ ID No. 2885 5438. 1 Contig48 m 104563 105147 + SEQ ID No. 3329 823. 4 Contig48 m 105148 105969 98% SEQ ID No. 3328 821. 2 Contig48 p 106064 106960 98% + SEQ ID No. 3158 6081. 1 Contig48 m 107058 107270 + SEQ ID No. 1946 396. 4 Contig48 m 107186 108082 98% SEQ ID No. 1934 393. 1 Contig48 p 108405 108956 100% + SEQ ID No. 3379 897. 2 Contig48 p 108957 111251 99% + SEQ ID No. 3 380 898. 2 Contig48 p 111179 112054 98% SEQ ID No. 3381 899. 3 Contig48 p 112066 112842 98% SEQ ID No. 1814 3720. 2 Contig48 p 112836 113633 97% + SEQ ID No. 2884 5437. 2 Contig48 p 113664 113978 + 94% + SEQ ID No. 3045 5767. 1 Contig48 m 113682 114005 93% + SEQ ID No. 3046 5769. 2 Contig48 m 114096 114503 99% SEQ ID No. 423 1569. 6 Contig48 m 114485 116662 99% SEQ ID No. 951 2422. 3 Contig48 m 116663 117175 98% + SEQ ID No. 952 2423. 2 Contig48 m 117160 118278 98% SEQ ID No. 2922 551. 2 Contig48 p 118410 119204 94% SEQ ID No. 2933 553. 1 Contig48 p 119189 119620 + + SEQ ID No. 2946 555. 2 Contig48 m 119679 120698 96% SEQ ID No. 1360 3058. 1 Contig48 p 120708 121190 100% + SEQ ID No. 863 2291. 2 Contig48 p 121301 122362 100% SEQ ID No. 862 2290. 1 Contig48 p 122363 123283 98% SEQ ID No. 861 2289. 2 Contig48 p 123222 123761 98% SEQ ID No. 1359 3057. 1 Contig48 p 123677 124783 99% SEQ ID No. 1358 3055. 1 Contig48 p 124770 125705 98% SEQ ID No. 1357 3054. 3 Contig48 p 125624 126583 92% SE Q ID No. 1356 3053. 3 Contig 48 m 126062 126499 86% SEQ ID No. 3157 6079. 1 Contig48 m 126066 126479 83% SEQ ID No. 736 2070. 4 Contig48 p 126562 128229 + 98% SEQ ID No. 681014. 2 Contig 48 p 128457 129848 98% SEQ ID No. 67 1013. Contig48 m 128699 129295 - - 97% + SEQ ID No. 734 2068. 3 Contig48 p 130078 131586 + - 98% + SEQ.ID No. 2448 4669. 2 Contig48 p 131759 132040 - 97% SEQ ID No. 2447 4668.1 Contig48 m 132141 133445 - 98% - SEQ ID No. 2446 4666.2 Contig48 p 133569 134588 + 98% - SEQ ID No. 365 1482.4 Contig48 p 134694 135689 - 98% SEQ ID No. 714 2034.2 Contig48 m 136325 137179 - 96% - SEQ ID No. 2836 5334.1 Contig48 p 137595 138359 - 83% SEQ ID No. 1427 315. 3 Contig48 p 137887 138900 + SEQ ID No. 1441 317.1 Contig48 m 138934 139956 - 99% + SEQ ID No. 1449 318.2 Contig48 m 139970 141388 - 99% + - SEQ ID No. 589 1812.4 Contig48 m 141531 142739 + - 99% SEQ ID No. 866 2295.3 Contig48 m 142854 143399 - 96% SEQ ID No. 867 2297. 3 Contig48 m 143330 143803 - 99% SEQ ID No. 2611 4907. 2 Contig48 m 143912 144691 - 98% SEQ ID No. 2837 5337.1 Contig48 m 144919 145224 - + - SEQ ID No. 2838 5338.2 Contig48 m 145238 146323 - 100% SEQ ID No. 2165 4266.3 Contig48 p 146551 147867 - 99% - SEQ ID No. 3258 723.3 Contig48 p 148217 150046 - 99% - SEQ ID No. 3257 722.3 Contig48 p 150016 150708 - 97% SEQ ID No. 3256 719.4 Contig48 p 150832 153201 - 99% - SEQ ID No. 3011 5671.2 Contig48 p 153153 153584 - 100% SEQ ID No. 3009 5669.2 Contig48 p 153548 155221 - - 99% + SEQ ID No. 3008 5668. 2 Contig48 m 155278 157158 - - 97% + SEQ ID No. 3005 5656. 2 Contig48 p 157395 158135 - 99% SEQ ID No. 3092 590. 4 Contig 48 p 158250 161354 - + + SEQ ID No. 2398 4599. 2 Contig48 m 161403 162059 - + SEQ ID No. 3156 6074.1 Contig49 p 3 614 + SEQ ID No. 2278 4421.2 Contig49 p 599 1414 - + - SEQ ID No. 2279 4422.1 Contig49 p 1499 1792 + + SEQ ID No. 2280 4424. 1 Contig49 p 1861 2124 + + SEQ ID No. 2281 4425.1 Contig49 p 2147 2680 - 94% SEQ ID No. 2282 4427.1 Contig49 m 3129 3356 + + SEQ ID No. 2283 44 28. 1 Contig49 p 3412 3774 + SEQ ID No. 2284 4429. 2 Contig49 m 3570 3890 91% + SEQ ID No. 597 1827.3 Contig49 P 4176 5615 - + + SEQ ID No. 596 1826.2 Contig49 p 5708 -6622 - 95 % + SEQ ID No. 2621 4920.4 Contig49 m 6970 7851 94% SEQ ID No. 256 1302. 2 Contig49 m 7878 9074 99% SEQ ID No. 257 1303.3 Contig49 m 9075 9848 - 97% SEQ ID No. 1709 3570.2 Contig49 m 9817 10080 + SEQ ID No. 931 2392. 2 Contig49 m 10206 10697 96% + SEQ ID No. 930 2391. 2 Contig49 P 10897 11898 84% + SEQ ID No. 1710 3572. 1 Contig49 m 12027 12509 - 96% SEQ ID No 428 1578. 3 Contig49 P 12817 13644 - 92% SEQ ID No. 429 1579. 4 Contig49 m 13726 14193 + 92% SEQ ID No. 2694 5044. 2 Contig49 m 14349 15251 - 98% SEQ ID No. 2695 5046. 2 Contig49 m 15500 15922 - 98% SEQ ID No. 2696 5047. 3 Contig49 m 16011 16757 98% SEQ ID No. 1156 2739. 3 Contig49 m 16733 17521 99% SEQ ID No. 1155 2738. 2 Contig49 m 17487 18263 99% + SEQ ID No. 1154 2737. 2 Contig49 m 18508 19089 93% SEQ ID No. 645 190.3 Contig49 p 19228 19989 93% + SE Q ID No. 651 191.1 Contig49 m 20119 20982 - 98% SEQ ID No. 662 193.3 Contig49 p 21045 22139 - 97% SEQ ID No. 675 195. 3 Contig49 P 22114 22965 98% SEQ ID No. 683 197. 3 Contig49 p 22941 24404 96% SEQ ID No. 691 199.1 Contig49 p 24389 25549 + 96% SEQ ID No. 700 201.2 Contig49 p 25543 26778 - 97% SEQ ID No. 712 2030.2 Contig49 m 26936 28129 + + SEQ ID No. 718 2041. 2 Contig49 p 28480 29592 - 94% SEQ ID No. 716 2039. 1 Contig49 p 29682 30515 + + SEQ ID No. 2629 494. 2 Contig49 m 30690 31535 + 95% SEQ ID No. 2642 496. 1 Contig49 p 31594 32652 85% + SEQ ID No. 2650 497. 1 Contig49 m 32699 33202 90% + SEQ ID No. 2655 498. 4 Contig49 P 33556 34560 92% SEQ ID No. 3042 5761. 1 Contig49 p 34545 35045 - + SEQ ID No. 715 2037 3 Contig49 p 35275 36714 + 96% SEQ ID No. 1153 2733. 1 Contig49 p 36823 37893 - - 89% SEQ ID No. 1152 2732. 1 Contig49 m 38090 38974 + 93% + SEQ ID No. 1151 2730. 1 Contig49 p 39326 40288 - - 97% + SEQ ID No. 182 1188. 2 Contig49 m 40523 42844 + 98% SEQ ID No. 663 1930. 3 Co ## STR1 ## ## STR5 ## ID No. 3405 932. 1 Contig49 p 53437 54480 98% SEQ ID No. 3406 935. 2 Contig49 m 54481 55269 - 99% SEQ ID No. 3407 936. 3 Contig49 m 55263 55808 97% + SEQ ID No. 1177 2769. 2 Contig49 m 55789 57639 - 96% SEQ ID No. 1179 2770. 1 Contig49 p 57644 58357 - 96% + SEQ ID No. 1180 2771. 2 Contig49 p 58350 59543 97% SEQ ID No. 3104 5926. 1 Contig49 p 59524 59913 + SEQ ID No. 1181 2772.1 Contig49 m 59918 60340 - 98% SEQ ID No. 3214 657.3 Contig49 p 60518 63580 - 96% SEQ ID No. 3213 656.3 Contig49 p 63581 65569 - 94% + SEQ ID No. 1655 350. 3 Contig49 p 65586 66236 - 98% + SEQ ID No. 1664 351. 1 Contig49 m 66378 66824 - 91% SEQ ID No. 1685 354. 1 Contig49 m 66885 68309 - 97% SEQ ID No. 1708 357. 2 Contig49 m 68395 69129 - 98% SEQ ID No. 1719 359. 2 Contig49 m 69080 69700 - 95% SEQ ID No. 1182 2774. 1 Contig49 p 69554 70459 - 97 % SEQ ID No. 1183 2775. 1 Contig49 p 70567 70794 - + SEQ ID No. 1184 2777. 1 Contig49 m 70880 71971 - 94% SEQ ID No. 1185 2778. 2 Contig49 m 71956 72480 - 97% SEQ ID No. 1187 2780. 2 Contig49 m 72516 73382 - 97% SEQ ID No. 1188 2781. 1 Contig49 m 73383 73757 - 99% SEQ ID No. 478 1649. 3 Contig49 m 73750 76110 - 94% SEQ ID No. 479 1650. 2 Contig49 m 76053 77585 96% SEQ ID No. 1063 2587. 2 Contig49 p 77654 78526 - 96% SEQ ID No. 669 1940. 2 Contig49 p 78565 80157 + - 98% SEQ ID No. 670 1943. 3 Contig49 p 80136 81140 + - 98 % + SEQ ID No. 2375 4561. 2 Contig49 p 81131 82534 - 98% SEQ ID No. 2374 4560. 2 Contig49 p 82681 83823 - - 92% + SEQ ID No. 2373 4559. 1 Contig49 m 83994 85562 + - 98% SEQ ID No. 2372 4558. 1 Contig49 m 85707 86597 - 97% + SEQ ID No. 3155 6072. 1 Contig49 p 86701 86892 + SEQ ID No. 3154 6071.1 Co ntig49 p 86822 87034 + SEQ ID No. 2371 4554.2 Contig49 m 87282 87542 + SEQ ID No. 2370 4553. 2 Contig49 p 87651 88352 + + SEQ ID No. 2752 5146. 2 Contig49 p 88433 89740 + + SEQ ID No. 1402 3116 2 Contig49 m 89715 90125 + SEQ ID No. 1401 3114.2 Contig49 p 90204 91163 + SEQ ID No. 1400 3113.1 Contig49 p 91157 93160 - + SEQ ID No. 1399 3110. 1 Contig49 p 93148 93756 - + SEQ ID No. 1398 3109 2 Contig49 p 93743 94096 + SEQ ID No. 1397 3107.2 Contig49 m 94191 94412 + + SEQ ID No. 1396 3106.2 Contig49 m 94616 96460 - 96% SEQ ID No. 1395 3105.2 Contig49 m 96450 96755 + SEQ ID No. 1394 3104. 2 Contig49 m 96892 99459 - 97% SEQ ID No. 1393 3102. 2 Contig49 p 99671 100228 - 98% SEQ ID No. 1392 3101. 1 Contig49 p 100453 102348 - + SEQ ID No. 2751 514. 5 Contig49 m 102459 107018 - 95% + SEQ ID No. 2235 436. 4 Contig49 p 104371 104940 - 96% + SEQ ID No. 783 2150. 1 Contig49 m 107367 107894 - 97% SEQ ID No. 201 1222. 5 Contig49 m 107944 109923 - 96% + SEQ ID No. 877 2315. 3 Contig49 p 110157 11099 9 - 93% SEQ ID No. 878 2317. 2 Contig49 p 111016 112482 - - 97% SEQ ID No. 1199 2804. 1 Contig49 p 112445 113809 - 98% SEQ ID No. 858 2279. 2 Contig49 p 113883 114656 + + SEQ ID No. 525 1722. 2 Contig49 p 114908 115852 - 97% SEQ ID No. 526 1723. 5 Contig49 p 115955 116539 - 98% SEQ ID No. 3153 6070. 1 Contig49 p 116472 116879 + SEQ ID No. 1200 2806. 1 Contig49 m 117016 117618 - 99% SEQ ID No. 3223 670. 1 Contig49 m 117945 119357 - 97% SEQ ID No. 1385 309. 2 Contig49 m 119391 122780 - 98% SEQ ID No. 1391 310. 1 Contig49 p 122902 123675 - 96% SEQ ID No. 1406 312. 3 Contig49 p 123904 124869 - - 98% + SEQ ID No. 1201 2807. 1 Contig49 p 124936 125370 - - 95% SEQ ID No. 962 2434. 2 Contig49 m 125457 126668 97% SEQ ID No. 961 2432. 2 Contig49 m 126730 127992 - 97% SEQ ID No. 1202 2808. 1 Contig49 p 128188 128580 98% SEQ ID No. 953 2424. 3 Contig49 p 128735 129358 - 97% SEQ ID No. 954 2425. 2 Contig49 p 129470 130117 - 97% SEQ ID No. 955 2426. 2 Contig49 p 130209 130778 - 94% + SEQ ID No. 12 03 2810. 1 Contig49 p 130891 132279 + _ 98% SEQ ID No. 1204 2811. 2 Contig49 p 132257 133306 98% + SEQ ID No. 1764 365. 4 Contig49 p 133354 134355 - 98% SEQ ID No. 1758 364. 2 Contig49 p 134520 136475 - 98% SEQ ID No. 1730 360. 3 Contig49 p 136479 138278 - 97% SEQ ID No. 713 2031. 2 Contig49 p 138614 138955 + SEQ ID No. 1436 3163. 1 Contig49 p 138969 139274 - + SEQ ID No. 1437 3165. 1 Contig49 p 139471 139872 - 98% + SEQ ID No. 1438 3166. 1 Contig49 m 139958 140611 96% SEQ ID No. 1439 3167. 1 Contig49 p 140837 142129 - 100% SEQ ID No. 1440 3169 1 Contig49 p 142184 142906 98% SEQ ID No. 1000 2488. 2 Contig49 m 143043 144032 + + SEQ ID No. 1001 2489. 2 Contig49 m 144070 144399 + + SEQ ID No. 1003 2490. 2 Contig49 p 144461 144931 + + SEQ ID No. 2483 4719. 2 Contig49 m 145036 146628 + 95% SEQ ID No. 2482 4718. 1 Contig49 p 146787 147245 - 96% + SEQ ID No. 2481 4716. 2 Contig49 m 147260 148393 - 96% SEQ ID No. 1128 2695. 2 Contig49 p 148478 149104 - 93% SEQ ID No. 1129 2696. 2 Contig49 p 1 49173 150738 95% SEQ ID No. 420 1564. 3 Contig49 p 150804 152222 99% SEQ ID No. 419 1563. 3 Contig49 p 152206 152847 - - 95% SEQ ID No. 1130 2698. 1 Contig49 m 152930 153349 - 98% SEQ ID No. ID No. 1133 2700. Contig49 m 153313 154554 97% SEQ ID No. 1134 2702. 2 Contig49 p 154618 155514 97% SEQ ID No. 1496 326. 2 Contig49 p 155911 159276 - 96% + SEQ ID No. 1490,325. 1 Contig49 p 159347 160909 94% + SEQ ID No. 1482 324. 3 Contig49 m 160975 161676 - + SEQ ID No. 999 2486. 3 Contig49 m 161677 163272 - 97% SEQ ID No. 1135 2704. 4 Contig49 m 163203 164651 97 % SEQ ID No. 1136 2705. 3 Contig49 m 164641 165852 - 98% SEQ ID No. 1137 2706. 2 Contig49 m 165977 166876 - - 94% SEQ ID No. 179 1183. 4 Contig49 p 166928 168976 - + + SEQ ID No 180 1184. 2 Contig49 m 168987 170183 + 95% SEQ ID No. 181 1186. 2 Contig49 m 170239 171039 - - 88% SEQ ID No. 638 189. 3 Contig49 p 171178 172434 - 97% SEQ ID No. 630 188. 1 Contig49 m 172539 173675 - 96% + SEQ ID No. 624 187. 1 Contig49 p 173879 174583 - 94% + SEQ ID No. 612,185. 1 Contig49 p 174610 175461 + 98% SEQ ID No. 603 184. 2 Contig49 p 175678 175977 + + SEQ ID No. 682 1968. 1 Contig49 p 176650 176925 + 97% SEQ ID No. 681 1966.

  2 Contig49 m 176980 177600 - 98% SEQ ID No. 1138 2709. 1 Contig49 P 177567 178601 - 98% SEQ ID No. 2166 4267. 5 Contig49 m 178670 180760 99% SEQ ID No. 359 1474. 4 Contig49 m 180783 181997 - 99% SEQ ID No. 358 1473. 4 Contig49 m 182064 182630 - 98% SEQ ID No. 2167 4269. 3 Contig49 m 182594 183289 95% + SEQ ID No. 650 1908. 4 Contig49 p 183369 185828 - 99% SEQ ID No. 2169 4272. 3 Contig49 P 185939 186634 - 98% + SEQ ID No. 2204 4323. 1 Contig49 m 186671 187360 - - 98% SEQ ID No. 2203 4322. Contig49 m 187330 188436 - - 96% SEQ ID No 2202 4321. 2 Contig49 P 188394 191069 99% SEQ ID No. 2201 4320. 1 Contig49 P 191146 192534 + 99% SEQ ID No. 224 1251. 2 Contig49 p 192522 193505 - - 97% SEQ ID No. 223 1250. 1 Contig49 P 193501 193998 93% SEQ ID No. 221 1249. 2 Contig49 m 194005 194559 + SEQ ID No. 3184 6134.1 Contig5 m 112 720 + SEQ ID No. 3183 6133.1 Contig5 m 943 1218 - + SEQ ID No. 3182 6132. 1 Contig 5 m 1232 1546 + SEQ ID No. 3152 6066.1 Contig 50 p 3 491 + SEQ ID No. 2960 5576.3 C ontig5O P 879 1850 + SEQ ID No. 2147 4239. 4 Contig50 p 1918 2205 + + SEQ ID No. 2146 4238.1 Contig50 m 2294 2842 + + SEQ ID No. 2145 4236.3 Contig50 m 2778 4787 + SEQ ID No. 2144 4234. 3 Contig5O m 4788 5267 + SEQ ID No. 2143 4233.3 Contig50 p 5113 5352 + + SEQ ID No. 459 1624.4 Contig50 m 5355 7022 + + SEQ ID No. 458 1623.4 Contig50M 6937 8328 - + SEQ ID No. 2561 4822.3 Contig50 m Embedded image Contig50 m 13740 14561 + + - SEQ ID No. 2052 4106.1 Contig50 m 14509 15180 + + + SEQ ID No. 2053 4107. 1 Contig50 m 15176 15646 - + + SEQ ID No. 914 2367. 2 Contig50 m 15535 15933 + + + SEQ ID No. 297 1372. 2 Contig 50 m 15924 16229 - + + SEQ ID No. 298 1373. 1 Contig 50 m 16190 16525 + SEQ ID No. 299 1375. 2 Contig 50 m 16526 17281 + SEQ ID No.300 1376. 2 Contig 50 m 17215 17766 - + SEQ ID No. 2054 4108. 1 Contig50 m 17 675 18538 + + SEQ ID No. 2055 4109. 2 Contig50 m 18522 19115 + + + SEQ ID No. 3060 5814. 1 Contig50 m 19109 19555 + + SEQ ID No. 3059 5813.1 Contig 50 m 19540 19761 - + - SEQ ID No. 3058 5812.1 Contig50 m 19757 20260 + + SEQ ID No. 1086 2625. 2 Contig50 m 20085 21020 + + SEQ ID No. 1087 2626.1 Contig5O p 21133 21804 - + - SEQ ID No. 583 1803.2 Contig50 p 21826 22089 + - SEQ ID No 584 1804.2 Contig50 p 22255 23502 + - 97% SEQ ID No. 1088 2627.1 Contig5O p 23499 24755 + 98% - SEQ ID No. 1090 2631.4 Contig50 p 24756 27710 - 99% - SEQ ID No. 3112 5953.1 Contig50 p 27632 27916 + SEQ ID No. 3273 747.3 Contig50 p 27917 30127 - 99% SEQ ID No. 2761 5164. 1 Contig50 p 30361 30561 + + + SEQ ID No. 3272 744.3 Contig50 p 30803 31477 - + - SEQ ID No. 3271 743.3 Contig50 m 31500 31961 - 94% - SEQ ID No. 3111 5952.1 Contig 50 32298 32483 + SEQ ID No. 3425 96.6 Contig 50 m 32725 33612 - 99% - SEQ ID No. 3432 97.2 Contig 50 m 33710 33985 97% SEQ ID No. 3446 99. 1 Contig50 m 34081 34362 94% + SEQ ID No. 2 760 5162. 1 Contig 50 p 34102 34254 - 100% + SEQ ID No. 69 102. 1 Contig 50 34385 37093 - 96% SEQ ID No. 75 103. 1 Contig 50 p 37068 38339 + 98% SEQ ID No. 83 104. 1 Contig50 p 38294 39469 + 98% SEQ ID No. 103 107. 1 Contig 50 p 39535 42687 98% SEQ ID No. 117 109.1 Contig 50 p 42543 44045 - 94% SEQ ID No. 133 111.2 Contig 50 p 43985 45556 - 96% SEQ ID No 851 227. 2 Contig 50 p 45523 46464 - 93% SEQ ID No. 859 228. 1 Contig 50 p 46477 46656 97% + SEQ ID No. 892 234. 2 Contig 50 p 46705 48930 - 99% SEQ ID No. 680 1961. 3 Contig50 p 49060 49950 - 96% + SEQ ID No. 390 152. 3 Contig 50 p 50084 50461 + - 98% SEQ ID No. 398 153. 2 Contig 50 p 50462 51799 + - 99% SEQ ID No. 405 154. 1 Contig50 p 51796 52764 + 96% SEQ ID No. 424 157. 2 Contig 50 p 52765 55980 + 98% SEQ ID No. 3107 594. 1 Contig 50 p 55956 56429 + 96% + SEQ ID No. 3105 593. 2 Contig 50 m 56568 56918 - 96 % + SEQ ID No. 3102 592. 3 Contig5O p 57113 58795 - 94% SEQ ID No. 504 169. 1 Contig50 m 58808 59020 + + SEQ ID No. 497 168.1 Contig50 p 5 9115 59687 97% SEQ ID No. 486 166.2 Contig50 p 59537 62800 95% SEQ ID No. 464 163. 1 Contig50 p 62978 64276 - + SEQ ID No. 447 160.1 Contig50 m 64504 64863 + SEQ ID No. 438 159.1 Contig50 p 65005 65316 89% SEQ ID No. 430 158. 2 Contig 50 p 65304 65987 - 98% SEQ ID No. 679 1960. 2 Contig 50 p 65972 66484 + - 92% + SEQ ID No. 462 1628. 3 Contig50 m 66550 67515 + - 92 % SEQ ID No. 463 1629. 1 Contig 50 m 67365 68138 + 95% SEQ ID No. 465 1631. 3 Contig 50 m 68126 70117 - 97% SEQ ID No. 1091 2637. 1 Contig 50 p 70315 70731 - 100% + SEQ ID No 3325 818. 2 Contig 50 m 70763 71647 - 94% + SEQ ID No. 3326 819. 2 Contig 50 m 71690 73171 - 100% SEQ ID No. 411 1550. 2 Contig 50 m 73149 73937 - 97% + SEQ ID No. 410 1549 1 Contig 50 73898 74191 + 100% SEQ ID No. 409 1548. 2 Contig 50 74170 74871 99% SEQ ID No. 336 1425.2 Contig 50 74865 75158 97% SEQ ID No. 335 1424.2 Contig 50 75133 75561 96% SEQ ID No. 334 1423. 2 Contig50 75552 76979 97% SEQ ID No. 1092 2639.1 Contig50 77314 77775 + 95% SEQ ID No. 1470 3226. 2 Contig5O 78822 79085 97% SEQ ID No. 708 2024. 2 Contig50 '79435 79977 98% SEQ ID No. 363 148.2 Contig5O 79937 81463 96% SEQ ID No. 376 150.2 Contig50 81725 82705 + SEQ ID No. 2902 5473. 1 Contig50 82659 83573 + SEQ ID No. 382 151.2 Contig50 83861 84685 97% SEQ ID No. 1471 3228.1 Contig50 84690 84905 + SEQ ID No. 1473 3230. 1 Contig50 84994 85458 90% + SEQ ID No. 1474 3231.1 Contig50 85582 85800 + SEQ ID No. Contig 50 85971 86342 + + SEQ ID No. 1476 3233. Contig50 86294 87133 + SEQ ID No. 1477 3234.3 Contig50 87124 87846 + SEQ ID No. 2903 5474.2 Contig50 87816 88361 + SEQ ID No. 3363 875. 5 Contig50 88330 89613 + + SEQ ID No. 3364 876.1 Contig50 89606 90100 + SEQ ID No. 3365 879.2 Contig50 90587 91051 + SEQ ID No. 2982 5615. Contig50 91012 91698 + SEQ ID No. 3103 5920.2 Contig50 91731 92939 97% + SEQ ID No. 3245 704.4 Contig50 93538 94440 98% + SEQ ID No. 3246 705. 1 Contig50 94413 95726 99% SEQ ID No. 3247 706.2 Contig50 95685 96212 97% SEQ ID No. 3248 707.2 Contig5O 9 5702 96757 97% SEQ ID No. 693 1992. 2 Contig 50 96880 97956 96% + SEQ ID No. 1637 3472. 1 Contig 50 98100 98402 97% SEQ ID No. 1638 3473. 1 Contig 50 98526 99380 92% + SEQ ID No. 1639 3476. 1 Contig 50 99459 100595 98% SEQ ID No. 1640 3477. 2 Contig50 100596 101333 99% SEQ ID No. 1753 3633. 3 Contig50 101324 102286 + 98% SEQ ID No. 1754 3634. 1 Contig50 102287 102892 100% SEQ ID No. 1755 3636. 1 Contig 50 p 102978 103520 + - 100% SEQ ID No. 1756 3637. 1 Contig 50 p 103508 104485 + - 98% SEQ ID No. 1757 3638. 2 Contig 50 p 104476 105135 - 97% SEQ ID No. 1759 3640. 2 Contig 50 p 105120 106100 99% SEQ ID No. 673 1947. 3 Contig 50 p 106081 106968 - 98% SEQ ID No. 674 1949. 4 Contig50 m 106981 107274 - 100% SEQ ID No. 828 2231. 3 Contig50 m 107472 108779 - 99% + SEQ ID No. 827 2230. 2 Contig50 m 108772 109404 99% SEQ ID No. 1760 3641. 1 Contig50 m 109367 110134 - 99% SEQ ID No. 1761 3642. 2 Contig50 m 110241 111392 - 99% SEQ ID No. 2724 5087. 2 Contig50 p 111723 112805 - + SEQ ID No. 270 1330. 5 Con ## EQU2 ## 99% SEQ ID No. 166 1162. 1 Contig50 m 119212 119568 - 98% SEQ ID No. 165 1161. 2 Contig50 p 119787 120848 - 98% + SEQ ID No. 1897 3867. 2 Contig50 m 121146 122486 - 99% SEQ ID No. 3,166,363. 2 Contig 50 p 122748 123362 - - 98% SEQ ID No. 1976 3999. 3 Contig 50 p 123480 125441 - 99% SEQ ID No. 1975 3998. 3 Contig50 m 125025 125495 96% SEQ ID No. 3357 866. 2 Contig50 p 125624 126769 - - 100% SEQ ID No. 3356 865. 2 Contig50 p 126853 127977 - 98% SEQ ID No. 460 1625. 3 Contig50 p 128135 129334 - 99% SEQ ID No. 461 1626. 3 Contig50 p 129335 130678 - 99% SEQ ID No. 2299 4457. 2 Contig 50 p 130769 131809 - 97% SEQ ID No. 3030 572. 2 Contig 50 p 131938 133629 + - 98% SEQ ID No. 3034 573. 1 Contig 50 m 133783 134067 - 100% SEQ ID No. 3038 574. 2 Contig 50 m 134078 134701 - 99% + SEQ ID No. 2806 5268. 2 Contig50 m 134 740 135327 98% SEQ ID No. 1405 3119.

  1 Contig50 m 135659 136453 - 94% SEQ ID No. 1404 3118. 1 Contig50 p 135939 136310 96% + SEQ ID No. 1407 3121. 2 Contig50 m 136447 137154 95% SEQ ID No. 1408 3124. 2 Contig50 p 137300 138337 - - 99% + SEQ ID No. 1409 3127. 1 Contig 50 m 138666 139430 - - 100% + SEQ ID No. 2491 473. 2 Contig50 p 139666 140541 - - 97% SEQ ID No. 2484 472. 1 Contig50 p 140538 141176 - 98% SEQ ID No. 2467 470. 3 Contig 50 p 141191 141430 + SEQ ID No. 2458 469. 3 Contig 50 p 141568 143721 - 99% SEQ ID No. 2454 468. 3 Contig 50 p 143679 144107 98% SEQ ID No. 1410 3128 1 Contig50 p 144071 144601 - - 99% SEQ ID No. 1015 2510. 2 Contig50 p 144653 146515 97% SEQ ID No. 1013 2509. 3 Contig50 p 146573 147010 98% + SEQ ID No. 1411 3129. 2 Contig5O p 147083 148138 - - 99% SEQ ID No. 1412 3130. 1 Contig 50 p 148182 149018 - - 97% SEQ ID No. 1413 3131. 1 Contig50 p 149155 149499 + 100% SEQ ID No. 3418 949. 3 Contig5O p 149500 151377 + 99 % + SEQ ID No. 780 2148. 1 Contig50 p 151378 152307 - 100% + SEQ ID No. 779 2147. 1 Con tig50 m 152485 152835 100% SEQ ID No. 778 2146. 2 Contig 50 m 152863 154005 - - 98% SEQ ID No. 1414 3132. 1 Contig50 p 154060 154446 - 95% + SEQ ID No. 1415 3133. 2 Contig50 p 154385 155191 - 97% + SEQ ID No. 2807 5269. 1 Contig 50 p 155067 155423 94% + SEQ ID No. 2808 5270. 2 Contig50 p 155164 155745 - 95% + SEQ ID No. 2244 4372. 3 Contig5O p 155848 157050 + 98% SEQ ID No. 2243 4371. 1 Contig 50 m 157168 158067 - 99% SEQ ID No. 2242 4370. 1 Contig 50 p 158463 159020 - 98% + SEQ ID No. 2241 4369. 1 Contig50 p 159079 159750 - 88% SEQ ID No. 2240 4367. 1 Contig 50 p 159936 160592 - 82% + SEQ ID No. 2239 4366. 1 Contig 50 m 160879 161298 - - 91% SEQ ID No. 2238 4365. 4 Contig 50 m 161394 161951 86% SEQ ID No. 2974 5602. 3 Contig5O p 162005 162481 - 97% SEQ ID No. 3320 808. 4 Contig 50 p 162640 165525 - 78% + SEQ ID No. 3319 807. 2 Contig 50 p 165692 167020 93% SEQ ID No. 3318 806. 2 Contig50 m 167060 167803 - 97% SEQ ID No. 2037 4082. 2 Contig 50 m 167817 169130 - - 92% SEQ ID No. 529 1726. 4 C ontig50 m 169200 170873 93% SEQ ID No. 2911 5484. 4 Contig50 m 170954 172321 94% + SEQ ID No. 2378 4567. 2 Contig50 p 172530 174488 - 91% SEQ ID No. 2377 4566. 1 Contig50 m 174558 175169 - 96 % SEQ ID No. 3094 5901. 3 Contig 50 m 175331 176827 - 82% SEQ ID No. 3093 5900. 3 Contig 50 p 176579 176953 84% + SEQ ID No. 2444 4663. 3 Contig 50 m 177123 178034 + 97% SEQ ID No. 2443 4662. 1 Contig 50 m 178485 178745 + SEQ ID No. 2442 4660. 2 Contig 50 m 179180 179395 + SEQ ID No. 2441 4659. 2 Contig 50 p 179570 179950 93% + SEQ ID No. 2440 4658. 2 Contig5O p 180138 180596 96% SEQ ID No. 2439 4657. 1 Contig 50 p 180604 181254 91% SEQ ID No. 2438 4656. 2 Contig 50 p 181581 183482 89% + SEQ ID No. 3151 6064. 1 Contig 50 p 183848 184141 92% + SEQ ID No 2842 5344. 2 Contig 50 m 184198 184968 90% SEQ ID No. 2841 5342. 2 Contig 50 m 185006 185581 94% SEQ ID No. 2840 5341. 1 Contig5O p 185774 186055 96% + SEQ ID No. 2839 5340. 1 Contig5O p 186391 187947 81% SEQ ID No. 2657 4984. 2 Contig50M 188128 188745 97 % SEQ ID No. 3150 6062. 1 Contig50 p 188912 189430 + SEQ ID No. 1533 3314.2 Contig5l p 46 753 + + SEQ ID No. 1534 3316.1 Contig5l m 1154 2896 96% + SEQ ID No. 726 2057. 3 Contig5l p 3624 4694 99% SEQ ID No. 3437 977. 3 Contig 5l p 4604 5275 94% + SEQ ID No. 3436 976. 3 Contig5l p 5276 5569 94% SEQ ID No. 3435 974.2 Contig5l p 5479 6735 98% SEQ ID No. 725 2056.1 Contig5l p 6907 7809 96% SEQ ID No. 234 1270. 2 Contig5l m 7842 8312 99% SEQ ID No. 235 1271. 3 Contig5l p 8263 8610 100% SEQ ID No. 3119 5983.1 Contig5l p 8510 8743 + + SEQ ID No. 236 1272.4 Contig5l p 8710 9696 97% SEQ ID No. 724 2054. 2 Contig5l p 9882 10940 97% SEQ ID No. 2898 5467. 1 Contig5l p 11030 11305 95% + SEQ ID No. 1535 3319. 1 Contig5l m 11064 12434 96 % SEQ ID No. 2645 4962. 2 Contig 50 m 13063 13476 96% + SEQ ID No. 2644 4961. 1 Contig5l m 13669 14061 96% SEQ ID No. 2643 4960. 2 Contig5l m 14167 15003 96% + SEQ ID No. 2632 4943. 2 Contig 5 m 15275 15778 92% + SEQ ID No. 2631 4942. 1 Contig5l m 15834 16097 + SEQ ID N 2630 4941.2 Contig5l 16060 16500 - 97% + SEQ ID No. 775 2141.2 Contig5l 16809 16967 + + SEQ ID No. 3274 748. 3 Contig5l 17140 18522 98% SEQ ID No. 3275 749. 1 Contig5l 18871 19188 94% + SEQ ID No. 3276 750.2 Contig5l 19419 19598 + SEQ ID No. 3277 751.2 Contig5l 19507 19821 93% + SEQ ID No. 3278 752. 2 Contig5l 19664 19837 92% + SEQ ID No. 3149 6061. 1 Contig5l 19993 20172 94% + SEQ ID No. 776 2143. 5 Contig5l 20064 21584 96% SEQ ID No. 871 2302.2 Contig5l 21648 21992 98% SEQ ID No. 178 1182.3 Contig5l 21993 22934 99% SEQ ID No. 177 1180. 2 Contig5l 22973 23767 98% SEQ ID No 175 1179.1 Contig5l 23986 24621 + 83% + SEQ ID No. 1140 2712.1 Contig5l 25013 25828 + SEQ ID No. 1141 2713. 2 Contig5l 25993 27000 + SEQ ID No. 1142 2717.1 Contig5l 27435 29141 - 97% + SEQ D No. 1143 2718.1 Contig5l 29268 30647 98% + SEQ ID No. 992 2477.1 Contig51 30907 31392 - 98% SEQ ID No. 993 2479. 2 Contig51 31862 32737 - 95% + SEQ ID No. 267 1324. 4 Contig51 33284 34675 - 91% SEQ ID No. 737 2073. 4 Contig5l 34700 35431 98% SEQ ID No. 305 1386.3 Contig5l 35892 36275 - 95% SEQ ID No. 304 1385.2 Contig5l 36572 37336 - 90% + SEQ ID No. 738 2075.1 Contig5l 37420 37815 - 100% + SEQ ID No. 185 1193. 2 Contig5l 37917 38414 98% + SEQ ID No. 186 1194. 3 Contig5l 38526 39716 100% + SEQ ID No. 1144 2721. 3 Contig5l 39661 41946 - 98% + SEQ ID No. 1145 2724. 3 Contig5l 42127 43302 - 97% + SEQ ID No. 1146 2725. 1 Contig5l 43206 43565 100% SEQ ID No. 1147 2726.1 Contig5l 43667 43867 + + SEQ ID No. 323 141.4 Contig5l 44028 46769 96% + SEQ ID No. 331 142. 2 Contig51 46762 47526 - 97% SEQ ID No. 341 144.3 Contig5l 47728 48822 + 98% SEQ ID No. 303 1380.3 Contig5l 49013 50593 - 97% SEQ ID No. 1615 3437.1 Contig5l 50610 51767 96% + SEQ ID No. 1617 3442. 3 Contig5l m 52578 54371 - 99 % SEQ ID No. 1618 3443. 1 Contig5l m 54463 55263 - 98% SEQ ID No. 1619 3444. 1 Contig5l m 55371 55877 - 98% + SEQ ID No. 804 2188. 2 Contig5l m 56047 56799 - - 100% SEQ ID No. ID No. 3290 767. 3 Contig5l m 56793 58106 97% SEQ ID No. 329 1 769. 2 Contig5l m 58073 59020 98% SEQ ID No. 805 2191. 4 Contig5l m 59014 59529 - 100% SEQ ID No. 1620 3445. 3 Contig5l p 59617 60657 + - 99% SEQ ID No. 1621 3446. 1 Contig5l p 60510 61739 - 98% SEQ ID No. 1622 3447. 1 Contig5l p 61720 62166 - - 97% + SEQ ID No. 2777 5200. 2 Contig5l p 62234 64525 - 99% SEQ ID No. 1503 3271. 3 Contig5l m 64736 66802 - 99% SEQ ID No. 1504 3272. 1 Contig5l m 66845 67288 - 100% SEQ ID No. 1505 3273. 1 Contig5l p 67395 67838 - 100% SEQ ID No. 1506 3275. 1 Contig5l p 67835 69160 - 97% + SEQ ID No. 1507 3276. 2 Contig 5l m 69289 69438 - 93% + SEQ ID No. 1508 3277. 2 Contig 5l p 69443 70258 - 98% SEQ ID No. 1509 3278. 1 Contig51 m 70313 70750 - 98% SEQ ID No. 1511 3280. 1 Contig5l m 70844 71740 99% SEQ ID No. 1512 3281. 1 Contig5l p 71741 72040 97% + SEQ ID No. 3201 637. 3 Contig5l m 71849 73939 - - 99% SEQ ID No. 3200 636. 2 Contig5l m 74029 74943 - 100% SEQ ID No. 3199 635. 5 Contig5l m 75191 76447 - 100% SEQ ID No. 3198 634. 4 Contig5l p 75669 76205 99% SEQ ID No. 1513 3282. 3 Contig 50 m 76582 77901 100% + SEQ ID No. 1514 3283. 1 Contig5l m 77820 78542 - 100% SEQ ID No. 354 1463. 2 Contig5l m 78555 79679 - - 99% + SEQ ID No 353 1461. 3 Contig5l m 79633 80634 - 99% SEQ ID No. 907 2358. 3 Contig5l m 80568 81986 - - 99% SEQ ID No. 512 1701. 5 Contig5l m 81987 83204 + - 99% SEQ ID No. 2931 5527 2 Contig5l m 83168 83683 + SEQ ID No. 511 1699.4 Contig5l m 83619 84545 - 97% SEQ ID No. 1798 3694.2 Contig5l m 84535 85659 - 99% SEQ ID No. 3231 683.2 Contig5l m 85735 87123 + - 99% SEQ ID No 3232 684. 5 Contig 5l m 87313 88107 - 99% SEQ ID No. 1799 3697. 4 Contig 5l m 88097 91603 - 98% SEQ ID No. 1428 3150. 1 Contig5l P 91763 92446 99% SEQ ID No. 1426 3149. 1 Contig5l m 92548 93645 99% + SEQ ID No. 1425 3148. 1 Contig5l P 93871 94731 + 98% SEQ ID No. 1424 3147. 1 Contig5l m 94805 95329 100% SEQ ID No. 3259 727. 3 Contig5l m 95296 98532 + 99% SEQ ID No. 750 2098. 2 Contig5l m 98628 98909 95% + SEQ ID No. 749 2095. 2 Contig5l p 99001 100194 95% SE Q ID No. 1423 3146. 2 Contig 50m 100234 101040 98% SEQ ID No. 1422 3145. 1 Contig 5l p 100490 100798 98% + SEQ ID No. 3366 880. 3 Contig 50 m 100986 102164 99% SEQ ID No. 3367 881. 2 Contig5l m 102053 103141 + 98% SEQ ID No. 3368 882. 3 Contig5l P 103303 104787 98% SEQ ID No. 824 2221. 3 Contig5l P 104753 105202 97% SEQ ID No. 2245 4373. 3 Contig5l m 105349 105768 97% SEQ ID No. 1033 2542. 2 Contig 5l m 105689 107065 98% SEQ ID No. 2246 4374. 4 Contig5l m 107058 108635 99% SEQ ID No. 3054 5806. 2 Contig5l P 108987 109253 100% SEQ ID No. 2557 4818. 3 Contig5l m 109314 110570 98% + SEQ ID No. 2556 4817. 4 Contig5l m 110877 112283 98% + SEQ ID No. 2100 4167. 4 Contig5l m 112666 116331 + 98% SEQ ID No. 2099 4165. 1 Contig5l m 116295 116864 + 97% SEQ ID No. 2098 4164. 1 Contig III m 116858 117592 + 99% SEQ ID No. 2097 4162. 2 Contig5l p 117747 120260 97% SEQ ID No. 3193 628. 3 Contig5l P 120526 121188 98% + SEQ ID No. 3192 627. 1 Contig5l p 121353 122504 93% SEQ ID No. 820 2217. 3 Contig5l m 122 ## EQU2 ## 1579 3385. 1 Contig5l m 127494 128615 99% SEQ ID No. 1580 3386. 1 Contig5l m 128733 129023 100% SEQ ID No. 641 1894. 2 Contig5l m 129024 129398 100% SEQ ID No. 640 1893. 2 Contig5l P 129560 130237 100% SEQ ID No. 842,2253. Contig 5l p 130333 130923 98% SEQ ID No. 841 2252. 1 Contig5l p 130939 132033 - 99% SEQ ID No. 1581 3388. 1 Contig5l p 132395 133510 98% SEQ ID No. 1582 3389. 1 Contig5l p 133644 134612 99% SEQ ID No. 1584 3390. 1 Contig5l m 134639 134893 100% SEQ ID No. 1585 3391. 2 Contig5l m 134835 137117 99% SEQ ID No. 2768 5180. 1 Contig5l m 137087 137341 + SEQ ID No. 1690 3544. Contig5l m 137403 138500 98% SEQ ID No. 1689 3543. Contig5l m 138482 139159 96% SEQ ID No. 1688 3542 1 Contig1 p 139288 140169 99% SEQ ID No. 1687 3541 1 Contig5l p 140157 140939 98% SEQ ID No. 1370 307. 2 Contig5l p 140927 141469 97% SEQ ID No. 1362 306. 1 Contig5l m 141483 142922 99% SEQ ID No. 1355 305. 2 Contig5l m 142891 143622 99% SEQ ID No. 527 1724. 3 Contig5l p 143835 144755 98% SEQ ID No. 528 1725. 3 Contig5l m 144891 145793 100% SEQ ID No. 2183 4294. 3 Contig5l m 146041 147027 99% SEQ ID No. 890 2337. 3 Contig5l m 146964 147656 99% SEQ ID No. 891 2339. 4 Contig5l m 147601 148743 98% SEQ ID No. 2184 4295. 3 Contig5l p 148722 150056 99% SEQ ID No. 2185 4296. 1 Contig5l p 150005 151357 98% SEQ ID No. 2186 4297. 2 Contig5l p 151324 151899 97% SEQ ID No. 2767 5178 1 Contig5l p 151974 152465 + 99% SEQ ID No. 911 2362. 3 Contig5l p 152437 153357 + 99% SEQ ID No. 912 2364. 1 Contig5l p 153306 154490 99% + SEQ ID No. 913 2365. 2 Contig5l p 154521 156299 + 95% SEQ ID No. 524 1720. 3 Contig5l m 156341 157147 99% SEQ ID No. 1684 3538. 1 Contig5l m 157168 158121 98% SEQ ID No. 239 1277. 2 Contig5l p 158205 159371 99% SEQ ID No. 238 1275. 2 Contig5l p 159645 160532 97% SEQ ID No. 237 1273. 4 Contig5l ## EQU1 ## 559 1770. 2 Contig 5l m 165180 168293 + 85% + SEQ ID No. 560 1772. 1 Contig5l m 168284 168760 89% SEQ ID No. 561 1773. 1 Contig5l 168849 169307 - 99% SEQ ID No. 562 1774. 2 Contig5l 169304 170725 + 87% SEQ ID No. 1713 3578. 2 Contig5l 170732 172456 88% + SEQ ID No. 1887 3846. 2 Contig5l 172718 175288 95% SEQ ID No. 1150 273. 1 Contig5l 175515 176069 98% + SEQ ID No. 1139 271. 1 Contig5l 176141 177055 98% SEQ ID No. 1132 270. 1 Contig5l 177065 177934 99% SEQ ID No. 1126 269. 1 Contig5l 178010 179101 98% SEQ ID No. 1120 268. 1 Contig5l 179040 179276 + SEQ ID No. 1115 267.3 Contig5l 179257 180225 + 98% SEQ ID No. 2793 5232.1 Contig5l 180191 181312 93% SEQ ID No. 1403 3117.2 Contig5l 181258 181983 + SEQ ID No. 208 123. 2 Contig5l 181917 183347 + 99% SEQ ID No. 216 124 1 Contig5l 183344 183853 100% SEQ ID No. 222 125. 2 Contig 5l 183952 185502 98% SEQ ID No. 707 2022. 1 Contig5l 185514 185687 98% + SEQ ID No. 706 2021. 1 Contig5l 185561 185980 99% SEQ ID No. 705 2020. 1 Contig5l 185959 186597 99% SEQ ID No. 703 2019. 2 Contig 5l 186827 187576 + 99% SEQ ID No. 3240 698. 2 Contig5l 187570 188787 99% SEQ ID No. 3239 697. 1 Contig5l 188795 189424 98% SEQ ID No. 3238 696. 2 Contig5l 189586 190029 100% SEQ ID No. 2791 5229. 1 Contig5l 190023 190493 99% SEQ ID No. 2578 4856. 2 Contig5l 190797 191123 96% SEQ ID No. 2577 4855. 2 Contig5l 191116 191436 100% SEQ ID No. 940 2407 3 Contig5l 191412 193793 98% SEQ ID No. 2336 4503. 1 Contig5l 194051 195133 99% + SEQ ID No. 2337 4505. 3 Contig5l 195204 195566 100% + SEQ ID No. 2790 5227. 2 Contig5l 195579 195845 + SEQ ID No. 2789 5226. 2 Contig5l 195800 196339 99% SEQ ID No. 2622 4923. 2 Contig5l 196361 198343 99% SEQ ID No. 1669 3516. 2 Contig5l 198784 199077 100% SEQ ID No. 1668 3515. 2 Contig5l 199397 199897 98% SEQ ID No. ID No. 1667 3514. 1 Contig 5l 19 9903 200154 + + SEQ ID No. 1666 3512. 1 Contig5l 200543 202108 97% SEQ ID No. 1665 3511. 2 Contig5l 202374 203537 98% SEQ ID No. 1663 3509. 2 Contig5l 203513 204547 98% SEQ ID No. 1064 2590. 3 Contig5l 204548 205471 99% SEQ ID No. 1065 2591. 3 Contig5l 205599 206756 98% SEQ ID No. 1662 3508. 2 Contig5l 206726 207028 97% SEQ ID No. 1661 3507. 1 Contig5l 207278 207652 98% + SEQ ID No. 1660 3506. 1 Contig5l 207724 208368 100% + SEQ ID No. 1659 3504. 1 Contig5l 208578 209129 99% + SEQ ID No. 1658 3503. 2 Contig5l 209099 210298 99% + SEQ ID No. 1657 3502. 3 Contig5l 210312 210839 + 97% SEQ ID No. 3053 5804. 1 Contig5l 210800 211321 + 100% SEQ ID No. 388 1517. 3 Contig5l 211384 212667 98% SEQ ID No. 389 1519. 2 Contig5l 212748 213812 100% SEQ ID No. 391 1521. 2 Contig5l 213997 214617 97% SEQ ID No. 2276 4415. 3 Contig5l 214705 215997 100% SEQ ID No. 2205 4325. 3 Contig5l 216364 217314 97% + SEQ ID No. 2206 4326. 1 Contig5l 217278 218063 96% SEQ ID No. 2207 4327. 1 Contig5l 218064 219191 97% SEQ ID No. 2208 4328. 1 Contig 5 219146 220381 + 98% SEQ ID No. 2499 4740. 2 Contig 21 220517 221473 99% + SEQ ID No. 2497 4739. Contig 5 1 221437 222102 99% SEQ ID No. 2496 4737. Contig51 222089 222667 100% SEQ ID No. 2495 4736. 2 Contig5l 222642 223916 98% SEQ ID No. 2494 4734. 2 Contig5l 223928 224914 97% SEQ ID No. 2887 5440. 1 Contig5l 224949 226127 97% + SEQ ID No. 3202 64 3 Contig 5 226279 228249 97% + SEQ ID No. 3209 65. 1 Contig 228321 228539 + SEQ ID No. 2951 5556.1 Contig 52 224 484 + SEQ ID No. 2950 5555.2 Contig 52 358 1134 + SEQ ID No. 3147 6052. 1 Contig52 1145 1837 + SEQ ID No. 2778 5201.2 Contig52 1785 2489 + SEQ ID No. 2779 5202.2 Contig52 2453 2761 + SEQ ID No. 2780 5204. 2 Contig52 2762 3238 + SEQ ID No. 2295 4444.2 Contig52 3519 4844 98% SEQ ID No. 2294 4442.1 Contig52 4989 5945 98% SEQ ID No. 2293 4441. 1 Contig52 p 6110 6532 99% SEQ ID No. 2292 4440. 1 Contig52 p 6424 6957 98% SEQ ID No. 621 1863.2 Contig52 p 6950 7645 99% SEQ ID No. 620 1862.2 Contig52 p 7735 9072 96% SEQ ID No. 3315 801.

  3 Contig52 p 9080 9829 94% SEQ ID No. 3316 802.3 Contig52 p 9968 10765 - 99% SEQ ID No. 3317 803.3 Contig52 p 10775 11470 + 99% SEQ ID No. 2781 5206.1 Contig52 p 11494 12612 + 98% SEQ ID No. 1421 3142. 2 Contig52 p 12546 13499 - - 94% SEQ ID No. 401 1532. 3 Contig52 p 13507 15498 - 97% SEQ ID No. 402 1533. 1 Contig52 p 15502 16737 97% SEQ ID No. 220 1246. 2 Contig52 p 16920 18671 80% SEQ ID No. 219 1245. 1 Contig52 p 18783 19034 87% + SEQ ID No. 218 1244. 2 Contig52 p 19306 20388 - 89% + SEQ ID No. 329 1417. 1 Contig52 p 20421 20891 - - 100% SEQ ID No. 330 1418. 3 Contig52 m 20994 22823 + 90% SEQ ID No. 3146 6049. 1 Contig52 m 22855 23631 + SEQ ID No. 1285 2954. 3 Contig52 m 23498 24508 99% SEQ ID No. 3131 601 4 Contig52 p 24684 25916 + SEQ ID No. 3127 600.3 Contig52 p 25859 26539 - + SEQ ID No. 3118 598.2 Contig52 p 26619 26939 + - 100% SEQ ID No. 3115 597.2 Contig52 p 26966 27346 + 98% SEQ ID No. 3114 596. 3 Contig52 m 27403 29127 99% + SEQ ID No. 1286 2955. 2 Contig52 p 29162 29581 99% + SEQ ID No. 1287 2958. 2 Contig52 p 29575 30342 98% SEQ ID No. 1288 2959. 1 Contig52 p 30346 31104 + - 97% SEQ ID No. 1290 2960. 1 Contig52 p 31112 32215 - 98% SEQ ID No. 1291 2961. 1 Contig52 m 32318 33571 - 98% SEQ ID No. 1292 2962. 1 Contig52 p 33682 34458 98% SEQ ID No. 1006 2495. 2 Contig52 p 34434 34982 - 98% SEQ ID No. 1005 2493. 2 Contig52 p 34913 35578 - - 98% SEQ ID No. 1004 2492. 2 Contig52 p 35616 35948 + 95% + SEQ ID No. 3409 938. 3 Contig52 m 35989 37614 90% SEQ ID No. 3408 937. 3 Contig52 m 37875 39305 + - 99% SEQ ID No. 437 1589. 3 Contig52 m 39287 39994 99% SEQ ID No. 439 1590.1 Contig52 4002540582 + 98% - SEQ ID No. 440 1591.4 Contig52 40813 42264 98% SEQ ID No. 1293 2963. 2 Contig52 42366 43133 98% SEQ ID No. 1294 2964. 1 Contig52 43134 43991 98% SEQ ID No. 1295 2965. 1 Contig52 44163 44477 100% + SEQ ID No. 1296 2966. 1 Contig52 44480 45376 97% + SEQ ID No 1297 2967. 1 Contig52 45421 45705 100% + SEQ ID No. 1298 2968. 3 Contig52 45890 48583 76% SEQ ID No. 2892 5455.1 Contig52 48635 49105 98% SEQ ID No. 787 2156.3 Contig52 49102 50409 98% - SEQ ID No. 538 1740.3 Contig52 50644 51432 100% SEQ ID No. 536 1739. 2 Contig52 51433 52056 99% SEQ ID No. 535 1738. 3 Contig52 52040 53257 99% + SEQ ID No. 408 1547. 2 Contig52 53250 54101 99% SEQ ID No. 407 1545. 3 Contig52 54083 55753 99% + SEQ ID No. 1531 3311. 1 Contig52 55754 57133 98% + SEQ ID No. 831 2235. 2 Contig52 57282 59225 97% SEQ ID No. 1532 3312.1 Contig52 59352 59669 98% - SEQ ID No. 2937 5534.2 Contig52 59770 61257 99% SEQ ID No. 2121 4197.2 Contig52 61258 63633 99% - SEQ ID No. 2938 5535.1 Contig52 62267 62506 97% + SEQ ID No. 345 1448. 2 Contig52 63680 64834 96% SEQ ID No. 346 1449.3 Contig52 64855 67023 + 98% - SEQ ID No. 2120 4195.3 Contig52 67104 68273 + 99% SEQ ID No. 2734 5100. 2 Contig52 68261 69484 96% SEQ ID No. 1578 3378. 2 Contig52 69468 71318 98% SEQ ID No. 1577 3376. 1 Contig52 71343 72434 96% SEQ ID No. 1773 366. 2 Contig52 72814 73131 91% + SEQ ID No. 1788 368.2 Conti g52 73211 75703 93% - SEQ ID No. 1576 3374.1 Contig52 75741 76907 94% SEQ ID No. 3441 982. 3 Contig52 77475 78893 + 98% + SEQ ID No. 3442 983.1 Contig52 78868 79611 98% - SEQ ID No. 3443 985.2 Contig52 79583 80569 99% - SEQ ID No. 1575 3371.2 Contig52 80548 81924 100% SEQ ID No. 2553 4813. 2 Contig52 81928 83229 99% SEQ ID No. 1573 3368. 2 Contig52 82091 82516 97% + SEQ ID No. 2554 4814.2 Contig52 83467 84225 - 99% SEQ ID No. 2555 4815.2 Contig52 84536 84952 99% SEQ ID No. 255 130. 4 Contig52 84956 86611 - 98% SEQ ID No. 249 129. 3 Contig52 86644 86940 96% + SEQ ID No. 227 126. 2 Contig52 87008 88483 98% SEQ ID No. 2433 465.2 Contig52 88842 89729 - 99% SEQ ID No. 2425 464.2 Contig52 89686 90996 95% SEQ ID No. 2420 463. 2 Contig52 90941 91528 95% + SEQ ID No. 2412 462.2 Contig52 90969 91781 + 94% SEQ ID No. 2400 460.2 Contig52 91747 92295 - 98% SEQ ID No. 2393 459. 3 Contig52 92270 92908 - 99% SEQ ID No. 2386 458.3 Contig52 92893 93930 - 98% SEQ ID No. 1279 2943.1 Contig52 93920 94501 + 100% SEQ ID No. 1278 2942.1 Contig52 94512 96995 99% SEQ ID No. 1277 2941. 1 Contig52 97049 98665 97% SEQ ID No. 3108 5944. 1 Contig52 98412 98600 96% + SEQ ID No. 198 1215.3 Contig52 98687 99826 - 100% SEQ ID No. 200 1220.3 Contig52 99827 101356 - 98% SEQ ID No. 751 2103.2 Contig52 101440 103845 + 99% SEQ ID No. 470 1638. 2 Contig52 103846 105045 99% + SEQ ID No. 471 1639. 4 Contig52 105158 106336 - 91% + SEQ ID No. 468 1635. 4 Contig52 106495 109404 92% + SEQ ID No. 2909 5481. 1 Contig52 109609 110751 + 97% SEQ ID No. 2445 4665. 2 Contig52 110890 113277 98% SEQ ID No. 2178 4288. 2 Contig52 113583 114581 + 97% SEQ ID No. 2179 4289. 2 Contig52 114538 115254 + 99% SEQ ID No. 2181 4291. 1 Contig52 115152 115556 + 98% SEQ ID No. 3293 770. 3 Contig52 115526 116104 - 97% SEQ ID No. 3294 771. 4 Contig52 115998 116444 100% SEQ ID No. 3295 772. 4 Contig52 116524 117759 99% + SEQ ID No. 3296 774. 3 Contig52 117790 119229 - 100% + SEQ ID No. 3297,775 2 Contig52 119230 119802 + 99% SEQ ID No. 2 182 4293. 2 Contig52 119803 120579 - 99% SEQ ID No. 2910 5482. 2 Contig52 120600 121508 98% SEQ ID No. 1920 3909. 3 Contig52 p 121603 123297 97% + SEQ ID No. 1921 3911. 2 Contig52 p 123484 125370 99% SEQ ID No. 925 2382. 2 Contig52 m 125482 125799 100% SEQ ID No. 924 2381. 2 Contig52 m 125894 127072 96% SEQ ID No. 922 2377. 2 Contig52 m 127035 128015 99% SEQ ID No. 921 2375 3 Contig52 p 128218 128793 98% SEQ ID No. 1922 3913. 2 Contig52 m 128905 130032 + 100% SEQ ID No. 1923 3914. 3 Contig52 m 130020 131921 + 99% SEQ ID No. 832 2239. 3 Contig52 p 132081 133076 + SEQ ID No. 833 2240. 2 Contig52 m 133339 133824 98% SEQ ID No. 834 2241. 2 Contig52 m 133818 134192 99% SEQ ID No. 2253 4384. Contig52 m 134261 135727 99% SEQ ID No. 3145 6044. 1 Contig52 p 135288 135446 96% + SEQ ID No. 2254 4385. 1 Contig52 p 135914 137590 99% + SEQ ID No. 2255 4386. 2 Contig52 p 137514 139124 98% SEQ ID No. 2585 4867. 2 Contig52 p 139087 140526 92 % SEQ ID No. 2586 4868. 2 Contig52 p 140406 141347 98% SEQ ID No. 2587 4869. 3 Contig52 p 141335 141775 100% SEQ ID No. 2945 5549. 2 Contig52 p 141660 142481 99% SEQ ID No. 2944 5548. 1 Contig52 m 142688 143068 100% + SEQ ID No. 2943 5546. 1 Contig52 p 143354 143830 100% SEQ ID No. 2590 4874. 2 Contig52 p 143907 145352 77% + SEQ ID No. 2591 4875. 1 Contig52 m 145418 145843 96% SEQ ID No. 2592 4877. 2 Contig52 m 145945 147057 98% SEQ ID No. 2419 4629. 2 Contig52 p 147294 147728 98% + SEQ ID No. 2418 4628. 2 Contig52 p 147706 148005 100% SEQ ID No. 2417 4627. 2 Contig52 p 147984 149039 100% SEQ ID No. 2416 4626. 1 Contig52 p 149012 149989 99% SEQ ID No. 2415 4625. 2 Contig52 p 149995 150963 98% SEQ ID No. 2545 4803. 2 Contig52 p 150975 151721 99% SEQ ID No. 2546 4804. 1 Contig52 p 151758 152054 100% SEQ ID No. 2547 4805. Contig52, 152038, 153312, 995, SEQ ID No. 2548, 4806. Contig52, 153313, 154311, 97%, SEQ ID No. 3144 6042, Contig 52, 154287, 154949, 97%, and SEQ ID No. 2641 4958. 3 Contig52 p 154943 155851 96% SEQ ID No. 2640 4957. 2 Contig52 p 155962 156318 - 98% SEQ ID No. 282 1346. 3 Contig52 p 156342 157166 98% SEQ ID No. 281 1345. 3 Contig52 p 157275 158378 - 97% SEQ ID No. 1670 3517. 3 Contig52 p 158419 159726 99% SEQ ID No. 347 1450. 2 Contig52 m 160244 161539 98% SEQ ID No. 1671 3519. 1 Contig52 p 161680 162921 - 98% SEQ ID No. 1672 3520. Contig52 m 163009 164394 + 97% SEQ ID No. 1673 3521. 2 Contig52 p 164484 165635 - 97% SEQ ID No. 1674 3522. 1 Contig52 m 165688 16652499% SEQ ID No. 1675 3524. 1 Contig52 p 166701 167300 - - 98% SEQ ID No. 1676 3525. 1 Contig52 p 167624 168361 - 99% SEQ ID No. 1677 3527. 1 Contig52 p 168334 168732 - 100% SEQ ID No. 2139 4228. 2 Contig52 m 168692 170233 99% SEQ ID No. 2138 4227. 1 Contig52 p 170259 171749 - 98% SEQ ID No. 96 1059.2 Contig52 m 171843, 173126 99% + SEQ ID No. 97 1060.2 Contig52 p 173322 174221 - 94% SEQ ID No. 2137 4226.2 Contig52 p 174266 176896 - 98% SEQ ID No. 932 2395. 3 Contig52 p 176847 177977 - 94 % SEQ ID No. 454 1611. 5 Contig52 p 177956 179017 - 98% SEQ ID No. 3143 6040. 1 Contig 52 p 178884 179285 + SEQ ID No. 3081 5876. 2 Contig52 p 179252 179977 - - 99% SEQ ID No. 3141 6039. 1 Contig52 p 179971 181719 - 100% SEQ ID No. 2966 5588. 2 Contig52 p 181821 182123 + 100% SEQ ID No. 2325 4489. 3 Contig52 p 182170 183339 - 100% SEQ ID No. 2324 4488. 1 Contig52 p 183570 184718 - - 100% SEQ ID No. 2323 4487. 1 Contig52 p 184719 185408 -, 97% SEQ ID No. 578 1795. 3 Contig52 p 185529 188249 - 98% SEQ ID No. 2542 4800. 2 Contig52 p 188179 188973 - 98% SEQ ID No. 2543 4801. 1 Contig52 p 188964 189461 - 93% SEQ ID No. 2544 4802. 2 Contig52 p 189554 190114 94% SEQ ID No. 2965 5587. 3 Contig52 p 190081 190959 - - 98% SEQ ID No. 2735 5103. 4 Contig52 m 191093 191497 - - 100% SEQ ID No. 2736 5104. 3 Contig 52 m 191571 193376 - 97% SEQ ID No. 577 1794. 3 Contig52 m 193397 194182 - 97% SEQ ID No. 576 1793. 3 Contig52 m 194158 195009 - 99% SEQ ID No. 2894 5457. 1 Contig52 m 195010 195438 - - 99% SEQ ID No. 2670 5003. 2 Contig52 m 195444 196262 - 97% + SEQ ID No. 2671 5005. 3 Contig52 m 196424 197824 + 99% SEQ ID No. 2893 5456.1 Contig52 m 197784 198467 - 99% - SEQ ID No. 1812 3712.2 Contig52 m 198472 199365 98% - SEQ ID No. 1811 3711.1 Contig52 m 199322 199801 100% - SEQ ID No. 1810 3710.1 Contig52 m 199795 200760 - - 98% SEQ ID No. 1808 3709.1 Contig52 p 201015 201863 - 96% SEQ ID No. 1807 3708.1 Contig52 p 201767 202480 - 99% - SEQ ID No. 1806 3706.2 Contig52 p 202699 203940 99% - SEQ ID No. 1805 3705.1 Contig52 p 203934 204731 - - 98% SEQ ID No. 1804 3703.1 Contig52 p 204682 205314 98% SEQ ID No. 1803 3702. 1 Contig52 p 205289 206050 - 99% SEQ ID No. 1802,371. 1 Contig52 p 206268 207071 97% SEQ ID No. 1800 3699. 3 Contig52 p 207457 210069 96% + SEQ ID No. 2149 4242.2 Contig52 p 210147 211148 95% - SEQ ID No. 2150 4243.2 Contig52 m 211272 211772 - 95% - SEQ ID No. 2151 4244.1 Contig52 p 211897 212304 + + + SEQ ID No. 2152 4246.2 Contig52 p 212331 213194 - 96% SEQ ID No. 266 1323. 2 Contig52 p 213309 213839 - 98% + SEQ ID No. 265 1322. 2 Contig52 m 213961 215397 + 97% SEQ ID No. 395 1525.3 Contig52 m 215375 216646 98% - SEQ ID No. 396 1528.4 Contig52 p 216734 218086 - 98% SEQ ID No. 400 1531. 3 Contig52 p 217993 220296 - 99% SEQ ID No. 399 1530. 2 Contig52 m 220337 220723 - 98% SEQ ID No. 397 1529.2 Contig52 p 220737 221954 - 99% - SEQ ID No. 1540 3327.1 Contig52 p 221944 222768 96% + SEQ ID No. 1541 3328.1 Contig52 p 222755 224497 - 98% SEQ ID No. 1543 3331. 1 Contig52 p 224570 225568 - 96% SEQ ID No. 433 1584. 3 Contig52 p 225621 228359 - 99% + + SEQ ID No. 1544 3333. 1 Contig52 p 228335 228760 99% SEQ ID No. 1545 3334. 2 Contig52 p 228944 229807 - 97% + SEQ ID No. 2678 5021. 3 Contig52 m 229852 230601 100% SEQ ID No. 2676 5019. 1 Contig52 m 230836 231474 - - 99% SEQ ID No. 2675 5018. 2 Contig 52 m 231413 231898 - 98% + SEQ ID No. 2464 4696. 3 Contig52 m 231883 233508 - 99% SEQ ID No. 2463 4695. 1 Contig52 p 233502 233720 + + SEQ ID No. 2462 4694. 1 Contig52 p 233593 235266 98% SEQ ID No. 2461 4692. 5 Contig52 m 235 587 236966 98% SEQ ID No. 444 1598. 6 Contig52 p 236937 237929 - 100% SEQ ID No. 443 1595. 3 Contig52 p 237930 239072 98% SEQ ID No. 442 1594. 2 Contig52 p 239053 239775 97% SEQ ID No 989 2472. 2 Contig 52 p 239763 240410 - - 96% SEQ ID No. 990 2473.1 Contig52 p 240545 240859 - - 100% - SEQ ID No. 991 2474.1 Contig52 p 240853 241485 99% SEQ ID No. 2609 4901. 3 Contig52 p 241486 243285 99% SEQ ID No. 2608 4900. 3 Contig52 p 243257 246211 98% + SEQ ID No. 2247 4376.3 Contig52 p 246162 246848 97% - SEQ ID No. 2248 4377.4 Contig52 m 246921 247985 96% + SEQ ID No. 3140 6038.1 Contig52 p 247180 247419 96% + SEQ ID No. 3433 971. 2 Contig52 m 248160 249020 98% + SEQ ID No. 3434 972. 3 Contig52 p 249094 250731 96% SEQ ID No. 2604 4891. 2 Contig52 m 250785 251615 - - 99% SEQ ID No. 2602 4889. 1 Contig52 m 251793 252218 100% SEQ ID No. 2601 4888.1 Contig52 m 252280 252804 96% - SEQ ID No. 2600 4887.3 Contig52 p 252888 253451 - - 97% SEQ ID No. 2716 5075.4 Contig52 p 253679 256276 94% - SEQ ID No. 3139 6037.1 Contig52 p 255546 255887 - 81% - SEQ ID No. 2715 5072.2 Contig52 m 255557 256015 - 82% SEQ ID No. 2714 5071.2 Contig52 p 256486 257511 - 88% + SEQ ID No. 2296 4452.2 Contig52 p 257614 259002 94% - SEQ ID No. 2297 4453.2 Contig52 p 259133 260563 - 78% + SEQ ID No. 2298 4454.4 Contig52 m 260752 261759 - - 95% - SEQ ID No. 3138 6036.1 Contig52 p 262003 262335 - + + SEQ ID No. 2963 5584.2 Contig52 m 262416 263513 + + SEQ ID No. 2662 4993. 2 Contig52 m 263713 264231 - 99% SEQ ID No. 2661 4992. 2 Contig52 p 264173 264472 - 98% + SEQ ID No. 2660 4990. 3 Contig52 p 264835 266655 94% + SEQ ID No. 984 2466.3 Contig52 p 266848 269556 95% - SEQ ID No. 2389 4584.3 Contig52 m 269691 270662 98% + SEQ ID No. 2953 5559.3 Contig52 270701 271255 - 97% + SEQ ID No. 2954 5560. 3 Contig52 271292 271954 98% SEQ ID No. 2955 5563. 1 Contig52 272495 272959 100% SEQ ID No. 2956 5564. 1 Contig52 273293 274750 99% SEQ ID No. 3387 908. 4 Contig52 274806 276458 97% SEQ ID No. 2237 4364. 2 Contig52 27490 0 275220 97% SEQ ID No. 3386 907. 4 Contig52 276498 279179 99% SEQ ID No. 2388 4581. 2 Contig52 279189 279581 99% + SEQ ID No. 2387 4580. 1 Contig52 279617 280120 90% SEQ ID No. 2385 4578 1 Contig52 280373 281584 99% SEQ ID No. 2384 4577. 2 Contig52 281864 282706 98% SEQ ID No. 2258 4389. 2 Contig52 282782 284104 + 99% SEQ ID No. 2259 4391. 1 Contig52 284105 284953 97% SEQ ID No 2260 4392. 1 Contig52 284954 285220 + SEQ ID No. 2261 4393. 1 Contig52 285109 285819 96% SEQ ID No. 2262 4394. 4 Contig52 285823 287865 98% SEQ ID No. 2699 5052. 4 Contig52 287980 288597 96% + SEQ ID No. 2698 5050. 2 Contig52 288634 289383 98% SEQ ID No. 1883 3838. 3 Contig52 289389 291629 99% SEQ ID No. 1885 3840. 1 Contig52 291630 292769 99% SEQ ID No. 1886 3841. 2 Contig52 292848 295433 85 % SEQ ID No. 3341 843. 2 Contig52 295435 296004 99% SEQ ID No. 3342 844. 2 Contig52 296047 296436 99% SEQ ID No. 3343 845. 4 Contig52 296556 297314 98% SEQ ID No. 1002 249. 4 Contig52 297549 299282 98% SEQ ID No. 3071,584 8. 1 Contig52 298199 298495 96% + SEQ ID No. 1008 250. 1 Contig52 299279 300508 99% SEQ ID No. 1014 251. 2 Contig52 300542 301417 99% + SEQ ID No. 1019 252. 2 Contig52 301431 302669 98% SEQ ID No. 1912 3898. 2 Contig52 302744 303340 98% + SEQ ID No. 1913 3899. 2 Contig52 303353 303835 98% + SEQ ID No. 1916 3901. 2 Contig52 303849 304757 99% SEQ ID No. 1917 3902. 3 Contig52 304877 306370 98% SEQ ID No. 1893 3857. 3 Contig52 306327 307457 + 98% SEQ ID No. 1892 3855. 1 Contig52 307661 308464 98% SEQ ID No. 315 1398. 2 Contig52 308532 310538 97% SEQ ID No. 3161399. 3 Contig52 310525 312153 99% SEQ ID No. 1891 3853. 2 Contig52 312450 313760 98% SEQ ID No. 1890 3851. 1 Contig52 314121 314300 + SEQ ID No. 1889 3850. 1 Contig52 314297 314740 97% SEQ ID No. 1888 3849 1 Contig52 314722 315453 99% SEQ ID No. 2582 4863. 4 Contig52 315679 317031 99% SEQ ID No. 2583 4864. 2 Contig52 317013 317423 + SEQ ID No. 2891 5453.2 Contig53 2 1057 + 99% SEQ ID No. 1486 3244.2 Contig53 1210 1977 99% SEQ ID No 3187 618. 3 Contig53 2045 2461 100% SEQ ID No. 3188 619.1 Contig53 2371 3357 97% SEQ ID No. 3189 621.5 Contig53 3335 4654 99% SEQ ID No. 3233 687. 5 Contig53 4655 5932 + 98% SEQ ID No. 3234 688.1 Contig53 5916 6770 99% SEQ ID No. 1485 3243.1 Contig53 6880 7188 99% + SEQ ID No. 1484 3242. 3 Contig53 7361 10084 98% + SEQ ID No. 2989 5633. 2 Contig53 10360 11202 98% SEQ ID No. 2990 5634.2 Contig53 11203 11337 + SEQ ID No. 2991 5636.1 Contig53 11490 11912 99% + SEQ ID No. 2992 5637. 1 Contig53 12003 12689 99% SEQ ID No. 2516 4766. 2 Contig53 12665 13120 100% SEQ ID No. 2517 4767. 2 Contig53 13062 13379 100% SEQ ID No. 2518 4768. 1 Contig53 13467 13820 99% SEQ ID No. 2519 4769. 1 Contig53 14000 14419 100% SEQ ID No. 2520 4770.1 Contig53 14512 14700 + SEQ ID No. 2521 4771.2 Contig53 14837 15913 96% SEQ ID No. 2993 5638. 2 Contig53 16224 16634 + 100% + SEQ ID No. 2854 5377. 2 Contig53 16834 17466 95% + SEQ ID No. 2853 5376. 2 Contig53 17524 21840 99% + SEQ ID No. 1375 3077. 1 Contig53 219 58 22719 97% SEQ ID No. 1376 3078. 2 Contig53 22682 23938 99% SEQ ID No. 1377 3080. 2 Contig53 23895 25349 100% SEQ ID No. 1378 3081. 2 Contig53 25561 26097 98% + SEQ ID No. 1379 3082 1 Contig53 26262 26786 98% SEQ ID No. 1380 3083.1 Contig53 m 26732 27307 + 97% SEQ ID No. 840 2251.3 Contig53 m 27542 28039 92% + SEQ ID No. 1381 3085.2 Contig53 p 28077 30950 - 98% + SEQ ID No 1382 3086. 1 Contig53 p 31106 31714 + 100% SEQ ID No. 1383 3087. 1 Contig53 p 31707 32744 99% SEQ ID No. 1384 3088. 1 Contig53 m 32771 33550 100% SEQ ID No. 2594 488. 2 Contig53 m 33534 34451 99% SEQ ID No. 2603 489. 1 Contig53 m 34530 34715 + SEQ ID No. 2613 491. 1 Contig53 m 34679 35737 97% + SEQ ID No. 2620 492. 4 Contig53 m 35824 36363 98% SEQ ID No. 2852 5373. 1 Contig53 m 36255 36521 + + SEQ ID No. 2625 493. 4 Contig53 m 36559 37296 96% SEQ ID No. 1386 3091. 1 Contig53 m 37453 37764 100% + SEQ ID No. 3075 5867. 1 Contig53 p 37577 37750 94% + SEQ ID No. 515 1705. 2 Contig53 p 37874 38746 98% + SEQ ID No. 516 1706. 2 Contig53 m 38847 39317 98% SEQ ID No. 517 1707. 2 Contig53 m 39318 39686 100% SEQ ID No. 1387 3093. Contig53 m 39710 40480 98% SEQ ID No. 1388 3095.

  1 Contig53 m 40462 41001 98% SEQ ID No. 1389 3096. 1 Contig53 m 40977 41246 100% SEQ ID No. 1390 3097. 3 Contig53 m 41324 42712 99% SEQ ID No. 1947 3960. 2 Contig53 m 42957 43676 93% + SEQ ID No. 1945 3959. 2 Contig53 p 43842 45401 97% SEQ ID No. 3270 742. 3 Contig53 P 45729 47141 + 99% SEQ ID No. 3269 741. 2 Contig53 P 47095 47721 97% + SEQ ID No. 3268 740 2 Contig53 p 47919 48266 - 100% SEQ ID No. 819 2213. 2 Contig53 m 48480 48932 + 100% + SEQ ID No. 1944 3958. 1 Contig53 m 48942 49568 + 97% SEQ ID No. 1943 3957. 1 Contig53 m 49907 50113 + + SEQ ID No. 1942 3956. 2 Contig53 P 50175 50906 98% SEQ ID No. 2929 5524. 1 Contig53 p 50884 51435 99% SEQ ID No. 2928 5523. 2 Contig53 P 51398 52447 + 97% SEQ ID No 935 2400. 2 Contig53 p 52389 53321 99% SEQ ID No. 936 2401. 2 Contig53 p 53322 53972 + 98% SEQ ID No. 361 1476. 2 Contig53 p 54335 55246 - 100% + SEQ ID No. 360 1475. 2 Contig53 m 55250 55540 100% + SEQ ID No. 690 1989. 2 Contig53 p 55808 57301 98% SEQ ID No. 692 1990. 1 Contig53 p 57129 58001 97% SEQ ID No. 942 241. 2 Contig53 p 57980 59827 98% SEQ ID No. 934 240. 1 Contig53 p 59751 60809 99% SEQ ID No. 929 239. 1 Contig53 p 60784 61458 97% SEQ ID No. 923 238. 1 Contig53 p 61569 62993 98% + SEQ ID No. 908 236. 1 Contig53 m 62888 63082 98% + SEQ ID No. 898 235. 2 Contig53 m 63083 64465 98% SEQ ID No. 1299 2969. 1 Contig53 m 64558 64863 98% SEQ ID No. 1301 2970. 2 Contig53 m 64881 65435 100% SEQ ID No. 3392 916. 3 Contig53 m 65548 66546 98% SEQ ID No. 3393 917. 3 Contig53 m 66654 66896 100% SEQ ID No. 3394 918. 3 Contig53 p 66802 66963 100% + SEQ ID No. 3395 919. 1 Contig53 p 67100 67537 - 92% SEQ ID No. 3396 920. 2 Contig53 m 67640 68068 - 97% + SEQ ID No. 2437 4655. 3 Contig53 p 68083 69438 + 99% SEQ ID No. 283 1353. 3 Contig53 p 69533 70615 99% + SEQ ID No. 284 1354. 2 Contig53 p 70542 71525 99% + SEQ ID No. 2436 4653. 2 Contig53 p 71489 72391 98 % SEQ ID No. 2435 4652. 2 Contig53 p 72395 72793 97% SEQ ID No. 2287 4432. 2 Contig53 m 72795 73247 97% + SEQ ID No. 2288 4433. 1 Contig53 p 73488 74099 98% SEQ ID No. 2289 4434. 1 Contig53 m 74253 75062 92% + SEQ ID No. 2290 4435. 4 Contig53 p 75252 77324 94% + SEQ ID No. 2339 451. 3 Contig53 m 78146 79099 97% + SEQ ID No. 2334 450. 1 Contig53 p 79261 79500 + SEQ ID No. 2316 448. 1 Contig53 p 79662 79931 100% SEQ ID No. 2307 447. 2 Contig53 p 79932 80276 100% SEQ ID No. 2291 444. 2 Contig53 p 80346 80738 96% SEQ ID No. 2285 443. 3 Contig53 p 80802 81404 99% SEQ ID No. 1703 3562. 3 Contig53 p 81579 82721 99% SEQ ID No. 1702 3561. 2 Contig53 p 82655 85069 99% SEQ ID No. 3362 874. 2 Contig53 p 85470 86042 + 99% SEQ ID No. 3361 873. 2 Contig53 p 86027 86338 + 96% SEQ ID No. 3360 872. 2 Contig53 p 86339 86992 - 100% SEQ ID No 3359 870. 3 Contig53 p 86938 88077 + 98% SEQ ID No. 3358 869. 2 Contig53 m 87390 87602 94% + SEQ ID No. 3222 668. 4 Contig53 p 88067 91228 + 97% SEQ ID No. 3221 667. 3 Contig53 m 89749 90402 95% SEQ ID No. 1536 3322. 2 Contig53 p 91234 92052 98% SEQ ID No. 1537 3323. 1 Contig53 p 92027 92644 - 100% SEQ ID No. 1538 3324. 1 Contig53 p 92655 93068 + 99% SEQ ID No. 2217 434. 3 Contig53 p 93248 93892 99% SEQ ID No. 2209 433. 1 Contig53 p 93919 96957 99% + SEQ ID No. 2200 432. 1 Contig53 m 94806 95345 99% + SEQ ID No. 2194 431. 1 Contig53 m 95892 96227 99% + SEQ ID No. 104 1071. 3 Contig53 m 97055 98368 - 98% SEQ ID No. 105 1072 4 Contig53 m 98314 101307 99% SEQ ID No. 1539 3326. 2 Contig53 m 101235 102038 - 100% SEQ ID No. 2794 5238. 1 Contig53 m 102305 103894 - 98% SEQ ID No. 3411 940. 4 Contig53 m 103921 104814 - 98% SEQ ID No. 3412 941. 3 Contig53 m 104792 106147 100% SEQ ID No. 3413 943. 3 Contig53 m 106148 106648 - 98% SEQ ID No. 3414 944. 3 Contig53 m 106644 107087 - 99% SEQ ID No 1932 3928. 1 Contig53 p 107241 109073 99% SEQ ID No. 1933 3929. 2 Contig53 p 109621 111270 + 99% SEQ ID No. 1868 3814. 1 Contig53 m 111272 112147 + 98% SEQ ID No. 3431 969. 2 Contig53 p 112570 113343 99% SEQ ID No. 3430 967. 2 Contig53 m 113522 114547 99% SEQ ID No. 3429 966. 2 Con tig53 m 114682 115431 99% SEQ ID No. 3428 965. 3 Contig53 p 115497 116042 + 100% + SEQ ID No. 1869 3815. 2 Contig53 m 116186 116506 - 100% SEQ ID No. 1870 3816. 2 Contig53 p 116694 117437 + 99% SEQ ID No. 1871 3818. 1 Contig53 m 117666 117950 100% SEQ ID No. 1872 3819. 2 Contig53 m 118126 118455 100% SEQ ID No. 2452 4676. 2 Contig53 m 118452 119846 99% SEQ ID No. 3137 6029 1 Contig53 m 120054 120221 SEQ ID No. 2451 4673. 1 Contig53 m 120233 120505 - 100% SEQ ID No. 2450 4672. 1 Contig53 p 120729 121451 99% SEQ ID No. 2449 4671. 3 Contig53 p 121408 122550 - 97% SEQ ID No. 2722 5082. 3 Contig53 p 122604 124115 - 98% + SEQ ID No. 141 1123. 2 Contig53 p 124321 125466 99% SEQ ID No. 140 1122. 1 Contig53 p 125451 126383 + 99% SEQ ID No. 781 2149. 4 Contig53 p 126515 127813 99% SEQ ID No. 2711 5068. 3 Contig53 p 128031 128603 96% SEQ ID No. 2712 5069. 3 Contig53 m 128803 129348 97% SEQ ID No. 3067 5829. 2 Contig53 p 129374 130126 + 94% SEQ ID No. 2348 4522. 4 Contig53 p 130084 130770 95% SEQ ID No. 2347 4521. 1 Contig53 p 130727 131422 98% SEQ ID No. 2346 4520. 1 Contig53 p 131377 132636 99% SEQ ID No. 362 1479. 3 Contig53 p 132452 133864 97% SEQ ID No. 364 1481. 3 Contig53 p 133846 134982 96% SEQ ID No. 601 1838. 2 Contig53 m 135071 136582 + 93% SEQ ID No. 2431 4647. 2 Contig53 p 136661 137836 + 97% + SEQ ID No. 2359 4535. 2 Contig53 m 137909 139276 + 100 % SEQ ID No. 2360 4536. 1 Contig53 m 139327 140496 + 99% SEQ ID No. 2361 4538. 2 Contig53 m 140456 142003 99% SEQ ID No. 2363 4540. 2 Contig53 m 142103 142414 + 94% + SEQ ID No. 735 207. 3 Contig53 m 142476 143771 + 98% SEQ ID No. 727 206. 3 Contig53 p 144091 144813 95% SEQ ID No. 721 205. 1 Contig53 p 144761 145621 + 97% SEQ ID No. 717 204. 1 Contig53 p 145639 147006 98% SEQ ID No. 704 202. 3 Contig53 p 147129 149489 + 99% SEQ ID No. 3264 732. 3 Contig53 p 149594 150103 + 100% SEQ ID No. 3263 731. 2 Contig53 p 150075 151127 87% SEQ ID No. 3262 730. 1 Contig53 p 151252 151707 97% SEQ ID No. 3261 729. 1 Contig53 p 151701 152474 99% SEQ ID No. 3260 728. 2 Contig53 p 152475 152882 99% SEQ ID No. 1341 3024. 1 Contig53 p 152886 154184 99% SEQ ID No. 1340 3023. 1 Contig53 p 154337 154546 + SEQ ID No. 1339 3022 1 Contig53 p 154705 154980 100% + SEQ ID No. 233 1268. 2 Contig53 p 155302 156252 98% SEQ ID No. 232 1267. 3 Contig53 p 156234 157100 97% SEQ ID No. 231 1265. 5 Contig53 m 157090 157923 97 % SEQ ID No. 1338 3018. 1 Contig53 158359 159219 - - 96% + SEQ ID No. 1337 3017. 1 Contig53 159194 159544 + + SEQ ID No. 1336 3016. 1 Contig53 159545 160066 + + SEQ ID No. 1335 3015.1 Contig53 159996 160766 - - 97% - SEQ ID No. 1334 3014.1 Contig53 160720 161361 - - 97% SEQ ID No. 1333 3013.2 Contig53 161325 161795 - 96% SEQ ID No. 1332 3011. 2 Contig53 161789 162874 + SEQ ID No. 2814 5288.1 Contig53 162784 163212 + SEQ ID No. 2815 5289.2 Contig53 163191 163865 94% SEQ ID No. 2824 5312. 2 Contig53 164165 164791 - - 96% + SEQ ID No. 2825 5313. 1 Contig53 164821 165249 87% SEQ ID No. 2607 4897 2 Contig53 165348 16650 8 - - 96% SEQ ID No. 2606 4895. 1 Contig53 166781 167182 + - 93% SEQ ID No. 2605 4894.1 Contig53 167095 167523 96% - SEQ ID No. 671 1945.4 Contig53 167507 169294 - - 99% SEQ ID No. 672 1946. 2 Contig53 169298 170029 - - 99% SEQ ID No. 161 1157. 4 Contig53 170063 172897 - 98% SEQ ID No. 1635 3468. 2 Contig53 172891 174162 99% SEQ ID No. 416 1559. 2 Contig53 174213 175388 - - 99% SEQ ID No. 415 1557. 3 Contig53 175448 176338 - 99% + SEQ ID No. 905 2356. 2 Contig53 176752 177408 - 100% + SEQ ID No. 571 1786. 2 Contig53 177979 178392 100% + SEQ ID No 570 1784. 2 Contig53 178463 178897 - - 100% + SEQ ID No. 569 1782. 3 Contig53 179471 180784 - - 99% SEQ ID No. 2826 5316. 1 Contig53 180979 182469 + - 99% SEQ ID No. 2743 5123.3 Contig53 182641 182940 100% - SEQ ID No. 2744 5124.3 Contig53 183002 183481 - + SEQ ID No. 2745 5127.

  4 Contig53 183405 183953 - - 98% SEQ ID No. 1964 3982. 2 Contig53 184332 184934 + - 98% SEQ ID No. 1963 3980.1 Contig53 184907 185500 - 98% - SEQ ID No. 1961 3979.2 Contig53 185478 187220 + - 98% SEQ ID No. 1960 3977.2 Contig53 187318 189588 - 97% - SEQ ID No. 372 1494.2 Contig53 189743 190537 99% SEQ ID No. 373 1495. 1 Contig53 190543 190902 99% SEQ ID No. 374 1497. 2 Contig53 191202 192272 - - 98 % SEQ ID No. 2827 5317. 2 Contig53 m 192709 193332 97% SEQ ID No. 451 1606. 2 Contig53 m 193404 194234 - 98% SEQ ID No. 452 1607. 2 Contig53 m 194228 194500 - + SEQ ID No. 453 1608 2 Contig53 p 194570 195826 - - 99% SEQ ID No. 2396 4597. 1 Contig53 m 195867 196286 100% SEQ ID No. 2397 4598. 2 Contig53 p 196513 197271 - 99% SEQ ID No. 2490 4729. 3 Contig53 p 197390 198196 + - 100% SEQ ID No. 2489 4727. 1 Contig53 p 198224 198724 - - 99% SEQ ID No. 2488 4726. 1 Contig53 p 198889 199224 - 98% SEQ ID No. 2487 4725. 2 Contig53 m 199470 200573 + 99 % SEQ ID No. 2486 4724. 2 Contig53 p 200568 201215 - 100% SEQ ID No. 2485 4721. 2 Contig53 p 201197 201745 99% SEQ ID No. 2593 4878. 2 Contig53 m 202045 203496 99% SEQ ID No. 1228 2859. 2 Contig53 p 203633 204940 - - 99% SEQ ID No 1227 2858. 1 Contig53 m 205210 205464 + SEQ ID No. 3321 81. 3 Contig53 m 205742 205948 + SEQ ID No. 3314 80. 3 Contig53 p 205998 206204 + SEQ ID No. 1159 2743. 2 Contig53 p 206346 206567 - + SEQ ID No. 1160 2745. 1 Contig53 p 206934 207152 - + + SEQ ID No. 3235 692. 1 Contig53 p 209993 210160 - 97% + SEQ ID No. 3236 693. 1 Contig53 m 210303 210845 - - 96% SEQ ID No 3237 694. 3 Contig53 m 210846 212210 + 98% SEQ ID No. 1161 2747. 1 Contig53 m 212435 213457 96% SEQ ID No. 1162 2748. 1 Contig53 p 213767 214243 - 97% + SEQ ID No. 1163 2749. 4 Contig53 m 214284 215546 + - 99% SEQ ID No. 552 1760. 4 Contig53 m 215547 216278 99% SEQ ID No. 550 1759. 4 Contig53 p 216391 217173 99% + SEQ ID No. 1720 3591. 2 Contig53 p 217448 218038 100 % SEQ ID No. 1721 3592. 1 Contig53 p 218007 218450 - 99% + SEQ ID No. 1722 3593. 1 Contig53 p 218407 219393 - - 98% SEQ ID No. 1723 3594. 1 Contig53 m 219507 219902 + + SEQ ID No. 950 2421. 2 Contig53 m 220002 221525 97% SEQ ID No. 1724 3595. 1 Contig53 m 221578 221850 - 97% SEQ ID No. 1725 3596. 1 Contig53 p 221926 222321 - - 100% SEQ ID No. 1726 3597. 3 Contig53 m 222331 222921 98% SEQ ID No. 1727 3598. 3 Contig53 p 223164 223358 - + + SEQ ID No 1728 3599. 4 Contig53 p 223351 224187 99% SEQ ID No. 3039 5741. 1 Contig53 m 224214 224969 - - 99% SEQ ID No. 1106 2657. 3 Contig53 p 225046 227253 - 98% SEQ ID No. 1105 2655. 1 Contig53 p 227254 227673 - 97% SEQ ID No. 1104 2654. 1 Contig53 p 227495 227683 90% + SEQ ID No. 1103 2653. 1 Contig53 m 227848 228192 93% + SEQ ID No. 2559 482. 2 Contig53 m 228193 230004 98% SEQ ID No. 2550 481. 1 Contig53 p 230355 230837 99% SEQ ID No. 2541 480. 3 Contig53 p 230827 232278 99% SEQ ID No. 677 1951. 4 Contig53 p 232262 233032 - 100% SEQ ID No. 676 1950. 2 Contig53 p 233014 234315 - - 100% SEQ ID No. 1606 342. 2 Contig53 p 23428 4 235549 - - 100% SEQ ID No. 1612 343. 1 Contig53 p 235534 235995 100% SEQ ID No. 1616 344. 1 Contig53 p 236025 236402 - - 100% SEQ ID No. 1630 346. 2 Contig53 p 236327 237358 100% SEQ ID No. 1636 347. 1 Contig 53 m 237431 238357 100% SEQ ID No. 1649 349. 2 Contig 53 m 238592 239380 100% SEQ ID No. 1102 2652. 2 Contig 53 m 239239 240552 - 100% SEQ ID No. 1101 2650. 1 Contig53 p 241173 242501 + 100% SEQ ID No. 1021 2521. 4 Contig53 m 242561 243616 - - 100% SEQ ID No. 1022 2522. 1 Contig53 m 243808 244155 + 100% + SEQ ID No. 1023 2523. 1 Contig53 p 244324 244743 100% SEQ ID No. 1024 2524. 2 Contig53 m 244779 245492 - - 97% SEQ ID No. 1100 2649. 1 Contig53 p 245702 246898 - + SEQ ID No. 3210 650. 3 Contig53 p 246861 248021 - + SEQ ID No. 3,211,651. 2 Contig53 m 248091 248534 - + SEQ ID No. 3212 652. 1 Contig53 p 248604 249497 - - 96% SEQ ID No. 1099 2648. 2 Contig53 p 249860 250981 + - 99% SEQ ID No. 1098 2647 2 Contig53 m 251141 251743 100% SEQ ID No. 1097 2646. 1 Contig53 p 251907 252410 1 00% SEQ ID No. 1096 2645. 1 Contig53 m 252511 253491 - - 100% SEQ ID No. 248 1288. 2 Contig53 m 253575 255041 - 100% SEQ ID No. 655 1915. 3 Contig53 m 255160 257109 100% SEQ ID No 654 1913. 2 Contig53 m 257214 257630 100% SEQ ID No. 1095 2644. 1 Contig53 p 257737 258120 + - 100% + SEQ ID No. 1094 2643. 1 Contig53 p 258216 259628 100% SEQ ID No. 339 1434. 3 Contig53 m 259654 261867 - - 100% SEQ ID No. 697 2000. 1 Contig53 m 261939 262439 - 100% + SEQ ID No. 1249 290. 2 Contig53 m 262400 265921 + 100% SEQ ID No. 1229 286. 2 Contig53 m 265922 266464 + 100% SEQ ID No. 1221 284.2 Contig53 m 266431 267564 - - 100% - SEQ ID No. 1215 283.1 Contig53 m 267495 268037 - - 100% SEQ ID No. 1208 282.2 Contig53 m 268047 268784 100% - SEQ ID No. 632 1882.2 Contig53 m 268976 269923 - 100% SEQ ID No. 633 1883. 4 Contig53 m 270013 271392 - - 100% + SEQ ID No. 2759 5159. 2 Contig53 p 271638 273131 - 100% SEQ ID No. 660 1926. 2 Contig53 p 273283 273951 98% SEQ ID No. 661 1928. 2 Contig53 p 273981 275270 - - 99% SEQ ID No. 3322 813.2 Contig53 p 275271 276566 100% - SEQ ID No. 3323 815.2 Contig53 p 276554 277786 - 97% - SEQ ID No. 1895 3860.2 Contig53 p 277948 278538 100% - SEQ ID No. 1894 3859.2 Contig53 p 278522 279865 - - 99% SEQ ID No. 1127 2690.2 Contig53 p 280065 281204 - 97% + SEQ ID No. 1125 2688. 2 Contig53 p 281205 281639 - + + SEQ ID No. 2758 5156. 1 Contig53 m 281789 282058 + + SEQ ID No. 694 1998. 3 Contig53 m 282043 283029 - 98% SEQ ID No. 3037 5739. 3 Contig53 p 283472 288685 + SEQ ID No. 3410 94. 7 Contig53 p 288516 295643 + + SEQ ID No. 1085 2624.1 Contig54 p 3 554 + - SEQ ID No. 57 10.1 Contig54 p 888 1235 + - SEQ ID No. 3382 9.1 Contig54 p 1049 1552 + SEQ ID No. 3242 7. 1 Contig54 p 1711 5829 + SEQ ID No. 1977 4.1 Contig54 p 5766 6818 - + - SEQ ID No. 1322 3.1 Contig54 p 6822 7124 + SEQ ID No. 695 2. 1 Contig54 p 7066 7698 + SEQ ID No. 3194 63.1 Contig54 m 9066 9281 - + + SEQ ID No. 3167 61.1 Contig54 p 9759 10058 + + SEQ ID No. 3126 60. 1 Contig54 m 9838 10008 + + SEQ ID No. 3091 59.1 Contig54 p 10665 11108 + SEQ ID No. 3052 58.1 Contig54 m 11098 11802 + SEQ ID No. 3025 57. 1 Contig54 p 11919 12803 - 91% + SEQ ID No. 2919 55. 1 Contig54 p 12574 13131 - 96% + SEQ ID No. 2775 52. 1 Contig54 p 13132 13347 + SEQ ID No. 2666 50.1 Contig54 p 13299 13646 + 82% SEQ ID No. 2540 48.1 Contig54 p 13647 13937 + SEQ ID No. 2466 47. 1 Contig54 p 13831 16404 94% SEQ ID No. 2399 46.1 Contig54 p 16389 17111 + 93% SEQ ID No. 2333 45.1 Contig54 p 17248 17664 - 80% + SEQ ID No. 2266 44.1 Contig54 p 17665 18708 94% SEQ ID No. 2187 43. 1 Contig54 p 18684 19421 95% SEQ ID No. 2122 42.1 Contig54 p 19373 20170 + 95% SEQ ID No. 1914 39.1 Contig54 p 20125 21258 - 93% SEQ ID No. 1801 37.1 Contig54 p 21218 22264 91% SEQ ID No. 1729 36. 1 Contig54 p 22191 24158 - - 98% SEQ ID No. 1654 35. 1 Contig54 p 24187 25053 + - 98% + SEQ ID No. 1592 34. 1 Contig54 p 25266 26048 + + SEQ ID No. 1522 33.1 Contig54 m 26172 28868 + SEQ ID No. 1323 30.1 Contig54 p 28991 29266 + + SEQ ID No. 1248 29. 1 Contig54 p 29232 29522 + SEQ ID No. 1131 27.1 Contig54 p 29610 30263 + SEQ ID No. 1072 26.1 Contig54 p 30264 31076 + SEQ ID No. 1007 25. 1 Contig54 m 31103 31582 - + SEQ ID No. 933 24.1 Contig54 m 31557 33023 + SEQ ID No. 696 20.1 Contig54 m 32977 33345 + + SEQ ID No. 644 19. 1 Contig54 m 33353 34066 - + SEQ ID No. 580 18.1 Contig54 p 34124 34408 + + SEQ ID No. 446 16.1 Contig54 p 34418 34645 + SEQ ID No. 375 15. 1 Contig54 p 34591 35802 - + SEQ ID No. 254 13.1 Contig54 p 35966 36853 + + SEQ ID NO. 126 11.2 Contig54 p 36783 37802 - + SEQ ID No. 1084 2622. 1 Contig54 p 38133 40073 + SEQ ID No. 1076 2605.3 Contig54 p 40025 42568 + SEQ ID No. 1083 2620.1 Contig54 p 42674 43009 - - 97% SEQ ID No. 1081 2619.1 Contig54 p 42970 43425 + SEQ ID No. 1080 2616. 1 Contig54 43401 44285 + SEQ ID No. 308 139.5 Contig54 44404 48882 + SEQ ID No. 1079 2611.1 Contig54 49022 49240 83% + SEQ ID No. 1078 2609. 2 Contig54 49931 50938 94% + SEQ ID No. 1077 2607. 2 Contig54 51047 52288 + 98% SEQ ID No. 1648 3489. 2 Contig54 52297 53340 94% + SEQ ID No. 432 1582. 2 Contig54 53466 53990 98% SEQ ID No. 431 1581. 4 Contig54 54089 55366 87% + SEQ ID No. 160 1156.3 Contig54 55687 56997 + SEQ ID No. 159 1153.1 Contig54 57180 57608 98% SEQ ID No. 158 1152. 2 Contig54 57786 58682 - 92% SEQ ID No. 1647 3488. 1 Contig54 58908 61016 86% + SEQ ID No. 1646 3486.1 Contig54 61261 61521 + + SEQ ID No 1645 3485.1 Contig54 61495 62223 87% + SEQ ID No. 1644 3484. 1 Contig54 62317 62967 93% + SEQ ID No. 1643 3483. 3 Contig54 63171 63917 92% SEQ ID No. 588 1809.4 Contig54 64253 66679 - 84% SEQ ID No. 1642 3481.2 Contig54 66646 66918 100% SEQ ID No. 1641 3480.4 Contig54 66923 68722 98% SEQ ID No. 3334 833. 3 Contig54 68959 71343 + 93% SEQ ID No. 757 2116.2 Contig54 71452 71955 - 96% SEQ ID No. 2659 499.2 Contig54 72017 73159 97% SEQ ID No. 2667 500. 2 Contig54 73382 74464 + 98% SEQ ID No. 2672 501. 2 Contig54 74623 75396 96% + SEQ ID No. 2677 502.3 Contig54 75598 76065 - + + SEQ ID No 2682 503.3 Contig54 76245 77588 - 98% SEQ ID No. 1435 3161.1 Contig54 77714 78490 - 99% SEQ ID No. 1434 3160. 1 Contig54 78711 79331 - - '87% + SEQ ID No. 90 1049. 2 Contig54 79487 80278 96% SEQ ID No 91 1050.4 Contig54 80420 83893 98% + SEQ ID No. 915 2368.5 Contig54 83988 85529 94% SEQ ID No. 564 1778. 5 Contig54 85555 86043 100% SEQ ID No. 563 1775. 3 Contig54 86468 88030 94% + SEQ ID No 1860 3801.2 Contig54 88195 89649 + - 98% SEQ ID No. 1859 3800.4 Contig54 89808 90146 - - 100% + SEQ ID No. 3307 791.5 Contig54 90299 91600 97% SEQ ID No. 1858 3798. 1 Contig54 91480 91875 99% + SEQ ID No. 1857 3797.1 Contig54 92077 93171 - 96% SEQ ID No. 1856 3796.3 Contig54 93107 93736 - 99% SEQ ID No. 1855 3793.3 Contig54 93867 94790 + 94% SEQ ID No. 1854 3792. 1 Contig54 94897 95136 + + + SEQ ID No. 1853 3791.1 Contig54 95344 96318 - 94% + SEQ ID No. 1852 3789.2 Contig54 96578 97606 98% SEQ ID No. 1851 3788.1 Contig54 97597 98373 - 99% SEQ ID No. 1850 3785. 2 Contig54 98361 99386 - 99% SEQ ID No. ID No. 1849 3784. 2 Con ## STR1 ## 379 1505. 4 Contig54 102899 105229 - 96% + SEQ ID No. 380 1507. 3 Contig54 105338 106840 98% SEQ ID No. 1626 3454. 1 Contig54 106841 107404 - - 91% + SEQ ID No. 1625 3453. 1 Contig54 107695 109209 90% SEQ ID No. 1624 3451. 1 Contig54 109351 110169 95% + SEQ ID No. 1623 3450. 2 Contig54 110251 111336 98% SEQ ID No. 2750 5135. 2 Contig54 111413 112909 - - 93% + SEQ ID No 1035 2545. 2 Contig54 113096 114103 - 90% + SEQ ID No. 1036 2546. 4 Contig54 113946 115451 - 94% SEQ ID No. 1935 3933. 3 Contig54 115898 117001 - 96% + SEQ ID No. 229 1261. 2 Contig54 ## EQU1 ## ID No. 3378 895. 3 Contig54 122576 123634 - 98% SEQ ID No. 3377 8 94. 3 Contig54 123736 124005 - 98% + SEQ ID No. 823 2220. 2 Contig54 124301124963 - 99% SEQ ID No. 821 2219. 2 Contig54 124648 125064 98% SEQ ID No. 2199 4319. 2 Contig54 125030 125764 + 98 % + SEQ ID No. 144 1126. 3 Contig54 125926 127218 - 96% SEQ ID No. 143 1125. 2 Contig54 127188 128384 - - 97% SEQ ID No. 142 1124. 2 Contig54 p 128626 129426 - 97% SEQ ID No. 2198 4316. 4 Contig54 m 129491 131527 97% + SEQ ID No. 2857 5381. 1 Contig54 p 129885 130109 - 100% + SEQ ID No. 2338 4508. 4 Contig54 p 131646 132248 - 98% SEQ ID No. 129 1105. 2 Contig54 m 132369 134687 - 96% SEQ ID No. 2129 4211. 2 Contig54 m 134827 136197 - 92% SEQ ID No. 2130 4212. 1 Contig54 p 136221 137318 97% SEQ ID No. 151 1137. 2 Contig54 p 137371 137796 - - 98% + SEQ ID No. 150 1136. 3 Contig54 p 137907 139430 + - 99% SEQ ID No. 2131 4214. 3 Contig54 p 139523 141115 - 96% SEQ ID No. 2886 544. 2 Contig54 p 141103 142440 - 96% SEQ ID No. 2883 543. 1 Contig54 p 142846 143115 - - 100% + SEQ ID No. 985 2468. 2 Contig54 m 143553 144497 97% SEQ ID No. 986 2469. 2 Contig54 m 144767 146230 - 99% SEQ ID No. 988 2471. 3 Contig54 p 146263 147339 - 98% SEQ ID No. 599 1832. 4 Contig54 p 147324 147938 98% SEQ ID No. 598 1831. 3 Contig54 p 147869 149143 - 97% SEQ ID No. 1815 3721. 1 Contig54 p 149133 149618 - 100% SEQ ID No. 1633 3465. 2 Contig54 p 149702 151381 + 100% SEQ ID No. 1632 3463 1 Contig54 p 151330 152202 100% SEQ ID No. 1631 3461. 4 Contig54 p 152359 154266 - 97% + SEQ ID No. 865 2293. 5 Contig54 p 154352 156745 - 97% SEQ ID No. 322 1409. 3 Contig54 p 157120 157902 + 99% + SEQ ID No. 324 1410. 2 Contig54 m 158050 158997 98% + SEQ ID No. 1629 3459. 3 Contig54 m 159106 160590 98% SEQ ID No. 1628 3456. 4 Contig54 m 160503 161009 + + SEQ ID No. 1627 3455. 3 Contig54 m 161013 162041 97% + SEQ ID No. 449 1602. 2 Contig54 p 162071 163246 97% SEQ ID No. 448 1601. 3 Contig54 p 163332 164519 + 98% SEQ ID No. 2813 5282. 3 Contig54 p 164626 164874 + SEQ ID No. 3135 6019. 1 Contig54 p 164875 165402 - 98% SEQ I D-1844 3771. 2 Contig54 m 165491 166123 99% SEQ ID No. 3347 854. 3 Contig54 m 166111 166785 96% SEQ ID No. 3050 5780. 1 Contig54 m 166583 166912 - + SEQ ID No. 3346 853. 1 Contig54 m 166885 167625 - 98% SEQ ID No. 3345 852. 3 Contig54 m 167598 168224 - 98% SEQ ID No. 1845 3772. 2 Contig54 m 168194 169255 97% + SEQ ID No. 127 1101. 4 Contig54 m 169230 170324 97% SEQ ID No. 128 1102. 2 Contig54 m 170325 171641 96% SEQ ID No. 843 2255. 2 Contig54 m 171626 172522 96% SEQ ID No. 1846 3778. 2 Contig54 m 172504 172809 98% SEQ ID No. 2947 5550. 3 Contig54 p 173129 174709 98% SEQ ID No. 2948 5552. 2 Contig54 p 174713 175861 99% SEQ ID No. 2275 4409. 1 Contig54 m 176087 176728 100% SEQ ID No. 2274 4408. 1 Contig54 m 176920 177180 98% + SEQ ID No. 2273 4407. 1 Contig 54 p 176950 177201 + SEQ ID No. 2272 4406. 1 Contig54 p 177700 178284 99% SEQ ID No. 2271 4405. 1 Contig54 p 178381 178899 98% SEQ ID No. 2270 4404. 1 Contig54 m 178929 179393 94% SEQ ID No. 2269 4403. 2 Contig54 p 179417 180214 9 1% SEQ ID No. 2268 4402. 2 Contig54 p 180142 180759 92% SEQ ID No. 1070 2598. 3 Contig54 m 180883 181581 + 97% SEQ ID No. 2741 5115. 2 Contig54 p 181805 182791 99% SEQ ID No. 2742 5116. 3 Contig54 p 182843 183412 97% SEQ ID No. 2949 5554. 2 Contig54 p 183792 184052 + + SEQ ID No. 3134 6018. 1 Contig54 m 184053 184367 + + SEQ ID No. 2785 5217.1 Contig55 p 45 509 + SEQ ID No. 1107 2659.2 Contig55 p 502 996 + SEQ ID No. 1108 2660. 1 Contig55 p 983 1276 + SEQ ID No. 1109 2661.2 Contig55 p 1221 1838 + + SEQ ID No. 1110 2662.2 Contig55 p 1823 2554 + + + SEQ ID No 2574 485. 3 Contig55 p 2536 4023 + + SEQ ID No. 2580 486.2 Contig55 p 3956 4243 + SEQ ID No. 1032 254.2 Contig 55 p 4093 6849 + SEQ ID No. 1038 255 1 Contig55 p 6821 7174 + + SEQ ID No. 1045 256.1 Contig55 p 7135 7797 + SEQ ID No. 1058 258.2 Contig55 p 7683 8804 + SEQ ID No. 698 2006. 2 Contig55 p 8818 9483 + SEQ ID No. 280 1344.3 Contig55 p 9401 10501 + + SEQ ID No 2786 5219.1 Contig55 p 10464 11285 + SEQ ID No. 279 1342. 3 Contig55 p 11279 12070 + SEQ ID No. 722 2051.2 Contig55 p 12067 12564 SEQ ID No. 253 1299.3 Contig55 p 12561 13958 + SEQ ID No. 3010 567. 5 Contig55 p 13877 16723 + + SEQ ID No. 818 2212. 4 Contig55 p 16754 18805 + + SEQ ID No. 445 1599. 4 Contig55 p 18806 24001 + SEQ ID No. 2787 5220.1 Contig55 p 23872 24702 SEQ ID No. 1111 2665.1 Contig55 p 24873 25163 + SEQ ID No. 1112 2666. 1 Contig55 m 25296 25622 + SEQ ID No. 1113 2667.1 Contig55 m 25607 26068 + SEQ ID No. 3255 717.2 Contig55 p 26412 26885 SEQ ID No. 3254 716. 1 Contig55 p 26900 27130 + SEQ ID No. 3253 715.1 Contig55 p 27284 27616 + SEQ ID No 3252 713.2 Contig 55 p 27686 28033 + SEQ ID No. 3069 5844. 1 Contig55 m 28321 28734 SEQ ID No. 2320 4483.2 Contig55 m 28848 29474 + SEQ ID No. 2319 4482.1 Contig55 p 29686 30615 SEQ ID No. 2318 4481. 1 Contig55 ## EQU5 ## g55 p 36168 37979 SEQ ID No. 3301 783.2 Contig55 m 38018 38377 SEQ ID No. 3302 785. 4 Contig55 m 38404 39363 + SEQ ID No. 3070 5846.2 Contig55 m 39236 39436 + SEQ ID No. 1751 3631.4 Contig55 m 39466 39723 + SEQ ID No. 3133 6016. Contig55 m 39777 40088 SEQ ID No. 3132 6015.1 Contig55 p 40166 40540 + SEQ ID No. 2739 5113.3 Contig55 p 40350 40982 + SEQ ID No. 2740 5114. 3 Contig55 p 40999 41910 + SEQ ID No. 1420 3138.2 Contig55 p 41939 42838 + SEQ ID No. 1419 3137.1 Contig55 p 42851 43375 + + SEQ ID No. 1418 3136. 1 Contig55 p 43426 43785 SEQ ID No. 3313 799.3 Contig55 p 43996 45474 + SEQ ID No. 3312 798.2 Contig55 p 45371 47254 + SEQ ID No. 3311 796. 2 Contig55 p 47244 48029 SEQ ID No. 745 2087.2 Contig55 p 48030 48989 + SEQ ID No. 803 2180.2 Contig55 p 48956 50470 SEQ ID No. 1417 3135. 1 Contig55 p 50443 50679 SEQ ID No. 1416 3134.1 Contig55 p 50672 51244 SEQ ID No. 554 1762.2 Contig55 p 51309 52265 SEQ ID No. 553 1761. 4 Contig55 p 52416 55592 SEQ ID No. 426 1575.2 Contig55 p 55896 56345 SEQ ID No. 1553 3346.2 Contig55 p 56297 58270 SEQ ID No. 1554 3347. 1 Contig55 p 58332 59138 + SEQ ID No. 1555 3348.2 Contig55 p 59139 60737 SEQ ID No. 1556 3349.3 Contig55 p 60738 61637 SEQ ID No. 1558 3350 3 Contig 55 p 61771 62142 SEQ ID No. 1559 3351.3 Contig55 p 62162 63334 + SEQ ID No. 1560 3352.1 Contig55 m 63363 63833 SEQ ID No. 1561 3353. 1 Contig55 p 63922 65490 + SEQ ID No. 1562 3354.1 Contig55 p 65511 66116 + SEQ ID No. 3426 960.2 Contig55 p 66059 66436 SEQ ID No. 3424 959. 2 Contig55 p 66489 66674 + SEQ ID No. 3423 957.2 Contig55 m 66768 67700 SEQ ID No. 3422 956.2 Contig55 m 67701 68516 SEQ ID No. 1563 3355 2 Contig55 m 68675 69007 SEQ ID No. 1564 3356.2 Contig55 m 68952 69212 SEQ ID No. 1565 3357.2 Contig55 m 69452 69934 + SEQ ID No. 2757 5154. 2 Contig55 m 70538 71368 SEQ ID No. 2756 5153.1 Contig55 m 71343 71813 + SEQ ID No. 1054 2573.3 Contig55 m 71767 72372 SEQ ID No. 1241 2881. 2 Contig55 m 72633 73565 + SEQ ID No. 1240 2879.3 Contig55 m 73627 74961 + SEQ ID No. 1239 2878.2 Contig 55 p 75141 75842 SEQ ID No. 290 1362. 3 Contig55 p 76079 77905 + SEQ ID No. 291 1364.2 Contig55 m 77909 79549 + SEQ ID No. 1238 2877.2 Contig55 m 79612 80280 SEQ ID No. 800 2175. 3 Contig55 m 80356 80577 SEQ ID No. 799 2174.1 Contig55 m 80578 80886 SEQ ID No. 110 1078.2 Contig55 81022 82008 + SEQ ID No. 109 1077. 1 Contig55 82086 82808 + SEQ ID No. 108 1076.3 Contig55 82869 83252 + SEQ ID No 798 2173.2 Contig55 83159 83683 + SEQ ID No. 797 2172. 2 Contig55 83680 84168 + SEQ ID No. 1237 2874.1 Contig55 84158 84934 + SEQ ID No. 1236 2873.1 Contig55 84965 85960 + SEQ ID No. 3285 761. 2 Contig55 85953 86924 + + SEQ ID No. 3286 762.2 Contig55 86954 87676 + + + SEQ ID No. 3287 764.1 Contig55 87747 88268 + + SEQ ID No. 3288 765. 1 Contig55 88340 89080 + SEQ ID No. 3289 766.3 Contig55 89231 90691 + + + SEQ ID No. 3371 886.3 Contig 55 90736 91527 + SEQ ID No. 3370 885. 2 Contig 55 91494 93173 + SEQ ID No. 3369 884.3 Contig 55 93167 94135 + SEQ ID No. 2367 4549.2 Conti ## STR1 ## No. 2754 5151.1 Contig55 98262 99167 + SEQ ID No. 610 1848.4 Contig55 99168 100433 + SEQ ID No. 611 1849. 3 Contig55 100339 100893 + SEQ ID No. 613 1852.2 Contig55 100904 101302 + + SEQ ID No. 392 1522.2 Contig55 101257 102432 SEQ ID No. 393 1523. 2 Contig 55 102483 102815 + SEQ ID No. 394 1524. 3 Contig 55 102816 103892 + SEQ ID No. 844 2258.2 Contig55 104112 105362 + SEQ ID No. 846 2260.2 Contig55 105337 106014 + + SEQ ID No. 1344 3030. 2 Contig 55 106015 106557 + SEQ ID No. 1345 3031.2 Contig55 106523 106960 + SEQ ID No. 1346 3035.2 Contig55 107019 107624 + SEQ ID No. 3215659.

  2 Contig55 107629 108609 + SEQ ID No. 3216 660.1 Contig55 108579 109169 + SEQ ID No. 3217 661.3 Contig55 109132 110268 + SEQ ID No. 1347 3036.2 Contig55 m 110272 110826 - SEQ ID No. 801 2176.3 Contig55 m 110897 111364 SEQ ID No. 802 2177. 2 Contig55 p 111374 112039 SEQ ID No. 3265 737.1 Contig55 m 112373 113413 SEQ ID No. 3266 738.2 Contig55 m 113352 113906 SEQ ID No. 3267 739. 4 Contig55 m 113977 114864 SEQ ID No. 2634 4947. 2 Contig55 p 115163 116416 SEQ ID No. 2633 4945. 2 Contig55 p 116406 117425 SEQ ID No. 2719 5078. 2 Contig55 p 117433 118752 + SEQ ID No. 2721 5081. 3 Contig55 p 118891 119469 + SEQ ID No. 2720 5080. 4 Contig55 p 119493 120956 SEQ ID No. 2737 5106. 3 Contig55 m 120958 122001 + SEQ ID No. 2738 5108. 2 Contig55 p 122110 122373 SEQ ID No. 2753 5147. 1 Contig55 p 122374 123642 + SEQ ID No. 1656 3500. 3 Contig55 p 123593 124777 SEQ ID No. 1653 3499. 1 Contig 55 p 124882 125178 + SEQ ID No. 205 1226. 2 Contig 55 p 125159 126205 SEQ ID No. 204 1225. 2 Contig 55 p 126202 127 263 + SEQ ID No. 856 2275. 3 Contig55 p 127253 128290 + SEQ ID No. 857 2277. 2 Contig55 p 128618 128899 SEQ ID No. 171 1171. 3 Contig55 p 128900 129670 + SEQ ID No. 172 1172. 2 Contig55 p 129671 130108 + SEQ ID No. 1652 3498. 1 Contig55 p 130156 130584 + + SEQ ID No. 3186 616. 4 Contig55 p 130624 131685 SEQ ID No. 3100 591.3 Contig55 p 131637 132476 SEQ ID No. 2834 5328.1 Contig55 m 132518 133048 SEQ ID No. 2127 4209. 2 Contig55 m 133049 134221 + SEQ ID No. 868 2298. 2 Contig55 m 134262 135566 95% SEQ ID No. 79 1035. 3 Contig55 p 136010 137455 97% SEQ ID No. 2311 4473. 4 Contig55 m 137527 138237 99% SEQ ID No. 2312 4474. 1 Contig55 m 138206 138715 100% SEQ ID No. 2313 4475. 1 Contig55 p 138772 139452 98% SEQ ID No. 2314 4477. 2 Contig55 p 139582 142005 98% + SEQ ID No 2315 4479. 2 Contig 55 p 142158 142640 99% SEQ ID No. 2317 4480. 4 Contig55 m 142691 143992 97% SEQ ID No. 2727 5090. 2 Contig55 143953 145032 - 99% SEQ ID No. 2725 5088. 2 Contig55 145313 145738 + SEQ ID No. 3006 5660.1 C ontig55 145939 146925 + SEQ ID No. 2701 5056.2 Contig55 147059 147427 + SEQ ID No. 2702 5058. 2 Contig55 147683 147949 SEQ ID No. 2703 5059.3 Contig55 147915 148292 + SEQ ID No. 3136 602.4 Contig55 148411 149406 98% SEQ ID No. 3142 604. 3 Contig 55 149566 150327 96% SEQ ID No. 2414 4623. 2 Contig 55 150381 150938 94% SEQ ID No. 2700 5054. 2 Contig 55 150905 151864 95% SEQ ID No. 1982 4004. 2 Contig 55 151865 153652 98% SEQ ID No. 1981 4003. Contig55 153639 155102 96% SEQ ID No. 202 1223. 2 Contig55 155439 156341 80% SEQ ID No. 203 1224. 2 Contig55 156401 157246 + 97% SEQ ID No. 1980 4002. 2 Contig55 157251 159182 + 95% SEQ ID No. 1979 4000. 2 Contig 55 159161 159628 97% SEQ ID No. 2192 4307. 2 Contig 55 159772 161094 95% + SEQ ID No. 847 2261. 3 Contig55 161261 162034 93% + SEQ ID No. 124 1098. 3 Contig55 162153 163196 97% SEQ ID No. 125 1099. 2 Contig55 163387 164445 94% SEQ ID No. 2191 4305. 2 Contig55 164470 164892 90% + SEQ ID No. 2962 5582. 4 Contig55 165100 167310 94% SEQ ID No. 2041 4088. 2 Contig55 167432 168376 97% SEQ ID No. 2040 4087. 2 Contig55 168470 169795 97% SEQ ID No. 134 1111. 3 Contig55 169738 170574 98% SEQ ID No. 132 1109. 3 Contig55 170559 171554 97% SEQ ID No 131 1107. 2 Contig 55 171541 172536 97% SEQ ID No. 2039 4084. 2 Contig55 172650 173840 97% SEQ ID No. 2038 4083. 3 Contig55 173810 174493 98% + SEQ ID No. 427 1577. 5 Contig55 174673 177582 95% SEQ ID No. 2210 4332. 1 Contig55 177722 178267 98% SEQ ID No. 2211 4333. 1 Contig55 178294 179169 95% SEQ ID No. 2212 4334. 1 Contig55 179170 180063 98% SEQ ID No. 2213 4336. 2 Contig55 180168 181493 100% SEQ ID No. 2421 4632. 1 Contig 55 181506 182885 99% + SEQ ID No. 2422 4633. 2 Contig 55 P 182895 183470 100% SEQ ID No. 2423 4634. 2 Contig55 m 183488 185485 - 97% SEQ ID No. 2112 4181. 1 Contig55 m 185668 186306 - + + SEQ ID No. 903 2354. 2 Contig55 m 186307 186954 - - 99% SEQ ID No. 543 1748. 3 Contig55 m 187301 188650 - 96% SEQ ID No. 544 1749. 2 Contig55 m 188742 189518 91% SEQ ID No. 2110 4179. 2 C ontig55 m 189807 191867 - + + SEQ ID No. 252 1295. 1 Contig55 m 191978 192574 + 96% SEQ ID No. 251 1294. 2 Contig55 m 192553 193086 - 98% SEQ ID No. 250 1293. 4 Contig55 m 193087 193707 + _ 96% SEQ ID No. 2214 4337. 3 Contig55 m 193708 194001 + 97% SEQ ID No. 2215 4338. 3 Contig55 m 194087 194995 - 97% SEQ ID No. 2216 4339. 1 Contig55 m 194986 196857 - - 97% SEQ ID No. 2218 4340. 2 Contig55 m 196896 198794 97% SEQ ID No. 2859 5386. 1 Contig55 m 198790 199812 - 97% SEQ ID No. 2532 4786. 2 Contig55 m 199797 201254 + - 98% SEQ ID No. 2531 4785 1 Contig55 m 201664 202824 - 96% + SEQ ID No. 2506 4751. 2 Contig55 m 202977 204695 97% SEQ ID No. 387 1516. 3 Contig55 m 204692 205651 96% SEQ ID No. 386 1515. 2 Contig55 P 205797 206564 - 96% SEQ ID No. 385 1513. 4 Contig 55 p 206522 207880 + 98% SEQ ID No. 2679 5022. 2 Contig 55 p 207980 209053 - 99% SEQ ID No. 1967 3988. 3 Contig55 p 209183 210673 - - 96% SEQ ID No. 1966 3986. 1 Contig55 m 210767 211888 - 97% SEQ ID No. 1965 3985. 1 Contig55 P 21 2031 212642 99% SEQ ID No. 3348 856. 2 Contig55 P 212770 213318 - 97% + SEQ ID No. 3349 857. 2 Contig55 m 213377 215725 + - 98% SEQ ID No. 2612 4908. 3 Contig55 p 215762 221632 + 98 % SEQ ID No. 1974 3996. 2 Contig 55 m 219910 220161 - 93% + SEQ ID No. 494 1671. 3 Contig 55 m 221880 223283 + 96% + SEQ ID No. 1973 3995. 5 Contig55 m 223444 224850 - 98% SEQ ID No. 1972 3994. 5 Contig 55 m 224983 225843 - - 98% SEQ ID No. 1971 3993. 2 Contig 55 p 226063 226629 - 87% + SEQ ID No. 3372 887. 4 Contig55 m 226955 229195 - 99% SEQ ID No. 3028 5711. 2 Contig 55 p 229465 230373 - 98% + SEQ ID No. 2772 5193. 2 Contig 55 p 230456 232594 - 97% SEQ D No. 1938 3938. 2 Contig55 m 232591 233181 98% SEQ ID No. 1937 3937. 2 Contig55 m 233166 234512 98% SEQ ID No. 854 2272. 3 Contig55 m 234482 235996 99% SEQ ID No. 855 2274. 2 Contig55 m 236004 237023 99% SEQ ID No. 1936 3936. 2 Contig55 m 236965 238269 99% SEQ ID No 684 1972. 3 Contig55 m 238224 239414 99% SEQ ID No. 1186 278. 3 Contig55 m 239267 241183 98% S EQ ID No. 2773 5194. Contig55 m 241056 241625 + SEQ ID No. 1178 277. Contig55 m 241772 242491 100% SEQ ID No. 1171 276. 1 Contig55 m 242556 242792 100% SEQ ID No. 547 1754. 3 Contig55 m 243052 244590 98% SEQ ID No. 548 1755. 3 Contig55 m 244529 244864 98% + SEQ ID No. 549 1756. 4 Contig55 m 244943 245797 98% SEQ ID No. 1114 2669. 2 Contig55 m 246338 247576 99% + SEQ ID No. 1116 2670. Contig 55 m 247577 248836 99% SEQ ID No. 1117 2671. 1 Contig 55 p 248990 249631 97% SEQ ID No. 1118 2674. 1 Contig 55 p 249701 252391 99% + SEQ ID No. 1119 2677. 2 Contig55 P 252653 254050 + 100% SEQ ID No. 3344 847. 4 Contig55 m 254244 257435 99% SEQ ID No. 1121 2680. 1 Contig55 p 257935 258630 + 99% SEQ ID No. 518 1708. 4 Contig55 p 259050 259427 99% SEQ ID No. 519 1709. Contig55 m 259455 260177 98% SEQ ID No. 520 1711. Contig55 m 260134 260889 99% SEQ ID No. 864 2292. Contig55 P 261111 262802 95% + SEQ ID No. 1122 2682. 1 Contig55 p 262935 264578 93% + SEQ ID No. 80 1036. 4 Contig55 m 264665 26 6002 98% SEQ ID No. 81 1037. 1 Contig55 m 265921 266478 100% SEQ ID No. 82 1039. 2 Contig55 p 266605 267834 95% SEQ ID No. 777 2144. 3 Contig55 P 267780 268817 91% SEQ ID No. 1123 2683. 3 Contig 55 p 268818 270377 96% SEQ ID No. 2774 5195. 2 Contig55 p 270293 271729 98% SEQ ID No. 1124 2685. 2 Contig55 p 271681 272466 98% + SEQ ID No. 2492 4732. 3 Contig55 m 272544 272921 97% SEQ ID No. 540 1743. 4 Contig55 m 273331 273900 99% SEQ ID No. 539 1742. 3 Contig55 273878 274645 - 98% SEQ ID No. 2493 4733. 2 Contig55 274618 275526 98% SEQ ID No. 2665 4999. 2 Contig55 275562 276383 - 99% SEQ ID No. 2668 5000. 3 Contig55 276648 277070 + 98% SEQ ID No. 2669 5001. 1 Contig55 277565 278038 99% + SEQ ID No. 2820 5307. 3 Contig55 278103 279803 97% SEQ ID No. 1970 3991. 3 Contig 55 280182 281885 95% SEQ ID No. 3336 837. 2 Contig55 281957 282727 100% SEQ ID No. 3335 835. 2 Contig55 282705 285299 99% SEQ ID No. 1968 3989. 1 Contig55 285321 285770 99% SEQ ID No. 195 1210. 2 Contig55 285761 287344 97% SEQ ID No. 193 1209. 2 Contig55 287341 288849 100% SEQ ID No. 192 1208. 1 Contig55 288191 288577 99% SEQ ID No. 2821 5309. 1 Contig55 288995 289852 100% SEQ ID No. 1016 2514. 3 Contig55 289828 290118 100 % SEQ ID No. 3376 893. 4 Contig 55 290434 292959 + 99% SEQ ID No. 2310 4472. 2 Contig 55 293013 293819 99% SEQ ID No. 2501 4744. 3 Contig55 293795 294718 98% SEQ ID No. 378 1503. 4 Contig55 294663 295850 97% SEQ ID No. 377 1501. 3 Contig55 295754 296599 + 98% SEQ ID No. 928 2388. 3 Contig55 296578 297459 97% SEQ ID No. 927 2387. 3 Contig55 297507 298577 99% SEQ ID No. 154 1144 3 Contig55 298751 300040 99% SEQ ID No. 155 1145. 3 Contig55 300027 302186 97% SEQ ID No. 2823 5311. 1 Contig55 302427 302744 100% SEQ ID No. 2044 4094. 2 Contig55 302741 304198 97% SEQ ID No. 2043 4093. 1 Contig 55 304199 305635 98% SEQ ID No. 893 2343. 2 Contig 55 305819 306838 98% SEQ ID No. 894 2344. 4 Contig 55 306980 309283 97% SEQ ID No. 2906 5478. 2 Contig 55 309284 309784 88% SEQ ID No. 136 1115. 4 Contig55 309795 310592 97% SEQ ID No. 135 1113. 2 Contig55 310647 311045 96% SEQ ID No. 2610 4902. 1 Contig55 310700 311026 + SEQ ID No. 2905 5477. 1 Contig55 311164 311460 100% SEQ ID No. 2904 5476. 1 Contig55 311846 312241 98% SEQ ID No. 1698 3556. 2 Contig55 m 312219 312647 97% SEQ ID No. 1699 3557. 1 Contig55 m 312599 313828 98% SEQ ID No. 2168 427. 3 Contig55 m 313737 314516 - 99% SEQ ID No 2173 428. 1 Contig55 p 314611 315411 100% SEQ ID No. 2180 429. 2 Contig55 m 315524 316543 98% SEQ ID No. 748 2092. 2 Contig55 p 316557 319145 99% SEQ ID No. 747 2091. Contig55 m 316811 317566 97% SEQ ID No. 1700 3558. 1 Contig55 m 317987 318523 98% + SEQ ID No. 1701 3559. 2 Contig55 m 319237 320562 97% + SEQ ID No. 635 1886. 2 Contig55 m 320563 321231 - 99% + SEQ ID No. 634 1885. 3 Contig 55 m 321503 322891 + 99% SEQ ID No. 2432 4649. Contig55 m 322872 323477 96% + SEQ ID No. 2434 4650 Contig55 m 323544 327368 + 98% + SEQ ID No. 2164 4262. 2 Contig55 m 327355 327813 - 98% SEQ ID No. 1039 2550. 2 Contig 55 m 327807 329195 98% SEQ ID No. 1040 2551. 2 Contig55 m 329159 329809 97% SEQ ID No. 1041 2553. 3 Contig55 m 329939 330940 100% SEQ ID No. 2162 4259. 2 Contig55 m 330931 331806 97% SEQ ID No. 1784 3674. Contig55 m 331754 332569 + SEQ ID No. 1785 3675. Contig55 m 332739 333086 98% SEQ ID No. 1786 3676 2 Contig55 m 333068 334462 99% SEQ ID No. 1787 3679. 3 Contig55 m 334405 335460 99% SEQ ID No. 2979 561. 3 Contig55 m 335735 337042 - 97% SEQ ID No. 2983 562. 1 Contig55 m 337055 337672 + 99% SEQ ID No. 3130 6007. 1 Contig55 p 337580 337705 100% + SEQ ID No. 2,994,564. Contig55 m 337666 340092 98% SEQ ID No. 1789 3680. 1 Contig 55 p 339922 341073 + 98% SEQ ID No. 1790 3681. 1 Contig 55 p 341052 341744 - 97% SEQ ID No. 1791 3682. 1 Contig55 P 341754 342179 - 95% SEQ ID No. 1792 3683. 2 Contig55 p 342284 342532 100% SEQ ID No. 2817 5295. 1 Contig55 m 342696 344141 99% SEQ ID No. 972 2448. 3 Contig55 p 344088 344876 + 97% SEQ ID No. 971 2447. 3 Contig55 p 345075 346076 98% SEQ ID No. 97 0 2445. 4 Contig 55 p 346267 349176 - 99% SEQ ID No. 2539 4797. 1 Contig55 p 349121 350293 - 99% SEQ ID No. 2538 4796. 1 Contig55 350604 351089 + 96% SEQ ID No. 2537 4795. 1 Contig55 350815 351099 87% + SEQ ID No. 1983 4005. 2 Contig55 351176 352696 99% SEQ ID No. 1984 4009. 1 Contig55 352663 353715 99% SEQ ID No. 1986 4010. 1 Contig55 353830 354234 100% + SEQ ID No. 1987 4012 1 Contig 55 354228 355055 98% SEQ ID No. 1988 4013. 1 Contig55 355006 355788 100% SEQ ID No. 1989 4014. 1 Contig55 355789 356577 99% SEQ ID No. 1990 4015. 1 Contig55 356602 357495 99% SEQ ID No. 1991 4016. 1 Contig55 357458 358642 98% SEQ ID No. 1992 4017. 4 Contig55 358638 360716 99% SEQ ID No. 2848 5361. 2 Contig55 360713 361897 99% SEQ ID No. 2847 5360. 2 Contig55 361044 361610 99% + SEQ ID No. 1066 2592. 4 Contig55 361844 362254 97% + SEQ ID No. 1067 2593. 3 Contig55 361861 362634 99% SEQ ID No. 2680 5026. Contig55 362635 362964 + 98% SEQ ID No. 1068 2595. 4 Contig55 362913 363662 + 97% SEQ ID No. 2845 5359. 2 Contig55 363663 364091 98% SEQ ID No. 2352 4526. 3 Contig55 364070 364414 96% SEQ ID No. 434 1585. 2 Contig55 364415 365494 95% SEQ ID No. 435 1586. 2 Contig55 365921 366190 + 100% + SEQ ID No. 436 1587. 4 Contig55 366186 367574 97% SEQ ID No. 2171 4275. 2 Contig55 367445 368293 + 97% SEQ ID No. 2170 4273. 1 Contig55 368190 369320 97% SEQ ID No. 876 2313. 2 Contig55 369399 370625 96% SEQ ID No. 875 2312. 1 Contig55 370829 371116 98% + SEQ ID No. 874 2311. 4 Contig55 371117 373702 98% SEQ ID No. 627 1873. 2 Contig55 373717 374169 100% SEQ ID No. 626 1871. 2 Contig55 374162 375211 100% SEQ ID No. 2428 4643. 2 Contig55 375511 376461 99% + SEQ ID No. 2427 4642. 1 Contig55 376740 377243 98% + SEQ ID No. 3101 5910. 1 Contig55 377311 377523 98% + SEQ ID No. 2426 4640. 2 Contig55 377831 380395 99% SEQ ID No. 1994 4020. 2 Contig55 380396 382096 99% SEQ ID No. 3332 830. 4 Contig55 382039 384633 95% + SEQ ID No. 3333 832. 3 Contig55 p 384667 385662 - 94% SEQ ID No. 3041 5747. 1 Contig55 p 3857 87 386191 + 96% + SEQ ID No. 678 1955. 3 Contig55 m 386532 388040 + 92% SEQ ID No. 885 2328. 2 Contig55 p 388278 390869 99% + SEQ ID No. 1501 3269. 1 Contig55 p 390859 394104 - 98 % SEQ ID No. 960 2430. 2 Contig55 p 394309 395385 99% SEQ ID No. 1500 3267. 1 Contig55 p 395435 396055 99% + SEQ ID No. 1499 3265. Contig55 m 396103 396999 98% SEQ ID No. 1498 3263 2 Contig 55 p 397202 398425 - 98% SEQ ID No. 1497 3260. 2 Contig55 m 398427 399434 + 99% + SEQ ID No. 467 1633. 2 Contig55 m 399379 400365 - 99% SEQ ID No. 466 1632. 3 Contig55 m 400350 402146 + 99% SEQ ID No. 2811 5278. 3 Contig55 m 402203 403054 - 99% + SEQ ID No. 2810 5277. 3 Contig55 m 403006 404235 100% SEQ ID No. 1371 3070. 2 Contig55 m 404293 405312 + 100% + SEQ ID No. 1369 3069. Contig55 m 405340 406062 - 99% SEQ ID No. 1368 3068. Contig55 p 406331 407521 - 100% SEQ ID No. 1031 2538. 2 Contig55 p 407509 408717 100% SEQ ID No. 1367 3067. 1 Contig 55 p 408846 409169 100% SEQ ID No. 3015 568.

  2 Contig55 p 409176 410786 - 99% SEQ ID No. 3020 569. 2 Contig55 p 410743 411600 99% SEQ ID No. 3027 571. 2 Contig55 p 411503 413557 - 97% SEQ ID No. 699 2007. 1 Contig55 p 413535 414476 - 100% SEQ ID No. 145 1127. 3 Contig55 p 414552 416573 - 98% SEQ ID No. 1366 3065. 1 Contig55 m 416733 417197 96% SEQ ID No. 1365 3063. 2 Contig55 p 417443 418627 99% SEQ ID No. 1364 3061. 2 Contig 55 p 418602 419252 99% SEQ ID No. 1363 3060. 1 Contig55 m 418655 419038 96% + SEQ ID No. 1361 3059. 2 Contig55 p 419253 420044 + 99% SEQ ID No. 95 1058. 3 Contig 55 p 420079 421542 98% + SEQ ID No. 94 1056. 1 Contig 55 p 421787 422035 100% + SEQ ID No. 93 1055. Contig55 m 422032 422802 97% SEQ ID No. 92 1053. Contig55 m 422766 423317 99% SEQ ID No 521 1713. 2 Contig55 m 423302 425392 97% SEQ ID No. 522 1714. 4 Contig55 m 425358 426290 - 100% SEQ ID No. 579 1797. 4 Contig55 m 426498 427307 + 100% SEQ ID No. 582 1800. 4 Contig55 m 427491 429701 98% SEQ ID No. 2277 4419. 2 Contig55 P 429883 430851 99% SEQ ID No. 2,899,546. 1 Contig 55 p 430842 431012 + SEQ ID No. 2900 5470. 1 Contig 55 p 430963 431283 100% SEQ ID No. 228 1260. 3 Contig 55 p 431468 432283 + 100% SEQ ID No. 226 1258. 1 Contig55 m 432392 433441 97% SEQ ID No. 225 1257. 5 Contig55 m 433351 434646 99% SEQ ID No. 3129 6004. 1 Contig55 m 434692 434850 + SEQ ID No. 2901 5471. 2 Contig55 m 434805 435017 + SEQ ID No. 3099 5907. 1 Contig55 m 434953 435111 SEQ ID No. 3040 5743. 1 Contig55 m 435125 435313 + SEQ ID No. 2895 5458.1 Contig56 m 1 294 + SEQ ID No. 1829 3744.2 Contig56 p 629 1834 + + SEQ ID No. 1828 3743 1 Contig56 m 1999 2334 + 96% + SEQ ID No. 1827 3742. 1 Contig56 m 2352 2624 92% + SEQ ID No. 1826 3741. 1 Contig56 m 2635 3855 98% + SEQ ID No. 1825 3740. 3 Contig56 m 4089 4625 100% SEQ ID No. 1823 3739. 3 Contig56 p 4848 5291 99% SEQ ID No. 1822 3737.1 Contig56 p 5344 6447 + 94% + SEQ ID No. 113 1082.3 Contig56 m 6468 8033 + SEQ ID No. 357 1469. 4 Contig56 m 8879 12292 + + SEQ ID No. 2197 4312. 2 Contig56 m 12373 13725 9 8% SEQ ID No. 2196, 4311. 1 Contig56 P 13958 14506 96% SEQ ID No. 2195 4310. 1 Contig56 m 14610 15161 97% + SEQ ID No. 2193 4309. 2 Contig56 m 15077 16219 97% + SEQ ID No 2010 4047. 3 Contig56 m 16291 17385 + 99% SEQ ID No. 2011 4048. 3 Contig56 p 17493 19334 100% SEQ ID No. 2013 4050. 1 Contig56 P 19403 20197 + 98% SEQ ID No. 2014 4051. 2 Contig56 p 20206 20601 + 98% SEQ ID No. 2015 4054. 2 Contig56 p 20585 21265 99% SEQ ID No. 2016 4055. 1 Contig56 m 21293 23185 + + SEQ ID No. 2017 4056. 2 Contig56 m 23266 24495 99% SEQ ID No. 2018 4058. 2 Contig56 m 24583 24942 + + SEQ ID No. 472 1641. 5 Contig56 p 25345 26694 98% SEQ ID No. 473 1642. 3 Contig56 p 26679 27341 - 100% SEQ ID No. 2465 4699. 3 Contig56 p 27452 28756 99% SEQ ID No. 2340 4510. 1 Contig56 p 28978 31440 100% SEQ ID No. 2341 4511. 1 Contig56 p 31527 31847 98% + SEQ ID No. 2342 4512. 4 Contig56 p 32084 33979 98% SEQ ID No. 572,177. 4 Contig56 p 34519 37686 + + SEQ ID No. 1678 3530. 1 Contig56 m 37969 38598 + + SEQ ID No. 16 79 3532. 1 Contig 56 p 38652 41942 + SEQ ID No. 368 1487. 3 Contig 56 m 42394 43230 99% + SEQ ID No. 1680 3533. 1 Contig 56 m 43296 44021 + 99% SEQ ID No. 1681 3534. 2 Contig56 m 43987 45666 + 99% SEQ ID No. 1682 3535. 5 Contig56 p 45982 46656 95% + SEQ ID No. 1683 3536. 2 Contig56 m 46690 47052 98% SEQ ID No. 2732 5098. 2 Contig56 m 47027 47311 100% SEQ ID No. 2731 5097. Contig56 m 47312 48241 + 99% SEQ ID No. 3128 6002. 1 Contig56 p 48661 49746 SEQ ID No. 3125 5999. 1 Contig56 p 49760 50065 100% SEQ ID No. 2480 4715. 3 Contig56 p 50326 50817 95% SEQ ID No. 2479 4714. 1 Contig56 m 50839 51837 96% SEQ ID No. 2478 4713. 1 Contig56 p 51969 52322 93% + SEQ ID No. 2935 5532. 2 Contig56 m 52635 53546 97% SEQ ID No. 2936 5533. 2 Contig56 m 53673 53912 + SEQ ID No. 499 1682. 4 Contig56 p 54221 55105 94% SEQ ID No. 500 1683. 2 Contig56 m 55230 55457 + + SEQ ID No. 501 1684. 3 Contig56 p 55649 56050 96 % + SEQ ID No. 2249 4378. 2 Contig56 p 56210 56911 95% SEQ ID No. 2250 4379. 1 Contig56 p 568 84 57786 94% SEQ ID No. 2251 4381. 2 Contig56 p 57812 59134 + 99% SEQ ID No. 2252 4383. 2 Contig56 p 59183 60082 + 97% SEQ ID No. 997 2483. 2 Contig56 m 60143 60406 93% + SEQ ID No. 996 2482. Contig56 m 60536 61048 96% SEQ ID No. 995 2481. 4 Contig56 m 61231 62142 97% SEQ ID No. 2401 4600. 2 Contig56 m 62433 63200 97% SEQ ID No. 2402 4601. 1 Contig56 m 63160 63900 97% + SEQ ID No. 2403 4602. 3 Contig56 p 63958 64875 98% SEQ ID No. 3002 5652. 2 Contig56 p 64957 65739 - 97% + SEQ ID No. 2009 4045. 2 Contig56 p 65724 66335 - + + SEQ ID No. 2008 4043. 1 Contig56 m 66641 67078 - - 98% SEQ ID No. 2007 4042. 1 Contig56 p 67106 67858 - 96% SEQ ID No. 2006 4041. 1 Contig56 p 68024 69148 + 96% + SEQ ID No. 2005 4040.1 Contig56 p 69187 69486 + - SEQ ID No. 2004 4039.2 Contig56 m 69539 70852 - + SEQ ID No. 2003 4037. 2 Contig56 m 70837 71115 - + SEQ ID No. 2002 4036. 2 Contig56 p 71116 71400 + SEQ ID No. 2001 4035. 1 Contig56 p 71831 72199 80% + SEQ ID No. 2326 4490.2 Contig56 m 72497 73351 + - SEQ ID No. 2327 4491.3 Contig56 m 73671 73943 + SEQ ID No. 2328 4492. 3 Contig56 p 74457 75404 + + SEQ ID No. 2329 4493. 1 Contig56 p 75398 75607 - + + SEQ ID No. 967 2441.2 Contig56 p 75770 77053 + - SEQ ID No. 965 2439.2 Contig56 p 77137 77460 + - SEQ ID No. 964 2438.2 Contig56 p 77301 77741 - + SEQ ID No. 2330 4496. 2 Contig56 p 77914 78756 + + SEQ ID No. 2975 5605. 2 Contig56 p 79041 79460 - + + SEQ ID No. 425 1570. 4 Contig56 p 79550 82762 + + + SEQ ID No. 2343 4516.3 Contig56 p 82740 83900 + + - SEQ ID No. 306 1387.2 Contig56 p 83888 85336 - + SEQ ID No. 307 1388. 2 Contig56 m 85597 85953 + + SEQ ID No. 853 2271. 1 Contig56 m 85954 86205 + + SEQ ID No. 852 2270. 2 Contig56 m 86198 86578 + SEQ ID No. 2860 5387.1 Contig56 p 86587 87405 + SEQ ID No. 2861 5388.1 Contig56 p 87345 87626 - + + SEQ ID No. 1941 3953. 1 Contig56 m 87959 89164 - - 99% SEQ ID No. 506 1692.2 Contig56 p 89181 91175 - - 98% + - SEQ ID No. 19403950.2 Contig56 p 91527 93143 + 94% SEQ ID No. 2681 5028.2 Contig56 m 93235 94818 + - 97% + - SEQ ID No. 2863 5390.1 Contig56 m 94884 95249 97% SEQ ID No. 1995 4021. 2 Contig56 p 95342 95935 98% SEQ ID No. 1996 4023. 2 Contig56 p 95838 97349 99% SEQ ID No. 1997 4025.

  1 Contig 56 p 97336 98541 98% SEQ ID No. 1998 4026.2 Contig 56 98511 99701 + 97% SEQ ID No. 273 1334.3 Contig 56 99838 100644 86% + SEQ ID No. 274 1335.2 Contig 56 100634 101995 90% + SEQ ID No. 1999 4030. 1 Contig56 102167 102703 79% + SEQ ID No. 2000 4032. 3 Contig56 102700 103668 99% SEQ ID No. 2864 5391. 2 Contig56 103725 105176 99% SEQ ID No. 3124 5996. 1 Contig56 105163 105690 + 98% SEQ ID No 2822 531. 4 Contig56 105919 107865 98% + SEQ ID No. 2819 530. 3 Contig56 107831 108436 96% SEQ ID No. 285 1356. 2 Contig56 108648 109430 88% SEQ ID No. 286 1357. 2 Contig56 109467 109916 98% SEQ ID No. 2635 4948. 4 Contig 56 110012 113998 96% + SEQ ID No. 869 2299. 3 Contig56 114216 114683 95% SEQ ID No. 870 2301. 2 Contig56 115076 117259 99% SEQ ID No. 1354 3049. 1 Contig56 117222 118001 97% SEQ ID No. 1353 3047. 2 Contig56 117973 118644 99% SEQ ID No. 1352 3046. 3 Contig56 118221 118781 97% SEQ ID No. 1351 3045. 3 Contig56 118645 120087 99% SEQ ID No. 1350 3042. 1 Contig56 120097 120294 + + SE Q ID No. 1349 3041. 1 Contig56 120462 121664 95% + SEQ ID No. 2967 559. 2 Contig56 121830 122159 97% SEQ ID No. 2961 558. 2 Contig56 122262 122726 98% SEQ ID No. 2959 557. 2 Contig56 122756 125467 98% SEQ ID No. 606 1844. 3 Contig56 125449 126537 100% SEQ ID No. 607 1845. 3 Contig56 126753 127550 + 100% + SEQ ID No. 608 1846. 3 Contig56 127547 128779 99% SEQ ID No. 71 1022 2 Contig56 128901 129779 97% SEQ ID No. 72 1023.2 Contig56 129880 130467 + 95% SEQ ID No. 73 1024.2 Contig56 130563 131165 99% SEQ ID No. 348 1451. 4 Contig56 131482 132765 98% SEQ ID No. 617 1859. 2 Contig 56 132780 133634 100% SEQ ID No. 616 1858. 1 Contig56 133685 133957 100% + SEQ ID No. 615 1856. 3 Contig56 134558 136363 99% + SEQ ID No. 2383 4574. 2 Contig56 136288 137400 95% SEQ ID No 164 1160. 2 Contig56 137686 138921 + SEQ ID No. 162 1159. 5 Contig56 m 139130 140416 99% + SEQ ID No. 498 1681. 5 Contig56 p 141000 143876 98% SEQ ID No. 994 248. 2 Contig56 m 143990 145393 100% + SEQ ID No. 987 247. 1 Contig56 m 145394 146179 99% SEQ ID No. 973 245. 1 Contig56 m 146315 147349 100% + SEQ ID No. 966 244. 1 Contig56 m 147447 148508 99% SEQ ID No. 959 243. 2 Contig56 m 148517 149470 99% SEQ ID No. 702 2017. 1 Contig56 p 149611 150183 98% SEQ ID No. 701 2016. 2 Contig56 p 150223 150675 100% SEQ ID No. 1343 3028. 1 Contig56 p 150665 150934 - 100% SEQ ID No. 1342 3027. 1 Contig56 p 150941 151432 - 99% SEQ ID No. 1837 376. 3 Contig56 p 151338 152423 + 98% SEQ ID No. 1843 377. 1 Contig56 m 152501 153340 99% SEQ ID No. 1865 381. 6 Contig56 m 153410 156961 89% + SEQ ID No. 3090 5899. 1 Contig56 p 157044 157373 100% + SEQ ID No. 595 1823. 5 Contig56 m 157377 158678 99% + SEQ ID No. 2223 4346. 2 Contig56 m 158924 159877 99% SEQ ID No. 2224 4347 2 Contig 56 p 159936 160262 + 98% SEQ ID No. 2225 4349. 2 Contig56 p 160489 161322 + 100% SEQ ID No. 2226 4350. 2 Contig56 p 161323 162489 - 98% SEQ ID No. 2227 4351. 2 Contig56 p 162510 163424 98% SEQ ID No. 2228 4352. 3 Contig56 p 163425 164372 - 98% SEQ ID No. 3121 5986. 2 Contig56 m 164438 164929 98% + SEQ ID No. 2460 4691. 2 Contig56 p 165075 166451 99% SEQ ID No. 2459 4690. 2 Contig56 m 166544 168484 - 98% + SEQ ID No. 2457 4688. 2 Contig56 m 168556 169680 98% + SEQ ID No. 2012 405. 3 Contig56 m 169767 171719 98% SEQ ID No. 2019 406. 1 Contig56 m 171982 172845 - 98% SEQ ID No. 2027 407. 4 Contig56 m 172815 174182 99% + SEQ ID No. 2874 5420. 1 Contig56 p 174276 174809 - + SEQ ID No. 2875 5421. 1 Contig56 p 174790 175281 - 97% + SEQ ID No. 2876 5422. 1 Contig56 p 175516 175929 96% + SEQ ID No. 2877 5423. 1 Contig 56 p 176093 176353 + SEQ ID No. 825 2225. 2 Contig56 p 176301 177230 97% SEQ ID No. 146 1128. 3 Contig56 m 177274 178308 99% SEQ ID No. 147 1132. 2 Contig56 178079 178876 - 97% SEQ ID No. 148 1133. 3 Contig 56 178905 180047 - 97% SEQ ID No. 149 1134. 3 Contig56 180035 180313 - 100% + SEQ ID No. 1861 3802. 2 Contig56 180508 181905 - 100% SEQ ID No. 1862 3803. 1 Contig56 181817 182977 - 100% SEQ ID No. 1863 3804. 2 Contig56 182964 1838 33 - 98% SEQ ID No. 1864 3807. 2 Contig 56 183917 184408 99% SEQ ID No. 321 1407. 2 Contig56 184433 185311 98% + SEQ ID No. 320 1406. 2 Contig56 185316 186611 - 96% SEQ ID No. 319 1405. 2 Contig 56 186721 187620 98% SEQ ID No. 2878 5424. 2 Contig56 187587 188366 98% + SEQ ID No. 2749 5134. 4 Contig56 188552 189529 + 99% SEQ ID No. 2748 5133. 3 Contig56 189601 190266 99% SEQ ID No. 2747 5132. 3 Contig 56 190423 190665 - + + SEQ ID No. 1372 3072. 2 Contig56 190992 192803 - 99% SEQ ID No. 3203 640. 2 Contig56 193129 194091 97% SEQ ID No. 3204 641. 3 Contig56 194043 196091 - - 99% SEQ ID No. 457 1618. 3 Contig56 196354 196860 + 98% + SEQ ID No. 456 1617. 3 Contig56 196904 197545 98% SEQ ID No. 785 2152. 2 Contig56 197442 198038 97% SEQ ID No. 1373 3074. 1 Contig 56 198106 199032 - 96% + SEQ ID No. 631 1880. 3 Contig56 199130 200137 100% SEQ ID No. 979 2459. 1 Contig56 200112 200678 - 99% SEQ ID No. 978 2458. 2 Contig56 200733 201881 - - 98% SEQ ID No. 791 2162. 2 Contig56 201913 203340 98% SEQ ID No. 792 2164. 2 Contig56 203649 204509 - 98% SEQ ID No. 1374 3075. 2 Contig56 204200 204562 95% + SEQ ID No. 646 1902. 5 Contig56 204808 205812 - 98% SEQ ID No. 2849 5369. 2 Contig56 206011 206253 - 100% SEQ ID No. 2851 5370. 1 Contig56 206447 206899 - 98% SEQ ID No. 860 2282. 4 Contig56 206833 208641 - 99% SEQ ID No. 169 1169. 3 Contig56 208701 210593 99% SEQ ID No. 168 1168. 2 Contig56 209799 210206 94% SEQ ID No. 3077 5871. 3 Contig56 210934 212142 - + SEQ ID No. 1824 374. 2 Contig56 212175 213962 - - 90% SEQ ID No. 1809 371. 1 Contig56 P 214213 214563 - + + SEQ ID No. 565 1779. 3 Contig56 m 214773 214958 + + SEQ ID No. 567 1780. 3 Contig56 p 215260 215511 100% SEQ ID No. 568 1781. 4 Contig56 P 215742 217157 98% SEQ ID No. 441 1592. 3 Contig56 p 217296 218225 + 99% SEQ ID No. 2177 4285. 1 Contig56 m 218497 218913 + + SEQ ID No. 2176 4284. 2 Contig56 m 218914 219987 + SEQ ID No. 2175 4282. 2 Contig56 m 220040 220858 + SEQ ID No. 2174 4281. 2 Contig56 P 220863 221168 + + SEQ I No. 2,172,476. Contig56 m 221531 223492 + SEQ ID No. 3078 5872. Contig56 m 223532 223738 + + SEQ ID No. 2357 4532. Contig56 p 223941 225431 + SEQ ID No. 2356 4531 Contig56 m 225684 226010 + SEQ ID No. 2355 4530. 1 Contig56 m 226119 226424 + SEQ ID No. 2353 4528. 2 Contig56 m 226438 227223 + SEQ ID No. 2921 5504. 4 Contig56 m 227405 228223 + + SEQ ID No. 906 2357. 4 Contig56 P 228590 230416 + SEQ ID No. 3355 864. 1 Contig56 m 230660 231064 77% SEQ ID No. 3354 863. 1 Contig56 m 231159 231653 + SEQ ID No. 3353 862. 1 Contig56 P 231881 232144 + + SEQ ID No. 3352 860. 2 Contig56 p 232289 234031 + SEQ ID No. 1598 3411. 2 Contig56 p 234499 235608 + SEQ ID No. 1599 3413. 2 Contig56 p 235844 236812 + SEQ ID No. 1600 3414. 3 Contig56 m 237027 238826 + SEQ ID No. 652 1910. 6 Contig56 m 239000 243505 + + SEQ ID No. 653 1911. 4 Contig56 m 243805 244335 86% SEQ ID No. 403 1536. 3 Contig56 m 244316 246199 + 95% SEQ ID No. 450 1603. 3 Contig56 p 246579 248123 + SEQ ID No. 1902 3878. 1 Conti ## STR3 ## ID No. 1898 3871. 1 Contig 56 p 252925 253329 + SEQ ID No. 2870 5406. 1 Contig56 m 253581 255119 97% SEQ ID No. 259 1307. 4 Contig56 P 255297 256598 93% SEQ ID No. 258 1306. 5 Contig56 m 256705 259905 + 96% SEQ ID No. 2869 5405. 2 Contig56 m 259906 260877 + 97% SEQ ID No. 59 1001. 3 Contig56 m 260871 262217 + 95% SEQ ID No. 60 1002. 2 Contig56 m 262543 264180 80% SEQ ID No. 2500 4742. 3 Contig56 p 264520 265437 97% SEQ ID No. 2510 4757. 2 Contig56 m 265449 266069 92% SEQ ID No. 2511 4758. 2 Contig56 m 266170 266652 95% SEQ ID No. 2512 4759. 2 Contig56 p 266570 267409 98% SEQ ID No. 2513 4760. 2 Contig56 m 267786 268739 95% + SEQ ID No. 2709 5065. 2 Contig56 p 268942 269424 96% SEQ ID No. 2710 5066. 2 Contig56 m 269508 270020 97% SEQ ID No. 474 1643. 4 Contig56 m 269917 272451 96% SEQ ID No. 2335 450 0. 1 Contig56 p 272747 273112 + SEQ ID No. 2332 4498. 1 Contig56 p 273538 275025 97% + SEQ ID No. 2331 4497. 4 Contig56 p 275092 276381 98% + SEQ ID No. 667 1937. 4 Contig56 p 276466 276828 98% + SEQ ID No. 668 1939. 5 Contig56 p 277056 277634 95% + SEQ ID No. 2942 5542. 3 Contig56 p 277693 278568 98% SEQ ID No. 1918 3904. 3 Contig56 p 278644 280497 97% SEQ ID No. 2267 440. 4 Contig56 p 280671 285386 95% SEQ ID No. 1919 3908. 3 Contig56 p 285579 286721 97% + SEQ ID No. 1813 3714. 3 Contig56 p 286765 289398 97% + SEQ ID No. 3324 817. 7 Contig56 p 289615 295440 93% + SEQ ID No. 664 1933. 4 Contig56 p 295715 300448 87% + SEQ ID No. 1328 3003. 1 Contig56 p 300856 301554 99% SEQ ID No. 1327 3002. 1 Contig56 m 301583 302824 96% SEQ ID No. 963 2436. 2 Contig 56 302990 304480 96% + SEQ ID No. 1326 3001. 1 Contig56 p 304644 304823 + SEQ ID No. 1325 3000. 1 Contig56 p 304917 307223 98% SEQ ID No. 1321 2999. 3 Contig56 p 307366 308247 92% SEQ ID No. 1320 2998. 1 Contig56 m 308384 308848 + 97% SEQ ID No. 1319 2996. 1 Contig 56 p 309173 309691 + 98% + SEQ ID No. 1318 2995. 1 Contig 56 p 309823 311085 97% + SEQ ID No. 656 1918. 3 Contig56 m 311244 311996 97% SEQ ID No. 1026 2528. 3 Contig56 m 311932 312699 88% + SEQ ID No. 1317 2994. 2 Contig56 312863 313255 - - 95% SEQ ID No. 1316 2993. 2 Contig56 313301 314026 - 95% SEQ ID No. 1315 2992. 2 Contig56 314243 315259 - 92% SEQ ID No. 1314 2991. 1 Contig56 315382 316488 96% SEQ ID No. 1313 2990. 1 Contig56 316851 317330 - + SEQ ID No. 1312 2988. 1 Contig56 317318 317605 + + SEQ ID No. 1311 2987. 1 Contig56 317642 318247 + SEQ ID No. 1310 2986. 1 Contig56 318269 318838 + SEQ ID No. 1309 2985. 1 Contig56 318799 319164 + SEQ ID No. 1308 2983. 1 Contig56 319420 319680 + SEQ ID No. 1307 2982.1 Contig56 319677 321527 + SEQ ID No. 1306 2978.1 Contig56 321511 322419 + SEQ ID No. 1305 2976. 1 Contig56 322361 322648 + + SEQ ID No. 1304 2975. 2 Contig56 322563 322895 - + + SEQ ID No. 1303 2973. 2 Contig56 322880 323161 + + SEQ ID No. 130 2 2972. 3 Contig56 323201 324955 - + SEQ ID No. 3013 5675. 2 Contig56 324956 326062 + SEQ ID No. 3014 5677.2 Contig56 326486 327133 + - SEQ ID No. 2796 5242.3 Contig56 327199 327939 + + SEQ ID No. 2797 5243. 2 Contig56 327951 328175 + + SEQ ID No. 344 1446.3 Contig56 328545 329315 91% - SEQ ID No. 343 1444.3 Contig56 329451 331304 - - 95% SEQ ID No. 625 1870. 3 Contig56 331500 332612 + - 97% SEQ ID No. 3195 630.4 Contig56 332655 335864 - 98% - SEQ ID No. 1460 3205.3 Contig56 335981 340345 - 97% SEQ ID No. 1461 3207. 5 Contig56 340451 342949 - 97% SEQ ID No. 2563 4830.2 Contig56 343121 344029 - 99% - SEQ ID No. 2564 4833.2 Contig56 344290 345072 98% - SEQ ID No. 2798 5247.1 Contig56 345073 346131 - 97% SEQ ID No. 190 1205.5 Contig56 346389 357734 - 97% - SEQ ID No. 191 1207.2 Contig56 357737 358141 99% + SEQ ID No 1280 2949. 2 Contig 56 358365 359324 - 99% SEQ ID No. 1282 2951. 2 Contig56 359726 361783 + SEQ ID No. 1283 2952. 1 Contig56 361896 363770 - 85% + SEQ ID No. 1284 2953. 2 Co ntig56 364225 364773 - - 96% SEQ ID No. 813 2204. 2 Contig56 364871 366475 + 96% SEQ ID No. 814 2207. 2 Contig56 366476 367105 96% SEQ ID No. 815 2208. 1 Contig56 367223 367516 77% SEQ ID No 816 2209. 4 Contig56 367547 368536 96% SEQ ID No. 1043 2557. 4 Contig56 368573 369052 96% SEQ ID No. 1042 2555. 5 Contig56 369375 370547 + + SEQ ID No. 2408 4613. 3 Contig56 370702 372222 + 95% + SEQ ID No. 2407 4609. 2 Contig56 372227 372832 87% + SEQ ID No. 2406 4608. 1 Contig56 373025 373588 91% SEQ ID No. 2405 4607. 2 Contig56 373694 374998 99% + SEQ ID No. 2981 5611. 1 Contig56 374824 375147 + SEQ ID No. 2980 5610. 1 Contig56 375175 375633 92% SEQ ID No. 2978 5609. 1 Contig56 375588 375899 + SEQ ID No. 2723 5084. 4 Contig56 375956 377518 96% SEQ ID No. 2977 5607. 2 Contig56 377512 378960 99% SEQ ID No. 2976 5606. 2 Contig56 379119 379787 91% + SEQ ID No. 262 1317. 3 Contig56 379963 381123 98% + SEQ ID No. 263 1318. 4 Contig56 381171 381926 95% SEQ ID No. 3007 5662. 1 Contig56 381808 382452 + SEQ ID No. 2366 4547. 4 Contig 56 382744 383787 99% SEQ ID No. 2104 4171. 4 Contig56 384054 384602 + 98% SEQ ID No. 2105 4172. 2 Contig56 384751 385848 97% SEQ ID No. 2106 4173. 2 Contig56 385948 386391 98% SEQ ID No. 1025 2526. 3 Contig56 386531 387826 97% SEQ ID No. 2107 4174. 1 Contig56 388061 388519 + 100% + SEQ ID No. 2108 4175. 1 Contig56 388616 389545 98% SEQ ID No. 2109 4177 2 Contig 56 389619 391223 97% SEQ ID No. 2952 5557. 2 Contig56 391235 393079 95% SEQ ID No. 2424 4636. 4 Contig56 393601 398376 + SEQ ID No. 647 1903. 4 Contig56 398612 399586 97% SEQ ID No. 3051 5796. 3 Contig56 399743 400387 96% SEQ ID No. 1529 3308. 4 Contig56 400486 400734 + SEQ ID No. 1528 3307. 4 Contig56 400664 400867 + SEQ ID No. 2913 549. 5 Contig56 400978 402165 99% + SEQ ID No. 2908,548. 3 Contig56 402228 403745 + 97% + SEQ D No. 1527 3306. 4 Contig56 m 403870 404619 + 100% SEQ ID No. 1526 3304. 2 Contig56 m 404967 406145 + 99% SEQ ID No. 1525 3303. 2 Contig56 m 406350 407627 - - 95% + SEQ ID No. 115 1088. 3 Contig56 m 407795 409327 - 96% SEQ ID No. 114 1087. 2 Contig56 m 409331 411073 - - 96% SEQ ID No. 1524 3301. 2 Contig56 m 411031 412473 - 98% SEQ ID No. 1521 3299 3 Contig56 m 412674 413180 - + SEQ ID No. 3110 5950. 1 Contig56 m 413084 413554 + + SEQ ID No. 1520 3297. 3 Contig56 P 414188 415258 - 98% SEQ ID No. 325 1412. 5 Contig56 p 415252 417015 - 98% SEQ ID No. 326 1413. 2 Contig56 P 416981 418399 - - 95% SEQ ID No. 327 1414. 1 Contig56 P 418371 418622 + SEQ ID No. 328 1415. 4 Contig56 P 418607 419371 - 97% + SEQ ID No 1250 2900. 2 Contig 56 p 419278 420378 - - 97% + SEQ ID No. 1247 2898. 4 Contig 56 m 420698 420934 + SEQ ID No. 604 1840. 3 Contig 56 m 420935 422323 - 99% SEQ ID No. 602 1839. 2 Contig56 P 422240 423514 97% SEQ ID No. 1246 2893. 2 Contig56 p 423595 426009 - 97% SEQ ID No. 1245 2891. 2 Contig56 m 426200 428203 - 98% SEQ ID No. 1244 2889. 2 Contig56 m 428194 428649 + 99 % SEQ ID No. 1034 2544. 3 Contig56 p 428750 432649 - 95% SEQ ID No. 850 2268. 2 Contig 56 P 432873 434093 - 99% SEQ ID No. 849 2266. 2 Contig56 p 434150 435448 - 99% SEQ ID No. 848 2264. 2 Contig56 p 435357 436682 96% SEQ ID No. 217 1242. 2 Contig56 p 436686 437339 - 99 % SEQ ID No. 215 1239. 2 Contig56 P 437445 437651 - + + SEQ ID No. 214 1238.

  2 Contig56 p 437537 440545 - - 97% + SEQ ID No. 2769 5188. 2 Contig56 m 440810 442120 - 98% SEQ ID No. 2770 5189. 2 Contig56 m 442423 442962 + 100% SEQ ID No. 1478 3235. 3 Contig56 P 443439 444020 - - 95% SEQ ID No. 3109 5947. 1 Contig56 p 443846 444142 + SEQ ID No. 1479 3236. 3 Contig56 m 444206 446461 - 98% + SEQ ID No. 3401 926. 4 Contig56 m 446531 447229 97% SEQ ID No. 3402 928. 1 Contig 56 m 447359 448597 - 97% SEQ ID No. 3403 929. 2 Contig56 m 448649 450079 97% + SEQ ID No. 573 1788. 3 Contig56 m 450084 451466 98% SEQ ID No. 575 1792. 2 Contig56 m 451509 452315 99% SEQ ID No. 1480 3238. 1 Contig56 m 452294 453229 95% SEQ ID No. 137 1116. 2 Contig56 m 453233 453562 + 98% + SEQ ID No. 138 1118. 2 Contig56 m 453914 455338 - 97% SEQ ID No. 139 1119. 2 Contig56 m 455395 456072 92% + SEQ ID No. 1481 3239. 1 Contig56 p 456141 456452 + 100% SEQ ID No. 1483 3240. 3 Contig56 m 456543 456878 - 100% SEQ ID No 2118 4192. 2 Contig56 P 456954 458858 97% SEQ ID No. 2117 4191. 1 Contig56 P 458774 460276 98% SEQ ID No. 2115 4188. 1 Contig56 P 460258 461391 95% SEQ ID No. 2114 4186. 1 Contig56 p 461427 462320 - 98% SEQ ID No. 2113 4184. 1 Contig56 p 462305 462637 - 99% SEQ ID No 477 1647. 2 Contig56 m 462634 463245 - 98% SEQ ID No. 476 1645. 1 Contig56 P 463276 463866 - 98% SEQ ID No. 475 1644. 6 Contig56 m 463899 465158 95% SEQ ID No. 1061 2583. 3 Contig56 p 465296 465898 94% SEQ ID No. 1060 2582. 3 Contig56 P 465798 468422 97% SEQ ID No. 2549 4809. 2 Contig56 P 468423 469292 98% SEQ ID No. 2551 4810. 1 Contig56 P 469441 470094 - 98% + SEQ ID No. 2552 4811. 2 Contig56 m 470268 470777 + 97% SEQ ID No. 558 1768. 3 Contig56 m 470901 472232 - 99% SEQ ID No. 557 1767. 2 Contig56 m 472211 472930 - 97% SEQ ID No. 2562 4826 2 Contig 56 m 472935 473642 + 99% SEQ ID No. 2031 4073. 1 Contig56 p 474278 475393 99% SEQ ID No. 2030 4072. 1 Contig56 P 475378 476064 98% SEQ ID No. 3453 997. 2 Contig56 p 476065 477177 99 % SEQ ID No. 3452 996. 2 Contig56 p 477200 478231 98% SEQ ID No. 3451 995. 2 Contig 56 p 478195 478866 91% SEQ ID No. 2029 4071. 1 Contig56 m 478863 479441 95% + SEQ ID No. 2028 4070. 3 Contig56 P 479535 480974 - 99% SEQ ID No. 2453 4678. 3 Contig56 m 480971 481381 82 % + SEQ ID No. 2455 4680. 2 Contig56 m 481393 482142 - 98% SEQ ID No. 2456 4683. 3 Contig56 m 482069 483433 + 99% SEQ ID No. 2914 5492. 2 Contig56 m 484133 484753 + 99% SEQ ID No 2232 4356. 2 Contig 56 m 484717 485379 - 99% SEQ ID No. 2231 4355. 2 Contig56 m 485369 486358 98% + SEQ ID No. 2230 4354. 2 Contig56 P 486613 486870 + + SEQ ID No. 2229 4353. 2 Contig56 P 486710 487144 100% + SEQ ID No. 3303 787. 3 Contig56 P 487168 489210 99% SEQ ID No. 3304 789. 4 Contig56 m 489432 489803 + SEQ ID No. 2595 4880. 2 Contig56 m 489804 490667 + SEQ ID No. 2596 4881. 4 Contig56 m 490946 494197 94% SEQ ID No. 271 1331. 3 Contig56 m 494404 495648 97% SEQ ID No. 272 1332. 3 Contig56 m 495853 497343 99% + SEQ ID No. 1749 3626. 1 Contig56 m 497301 497801 99% + SEQ ID No. 1748 3625. 2 Contig56 m 497609 498991 97% SEQ ID No. 1747 3623. 2 Contig 56 m 498982 499392 100% SEQ ID No. 1746 3622. 3 Contig56 m 499393 500466 99% SEQ ID No. 2653 4977. 3 Contig56 p 500591 501079 100% + SEQ ID No. 2652 4974. 1 Contig56 m 501054 501593 + 99% SEQ ID No. 2536 4793. 2 Contig56 p 502045 503820 99% SEQ ID No. 2534 4790. 3 Contig56 P 503795 505126 100% SEQ ID No. 2535 4791. 3 Contig56 m 504082 504483 100% SEQ ID No. 2533 4788. 3 Contig56 m 505287 505961 + 98% SEQ ID No. 2656 4980. 3 Contig56 m 505912 506535 + 99% SEQ ID No. 2654 4979. 1 Contig56 P 506583 507191 99% SEQ ID No. 1265 2921 3 Contig 56 p 507266 510616 96% + SEQ ID No. 1502 327. 2 Contig56 m 510713 512743 97% SEQ ID No. 1510 328. 1 Contig56 m 512598 513521 98% SEQ ID No. 1523 330. 2 Contig56 m 513518 515047 99 % + SEQ ID No. 1264 2920. 1 Contig56 P 514374 514946 100% + SEQ ID No. 1262 2919. 1 Contig56 m 515128 515355 SEQ ID No. 61 1003. 3 Contig56 p 515479 517950 98% + SEQ ID No. 621005 2 Contig56 m 518054 518785 97% SEQ ID No. 1261 2917. 1 Contig56 p 5 19483 520199 97% SEQ ID No. 1260 2916. 1 Contig56 m 520040 520345 97% + SEQ ID No. 909 2360. 2 Contig56 p 520200 521270 + 98% SEQ ID No. 910 2361. 4 Contig56 m 521370 527024 91% + SEQ ID No. 1707 3568. Contig56 m 527089 528615 99% SEQ ID No. 1706 3566. Contig56 m 528497 529690 98% SEQ ID No. 3251 712. Contig56 m 529698 530726 99% + SEQ ID No. 3250 711. 2 Contig56 m 530771 532873 98% SEQ ID No. 3249 709. 1 Contig56 p 531595 531951 95% + SEQ ID No. 888 2335. 2 Contig56 p 533008 534369 97% + SEQ ID No. 889 2336. 2 Contig56 p 534412 536484 98 % SEQ ID No. 1705 3564. 2 Contig56 m 536875 537150 100% + SEQ ID No. 1704 3563. 2 Contig56 p 537264 537611 + SEQ ID No. 3123 5988. 1 Contig56 p 537425 537688 + ORF Contig Sens Position 1 Specific to% homology Position 2 Signal P Presence in specific Paris / Philadelphia ORFs L.longbeachae Legionella conserved 10.1 Contig54 p 888 1235 + 1000.2 Contig46 p 43955 44752 100% + 1001.3 Contig56 m 260871 262217 + 95% 1002.2 Contig56 m 26 2543 264180 80% 1003.3 Contig56 p 515479 517950 98% + 1005.2 Contig56 m 518054 518785 97% 1006.3 Contig44 p 71092 71754 + 96% 1009.2 Contig44 p 70565 71083 98% 1010.2 Contig44 p 69530 70564 97% 1011.5 Contig44 p 67175 69529 - 98% 1013.1 Contig48 m 128699 129295 - 97% + 1014.2 Contig48 p 128457 129848 98% 102.1 Contig5O p 34385 37093 96% 1021.3 Contig43 p 1363 4413 100% 1022.2 Contig56 m 128901 129779 97% 1023.2 Contig56 m 129880 130467 + 95% 1024.2 Contig56 m 130563 131165 - 99%, 1028.3 Contig43 m 24521 25792 97% 103.1 Contig5O p 37068 38339 + 98% 1030.3 Contig43 m 25732 26601 - 96% 1032.3 Contig43 p 26819 27790 99% 1034.3 Contig43 p 27791 28777 + 96% + 1035.3 Contig55 p 136010 137455 - 97% 1036.4 Contig55 m 264665 266002 - 98% 1037.1 Contig55 m 265921 266478 - 100% 1039.2 Contig55 p 266605 267834 95% 104.1 Contig5O p 38294 39469 + 98% 1040.3 Contig4l p 38592 39653 96% 1041.3 Contig4l m 40023 42467 - 99% 1042.5 Contig45 m 121153 122400 100% 1044.3 Contig45 m 119649 120962 99% 1047.2 Co ntig46 m 143301 144233 + 98% 1048.3 Contig46 m 142126 143316 - 99% 1049.2 Contig54 p 79487 80278 - 96% 1050.4 Contig54 p 80420 83893 - 98% + 1053.2 Contig55 m 422766 423317 99% 1055.1 Contig55 m 422032 422802 - - 97% 1056.1 Contig55 p 421787 422035 100% + 1058.3 Contig55 p 420079 421542 98% + 1059.2 Contig52 m 171843 173126 99% + 1060.2 Contig52 p 173322 174221 - 94% 1063.1 Contig47 m 197173 198501 - 98% + 1065.3 Contig47 m 195618 196814 96% 1066.2 Contig45 m 84221 85126 - 94% 1067.1 Contig45 p 83801 84055 + 1069.2 Contig45 p 82510 83586 + 107.1 Contig50 p 39535 42687 98% 1071.3 Contig53 m 97055 98368 98% 1072.4 Contig53 m 98314 101307 - - 99% 1074.3 Contig40 p 13158 15182 98% 1075.3 Contig40 p 11840 13171 99% 1076.3 Contig55 p 82869 83252 - + 1077.1 Contig55 p 82086 82808 - + 1078.2 Contig55 p 81022 82008 - + + 1080.2 Contig48 p 21518 22444 + 1081.2 Contig48 m 22650 23873 + + 1082.3 Contig56 m 6468 8033 - + 1087.2 Contig56 m 409331 411073 - 96% 1088.3 Contig56 m 407795 409327 - 96% 10 89.2 Contig39 m 22468 25227 - 96% 109.1 Contig50 p 42543 44045 94% 1090.1 Contig39 m 25228 25578 - 87% 1091.2 Contig39 m 25532 26836 + - 95% 1092.3 Contig39 m 26788 27693 - 98% 1093.3 Contig46 m 31987 32967 - 100% 1094.1 Contig46 m 31483 31767 - 100% 1096.3 Contig46 p 30003 31439 100% 1098.3 Contig55 m 162153 163196 97% 1099.2 Contig55 p 163387 164445 - 94% 11.2 Contig54 p 36783 37802 + 1101.4 Contig54 m 169230 170324 97% 1102.2 Contig54 m 170325 171641 96% 1105.2 Contig54 m 132369 134687 - 96% 1106.5 Contig 37 p 3626 7762 99% 1107.2 Contig55 m 171541 172536 - 97% 1109.3 Contig55 m 170559 171554 - 97% 111.2 Contig5O p 43985 45556 96% 1111.3 Contig55 m 169738 170574 98% 1113.2 Contig55 p 310647 311045 96% 1115.4 Contig55 p 309795 310592 97% 1116.2 Contig56 m 453233 453562 + - 98% + 1118.2 Contig56 m 453914 455338 - 97% 1119.2 Contig56 m 455395 456072 92% + 1122.1 Contig53 p 125451 126383 + 99% 1123.2 Contig53 p 124321 125466 99% 1124.2 Contig54 p 128626 129426 97% 1125.2 Contig54 p 12718 8 128384 97% 1126.3 Contig54 p 125926 127218 - 96% 1127.3 Contig55 p 414552 416573 98% 1128.3 Contig56 m 177274 178308 99% 1132.2 Contig56 p 178079 178876 - - 97% 1133.3 Contig56 m 178905 180047 97% 1134.3 Contig56 m 180035 180313 100% + 1136.3 Contig54 p 137907 139430 + - 99% 1137.2 Contig54 p 137371 137796 - - 98% + 114.2 Contig48 p 79316 79507 + + 1142.4 Contig45 m 65328 66779 + - 99% 1144.3 Contig55 m 298751 300040 99% 1145.3 Contig55 m 300027 302186 - - 97 % 1148.2 Contig43 m 69161 71929 98% 115.2 Contig48 p 79533 80096 + 1152.2 Contig54 m 57786 58682 92% 1153.1 Contig54 m 57180 57608 - 98% - 1156.3 Contig54 m 55687 56997 + 1157.4 Contig53 p 170063 172897 - 98% 1159.5 Contig56 m 139130 140416 - 99% + 116.1 Contig48 p 80429 80992 - + 1160.2 Contig56 m 137686 138921 + 1161.2 Contig5O p 119787 120848 98% + 1162.1 Contig50 m 119212 119568 98% 1163.2 Contig50 p 118435 119172 99% 1168.2 Contig56 m 209799 210206 - 94% 1169.3 Contig56 p 208701 210593 - 99% 117.1 Contig48 p 81479 81859 + + 1171.3 Contig55 p 128900 129670 + + _ 1172.2 Contig55 p 129671 130108 + + 1174.2 Contig41 p 49394 50734 - 98% - 1176.5 Contig41 p 51021 52868 - 98% + 1179.1 Contig5l m 23986 24621 + 83% + 118.1 Contig48 p 81813 82490 - + + 1180.2 Contig5l m 22973 23767 - 98% 1182.3 Contig51 m 21993 22934 - 99% 1183.4 Contig49 p 166928 168976 + + 1184.2 Contig49 m 168987 170183 + 95% 1186.2 Contig49 m 170239 171039 - 88% - 1188.2 Contig49 m 40523 42844 + - 98% 119.1 Contig48 p 82812 83327 + 1190.4 Contig40 m 47773 49917 + - 96% - 1193.2 Contig51 m 37917 38414 - 98% + 1194.3 Contig51 m 38526 39716 - 100% + 1199.4 Contig37 p 19451 19795 - 100% 1201.1 Contig37 p 19786 20454 100% - 1202.2 Contig37 p 20459 20884 - 100% - 1205.5 Contig56 p 346389 357734 - - 97% - 1207.2 Contig56 m 357737 358141 - 99% + 1208.1 Contig55 p 288191 288577 99% 1209.2 Contig55 m 287341 288849 - 100% 121.1 Contig48 m 83648 84016 - + 1210.2 Contig55 m 285761 287344 - 97% 1211.3 Contig49 p 50962 52008 86% 1213.2 Contig49 p 49373 50596 + + 1215.3 Contig52 p 98687 99826 - - 100% 122.3 Contig48 m 84504 85001 + - 100% 1220.3 Contig52 p 99827 101356 - - 98% 1222.5 Contig49 m 107944 109923 - 96% + 1223.2 Contig55 p 155439 156341 - 80% 1224.2 Contig55 m 156401 157246 + 97% 1225.2 Contig55 p 126202 127263 + + 1226.2 Contig55 p 125159 126205 + 1227.1 Contig39 p 48300 49013 95% 1229.3 Contig39 p 47244 47789 - - 95% + 123.2 Contig51 m 181917 183347 + 99% 1230.2 Contig46 p 47057 48649 100% 1231.3 Contig46 m 48715 49140 - - 100% + 1235.3 Contig55 m 97094 97873 + 1236.2 Contig55 m 96236 97093 96% 1237.2 Contig55 p 95677 96117 + 1238.2 Contig56 p 437537 440545 - - 97% + 1239.2 Contig56 p 437445 437651 + + 124.1 Contig5l m 183344 183853 100% 1242.2 Contig56 p 436686 437339 - 99% 1244.2 Contig52 p 19306 20388 89% + 1245.1 Contig52 p 18783 19034 - 87% + 1246.2 Contig52 p 16920 18671 80% 1249.2 Contig49 m 194005 194559 + 125.2 Contig51 m 183952 185502 - 98% 1250.1 Contig49 p 193501 193998 - 93% 1251.2 Contig49 p 192522 193505 - - 97% 1257.5 Contig55 m 433351 434646 - 99% 1258.1 Contig55 m 432392 433441 97% 126.2 Contig52 m 87008 88483 - 98% 1260.3 Contig55 p 431468 432283 + 100% 1261.2 Contig54 p 117232 118920 99% 1264.3 Contig54 m 118978 120174 + 95% 1265.5 Contig53 m 157090 157923 97% 1267.3 Contig53 p 156234 157100 - 97% 1268.2 Contig53 p 155302 156252 - - 98% 127.4 Contig52 p 87285 87671 95% 1270.2 Contig5l m 7842 8312 99% 1271.3 Contig51 p 8263 8610 - - 100% 1272.4 Contig5l p 8710 9696 - - 97% 1273.4 Contig5l p 160659 161378 90% 1275.2 Contig51 p 159645 160532 97% 1277.2 Contig5l p 158205 159371 99% 1278.2 Contig45 m 80071 81282 99% 1279.3 Contig45 p 79527 80066 - - 96% 1280.3 Contig46 m 117725 119929 98% + 1282.3 Contig46 p 157074 158642 97% 1283.2 Contig45 p 37016 38341 98% 1284.2 Contig45 p 36772 37059 96% 1286.3 Contig45 p 34628 36538 - 98% 1287.3 Contig50 m 9299 12076 - + 1288.2 Contig53 m 253575 255041 - 100% 129.3 Contig52 m 86644 86940 - - 96% + 1293.4 Contig55 m 193087 193707 + 96% 1294.2 Contig55 m 1 92553 193086 98% 1295.1 Contig55 m 191978 192574 + 96% 1299.3 Contig55 p 12561 13958 + + + 13.1 Contig54 p 35966 36853 - + + 130.4 Contig52 m 84956 86611 - 98% 1302.2 Contig49 m 7878 9074 - 99% 1303.3 Contig49 m 9075 9848 97 % 1306.5 Contig56 m 256705 259905 + - 96% 1307.4 Contig56 p 255297 256598 - - 93% 131.2 Contig39 m 51668 52141 + 44% 1314.3 Contig43 m 86777 88240 + - 99% 1317.3 Contig56 p 379963 381123 98% + 1318.4 Contig56 m 381171 381926 95 % 1320.3 Contig47 m 134959 137187 97% 1322.2 Contig52 m 213961 215397 + 97% 1323.2 Contig52 p 213309 213839 - 98% + 1324.4 Contig51 p 33284 34675 - 91% - 1325.2 Contig50 p 116708 118477 98% 1328.2 Contig50 p 115459 116604 100% 1330.5 Contig50 m 113327 115459 98% 1331.3 Contig56 m 494404 495648 97% - 1332.3 Contig56 p 99838 100644 - 86% + 1335.2 Contig56 m 100634 101995 - 90% + 1336.3 Contig47 m 104195 105385 - 98% 1338.3 Contig48 p 95203 97308 - 98% 1339.2 Contig48 m 94458 95033 100% - 1341.2 Contig48 p 93650 94402 - 98% + 1342.3 Contig55 p 11279 12070 + + 1344.3 Contig55 p 9401 10501 + + 1345.3 Contig52 p 157275 158378 - 97% 1346.3 Contig52 p 156342 157166 - - 98% 1353.3 Contig53 p 69533 70615 - 99% + 1354.2 Contig53 p 70542 71525 - 99% + 1356.2 Contig56 m 108648 109430 - 88% 1357.2 Contig56 m 109467 109916 98% 1359.2 Contig42 p 40114 41187 100% 1360.6 Contig45 m 31446 32963 - - 96% 1361.3 Contig45 p 33558 34631 - - 98% 1362.3 Contig55 p 76079 77905 + + 1364.2 Contig55 m 77909 79549 + + 1366.3 Contig46 m120156 123287 97% + 1367.3 Contig43 m 30046 30639 + - 97% 1368.2 Contig43 p 30475 30666 - 96% + 1369.2 Contig43 m 30471 30911 97% 1370.5 Contig43 m 31018 31629 99% CO 1372.2 Contig50 m 15924 16229 + + N 0) 1373.1 Contig50 m 16190 16525 - + + 1375.2 Contig50 m 16526 17281 + + 1376.2 Contig5O m 17215 17766 + 1377.5 Contig47 m 175216 177651 97% + 1378.5 Contig47 m 177711 178910 - 98% + 1380.3 Contig5l p 49013 50593 - - 97% 1385.2 Contig5l m 36572 37336 - 90% + 1386.3 Contig51 m 35892 362 75 - 95% 1387.2 Contig56 p 83888 85336 - + 1388.2 Contig56 m85597 85953 + + 139.5 Contig54 p 44404 48882 + 1390.5 Contig39 p 49497 49979 - 96% + 1391.1 Contig39 p 50090 50704 - 97% 1392.2 Contig39 m 50780 51103 + 1394.2 Contig47 m 155492 155962 + 1396.3 Contig47 p 156048 157058 98% 1397.2 Contig47 p 157308 157814 - 99% 1398.2 Contig52 m 308532 310538 - - 97% 1399.3 Contig52 m 310525 312153 99% 1400.2 Contig44 p 75570 77072 99% 1402.2 Contig44 p 74062 75576 - - 100% 1405.2 Contig56 p 186721 187620 98% 1406.2 Contig56 m 185316 186611 - - 96% 1407.2 Contig56 p 184433 185311 - - 98% + 1409.3 Contig54 p 157120 157902 + 99% + 141.4 Contig5l p 44028 46769 - 96% 1410.2 Contig54 m 158050 158997 - 98% + 1412.5 Contig56 p 415252 417015 98% 1413.1 Contig56 p 416981 418399 - 95% 1414.1 Contig56 p 418371 418622 - + 1415.4 Contig56 p 418607 419371 97% + 1417.1 Contig52 p 20421 20891 100% 1418.3 Contig52 m 20994 22823 + 90% 142.2 Contig5l p 46762 47526 - - 97% 1420.2 Contig46 m 63415 64569 100% 1421.3 Contig46 p 64694 67030 - 100% 1423.2 Contig50 m 75552 76979 - 97% 1424.2 Contig50 m 75133 75561 - 96% 1425.2 Contig50 m 74865 75158 97% 1429.4 Contig47 m 24232 25806 + + + 1432.3 Contig47 p 23126 24049 - - 98% 1434.3 Contig53 m 259654 261867 - - 100% 1438.4 Contig43 p 54447 56333 - 98% 144.3 Contig51 p 47728 48822 + - 98% 1440.2 Contig43 p 2 1249 + - 100% 1444.3 Contig56 m 329451 331304 - - 95% 1446.3 Contig56 p 328545 329315 91% 1448.2 Contig52 p 63680 64834 96% 1449.3 Contig52 m 64855 67023 + 98% 1450.2 Contig52 m 160244 161539 - - 98% 1451.4 Contig56 m 131482 132765 - - 98% 1454.2 Contig44 m 34019 35995 - 100% 1455.2 Contig46 m 17189 17725 + 100% 1456.2 Contig46 m 16467 17201 100% 1457.2 Contig46 m 15855 16466 98% 1461.3 Contig5l m 79633 80634 - - 99% 1463.2 Contig51 m 78555 79679 99% + 1466.2 Contig47 p 165058 165801 98% 1467.5 Contig47 p 164422 165021 - 98% 1469.4 Contig56 m 8879 12292 - + + 1473.4 Contig49 m 182064 182630 98% 1474.4 Contig49 m 180783 181997 99% 1475.2 Contig53 m 55250 55540 - - 100% + 1476.2 Contig53 p 54335 55246 - - 100% + 1479.3 Contig53 p 132452 133864 97% 148.2 Contig50 p 79937 81463 96% 1481.3 Contig53 p 133846 134982 96% 1482.4 Contig48 p 134694 135689 98% 1484.2 Contig46 m 25905 26603 - 100% 1485.4 Contig46 m 26579 27880 + - 100% 1487.3 Contig56 m 42394 43230 - 99% + 1488.2 Contig46 m 114650 114994 98% + 1490.4 Contig46 p 113424 116225 99% 1493.6 Contig4O p 26618 31495 - 99% + 1494.2 Contig53 m 189743 190537 - 99% 1495.1 Contig53 m 190543 190902 - 99% 1497.2 Contig53 m 191202 192272 - - 98% 15.1 Contig54 p 34591 35802 + 150.2 Contig50 p 81725 82705 + 1501.3 Contig55 m 295754 296599 + 98% 1503.4 Contig55 m 294663 295850 97% 1505.4 Contig54 p 102899 105229 - 96% + 1507.3 Contig54 p 105338 106840 - 98% 1508.4 Contig5l p 126402 127535 - 98% 151.2 Contig50 m 83861 84685 - 97% 1510.3 Contig5l m 125180 126028 99% 1511.3 Contig51 m 124396 125073 99% 1513.4 Contig55 p 206522 207880 + 98% 1515.2 Contig55 p 205797 206564 - 96% 1516.3 Contig55 m 204692 205651 - 96% 1517.3 Contig51 p 211384 212667 98% 1519.2 Contig51 m 212748 213812 - - 100% 152.3 Contig5O p 50084 50461 + - 98% 1521.2 Contig51 p 213997 214617 - 97% 1522.2 Contig55 m 101257 102432 + 1523.2 Contig55 m 102483 102815 + + 1524.3 Contig55 m 102816 103892 + 1525.3 Contig52 m 215375 216646 98% 1528.4 Contig52 p 216734 218086 - 98% 1529.2 Contig52 p 220737 221954 - 99% 153.2 Contig50 p 50462 51799 + - 99% 1530.2 Contig52 m 220337 220723 - 98% 1531.3 Contig52 p 217993 220296 99% 1532.3 Contig52 p 13507 15498 97% 1533.1 Contig52 p 15502 16737 97% 1536.3 Contig56 m 244316 246199 + 95% 1539.2 Contig46 m 45979 46878 + 100% + 154.1 Contig5O p 51796 52764 + 96% 1542.2 Contig46 p 44743 45813 100% 1545.3 Contig52 p 54083 55753 99% + 1547.2 Contig52 p 53250 54101 - 99% 1548.2 Contig50 m 74170 74871 99% 1549.1 Contig50 m 73898 74191 + 100% 1550.2 Contig50 m 73149 73937 97% + 1552.3 Contig4l p 67559 69124 - 100% 1555.2 Contig4l p 69211 70080 99% 1556.2 Contig4l p 70081 71469 - 100% 1557.3 Contig53 p 175448 176338 99% + 1559.2 Contig53 p 174213 175388 - 99% 1560.2 Contig47 m 69761 70600 + 1562.3 Contig47 p 68820 69641 97% + 1563.3 Contig49 p 152206 152847 95% 1564.3 Contig49 p 150804 152222 - 99% 1566.3 Contig47 m 88505 89068 + + 1567.2 Contig47 m 86827 88173 92% + 1569.6 Contig48 m 114485 116662 99% 157.2 Contig50 p 52765 55980 + 98% 1570.4 Contig56 p 79550 82762 + + + 1575.2 Contig55 p 55896 56345 + 1577.5 Contig55 m 174673 177582 95% 1578.3 Contig49 p 12817 13644 - 92% 1579.4 Contig49 m 13726 14193 + 92% 158.2 Contig50 p 65304 65987 - 98% 1581.4 Contig54 m 54089 55366 - 87% + 1582.2 Contig54 p 53466 53990 - 98% 1584.3 Contig52 p 225621 228359 - 99% + + 1585.2 Contig55 m 364415 365494 - 95% 1586.2 Contig55 m 365921 366190 + 100% + 1587.4 Contig55 p 366186 367574 97% 1589.3 Contig52 m 39287 39994 99% 159.1 Contig5O p 65005 65316 - 89% 1590.1 Contig52 m 40025 40582 + 98% 1591.4 Contig52 m 40813 42264 - 98% 1592.3 Contig56 P 217296 218225 + 99% 1594.2 Contig52 p 2 39053 239775 97% 1595.3 Contig52 p 237930 239072 - 98% 1598.6 Contig52 p 236937 237929 - - 100% 1599.4 Contig55 p 18806 24001 + + 16.1 Contig54 p 34418 34645 - + 160.1 Contig50 m 64504 64863 + 1601.3 Contig54 p 163332 164519 + 98% 1602.2 Contig54 p 162071 163246 97% 1603.3 Contig56 p 246579 248123 + 1606.2 Contig53 m 193404 194234 98% 1607.2 Contig53 m 194228 194500 + 1608.2 Contig53 p 194570 195826 - - 99% 1611.5 Contig52 p 177956 179017 - - 98% 1615.2 Contig46 p 128397 130232 - - 99% + 1617.3 Contig56 m 196904 197545 - 98% 1618.3 Contig56 p 196354 196860 + 98% + 1623.4 Contig50 m 6937 8328 - + 1624.4 Contig50 m 5355 7022 + + 1625.3 Contig50 p 128135 129334 - 99% 1626.3 Contig50 p 129335 130678 99% 1628.3 Contig50 m 66550 67515 + 92% 1629.1 Contig50 m 67365 68138 + 95% 163.1 Contig50 p 62978 64276 - + 1631.3 Contig50 m 68126 70117 97% 1632.3 Contig55 m 400350 402146 + - 99% 1633.2 Contig55 m 399379 400365 - 99% 1635.4 Contig52 m 106495 109404 - - 92% + 1636.2 Contig46 p 151141 154593 - 99% 1638.2 Contig52 p 103846 105045 - 99% + 1639.4 Contig52 m 105158 106336 91% 1641.5 Contig56 p 25345 26694 - 98% 1642.3 Contig56 p 26679 27341 - 100% - 1643.4 Contig56 m 269917 272451 96% 1644.6 Contig56 m 463899 465158 - 95 % 1645.1 Contig56 p 463276 463866 98% 1647.2 Contig56 m 462634 463245 - - 98% 1649.3 Contig49 m 73750 76110 94% 1650.2 Contig49 m 76053 77585 96% _ 1652.4 Contig47 p 39121 39687 - 91% 1653.3 Contig47 m 39802 40740 + - 96% 1655.2 Contig45 p 62532 62795 100% 1657.1 Contig45 p 62789 63544 - 98% 1658.2 Contig45 p 63762 65222 - - 98% + 1659.4 Contig47 p 150829 154725 - - 96% + 166.2 Contig50 p 59537 62800 95% 1660.2 Contig47 p 15051.0 150761 89% + 1661.3 Contig47 p 149794 150489 - - 98% 1663.6 Contig37 p 7788 12056 99% 1664.2 Contig47 m 89346 90161 87% + 1666.3 Contig43 p 41339 43054 - - 96% + 1669.3 Contig45 m 104200 105201 98% _ 1670.3 Contig45 p 105391 106725 - 96% 1671.3 Contig55 m 221880 223283 + - 96% + 1673.5 Contig45 p 102412 104136 - 97% 1675.3 Contig45 m 1 02037 102357 - 99% 168.1 Contig50 p 59115 59687 - 97% 1681.5 Contig56 p 141000 143876 - - 98% 1682.4 Contig56 p 54221 55105 94% 1683.2 Contig56 m 55230 55457 + + 1684.3 Contig56 p 55649 56050 - 96% + 1685.3 Contig45 m 109460 110584 98% 1689.3 Contig48 p 74054 75268 + 100% 169.1 Contig5O m 58808 59020 + + 1691.3 Contig48 p 75250 76881 - 99% 1692.2 Contig56 p 89181 91175 98% + 1693.2 Contig45 p 25663 25947 91% 1695.2 Contig45 m 24311 25426 - - 92% 1697.2 Contig40 p 31501 32064 98% 1698.2 Contig40 m 32095 33180 96% 1699.4 Contig5l m 83619 84545 - 97% 1701.5 Contig5l m 81987 83204 + - 99% 1703.1 Contig45 m 2232 3020 - - 98% 1704.4 Contig45 m 3189 5213 - 97% 1705.2 Contig53 p 37874 38746 98% + 1706.2 Contig53 m 38847 39317 - 98% 1707.2 Contig53 m 39318 39686 - - 100% 1708.4 Contig55 p 259050 259427 99% 1709.1 Contig55 m 259455 260177 98% 1711.2 Contig55 m 260134 260889 99% 1713.2 Contig55 m 423302 425392 - - 97% 1714.4 Contig55 m 425358 426290 100% 172.1 Contig48 m 59557 59775 + 1720.3 Cont ig5l m 156341 157147 - - 99% 1722.2 Contig49 p 114908 115852 - - 97% 1723.5 Contig49 p 115955 116539 98% 1724.3 Contig5l p 143835 144755 98% 1725.3 Contig5l m 144891 145793 100% 1726.4 Contig50 m 169200 170873 - 93% 1730.3 Contig44 p 79326 81956 99% 1733.3 Contig43 p 7541 8806 + - 100% 1734.2 Contig45 p 98319 98483 + + 1735.1 Contig45 p 98103 98318 + + 1737.2 Contig45 p 96822 97934 - + 1738.3 Contig52 p 52040 53257 - 99% + 1739.2 Contig52 p 51433 52056 - 99% 174.1 Contig48 p 60382 61275 96% 1740.3 Contig52 p 50644 51432 100% 1742.3. Contig55 m 273878 274645 - - 98% 1743.4 Contig55 m 273331 273900 - - 99% 1746.2 Contig43 p 71971 72792 91% 1747.2 Contig43 m 73047 73409 - - 100% + 1748.3 Contig55 m 187301 188650 - - 96% _ 1749.2 Contig55 m 188742 189518 - 91% 1750.3 Contig48 p 77589 78464 97% 1752.2 Contig48 p 76882 77436 + 100% 1754.3 Contig55 m 243052 244590 - 98% - 1755.3 Contig55 m 244529 244864 - 98% + 1756.4 Contig55 m 244943 245797 - - 98% 1759.4 Contig53 p 216391 217173 - - 99% + 176.1 Contig48 m 61299 62291 - - 96% + 1760.4 Contig53 m 215547 216278 - 99% 1761.4 Contig55 p 52416 55592 - + 1762.2 Contig55 p 51309 52265 - + 1764.3 Contig42 p 13730 14869 100% - 1765.4 Contig42 p 14850 15467 - 100% 1767.2 Contig56 m 472211 472930 - 97% - 1768.3 Contig56 m 470901 472232 99% 1770.2 Contig5l m 165180 168293 + - 85% + 1772.1 Contig5l m 168284 168760 - 89% - 1773.1 Contig5l p 168849 169307 99% - 1774.2 Contig51 p 169304 170725 + 87% 1775.3 Contig54 p 86468 88030 - 94% + 1778.5 Contig54 p 85555 86043 - 100% 1779.3 Cont ig56 m 214773 214958 + + 178.1 Contig48 p 62390 62704 - 100% + 1780.3 Contig56 p 215260 215511 - - 100% 1781.4 Contig56 p 215742 217157 - 98% - 1782.3 Contig53 p 179471 180784 - - 99% 1784.2 Contig53 m 178463 178897 100% + 1786.2 Contig53 p 177979 178392 100% + 1787.4 Contig56 p 34519 37686 - + + 1788.3 Contig56 m 450084 451466 - - 98% - 179.1 Contig48 m 62747 63022 - 95% _ 1792.2 Contig56 m 451509 452315 99% 1793.3 Contig52 m 194158 195009 - 99% 1794.3 Contig52 m 193397 194182 - 97% 1795.3 Contig52 p 185529 188249 - 98% 1797.4 Contig55 m 426498 427307 + - 100% 18.1 Contig54 p 34124 34408 + 180.1 Contig48 m 63013 63207 + + 1800.4 Contig55 m 427491 429701 - 98% 1803.2 Contig5O p 21826 22089 + 1804.2 Contig5O p 22255 23502 + 97% 1805.3 Contig47 m 161682 162344 - - 98% 1806.2 Contig47 p 160979 161524 99% 1807.3 Contig47 m 159379 160806 100% 1809.4 Contig54 m 64253 66679 - 84% 1812.4 Contig48 m 141531 142739 + 99% 1815.2 Contig48 p 49732 50319 + 1817.2 Contig48 p 50616 51212 - 98% + 1818.4 Contig42 p 15448 16980 - 100% 1819.6 Contig43 m 48139 52452 - 95% + 182.3 Contig48 m 63200 64855 - 99% 1823.5 Contig56 m 157377 158678 - 99% + 1826.2 Contig49 p 5708 6622 - 95% + 1827.3 Contig49 p 4176 5615 + + 1831.3 Contig54 p 147869 149143 97% 1832.4 Contig54 p 147324 147938 - - 98% 1834.4 Contig46 p 69560 70978 - 100% 1838.2 Contig53 m 135071 136582 + 93% 1839.2 Contig56 p 422240 423514 - 97% 184.2 Contig49 p 175678 175977 + + 1840.3 Contig56 m 420935 422323 - 99% 1841.2 Contig46 p 135667 137343 - 98% 1844.3 Contig56 m 125449 126537 - 100% 1845.3 Contig56 p 126753 127550 + - 100% + 1846.3 Contig56 m 127547 128779 99% 1847.3 Contig39 p 43268 45091 - 97% 1848.4 Contig55 m 99168 100433 + 1849.3 Contig55 m 100339 100893 + 185.1 Contig49 p 174610 175461 + - 98% 1852.2 Contig55 m 100904 101302 - + + 1853.2 Contig46 p 39690 40109 + 100% 1856.3 Contig56 p 134558 136363 - - 99% + 1858.1 Contig56 m 133685 133957 100% + 1859.2 Contig56 m 132780 133634 100% 1860.2 Contig47 p 75237 76346 - 92% 1861.2 Contig47 m 73905 74735 - 96% + 1862.2 Contig52 p 7735 9072 - 96% 1863.2 Contig52 p 6950 7645 - - 99% 1864.3 Contig42 p 77689 79155 - 100% 1865.3 Contig42 p 76665 77765 - 100%

  187.1 Contig49 p 173879 174583 - 94% + 1870.3 Contig56 p 331500 332612 + 97% 1871.2 Contig55 m 374162 375211 - 100% 1873.2 Contig55 m 373717 374169 100% 1875.2 Contig47 p 125840 127069 + + 1878.3 Contig47 p 124766 125719 98% 188.1 Contig49 m 172539 173675 - 96% + 1880.3 Contig56 m 199130 200137 - 100% 1882.2 Contig53 m 268976 269923 100% 1883.4 Contig53 m 270013 271392 - 100% + 1885.3 Contig55 m 321503 322891 + 99% 1886.2 Contig55 m 320563 321231 - 99% + 1887.2 Contig45 m 5447 7078 - 90% 1889.2 Contig45 m 7392 8750 - - 91% + 189.3 Contig49 p 171178 172434 - 97% 1891.2 Contig48 m 27597 28370 + 1893.2 Contig51 p 129560 130237 - 100% 1894.2 Contig5l m 129024 129398 - 100% 1895.6 Contig46 p 105421 106050 - 96% 1896.5 Contig46 p 106051 108150 + 99% 19.1 Contig54 m 33353 34066 + 190.3 Contig49 p 19228 19989 93% + 1902.5 Contig56 m 204808 205812 - 98% 1903.4 Contig56 m 398612 399586 - 97% 1905.2 Contig44 m 32600 33892 99% 1906.2 Contig44 m 31080 32615 99% 1908.4 Contig49 p 183369 185828 99% 1 91.1 Contig49 m 20119 20982 98% - 1910.6 Contig56 m 239000 243505 + + 1911.4 Contig56 m 243805 244335 - - 86% 1913.2 Contig53 m 257214 257630 100% 1915.3 Contig53 m 255160 257109 100% 1918.3 Contig56 m 311244 311996 97% 1920.3 Contig33 m 3738 4808 + 1923.2 Contig33 m 2892 3113 + + 1924.4 Contig33 m 2329 2898 + _ 1926.2 Contig53 p 273283 273951 - 98% 1928.2 Contig53 p 273981 275270 99% - 193.3 Contig49 p 21045 22139 - - 97% 1930.3 Contig49 m 42892 43923 94% + 1933.4 Contig56 p 295715 300448 87% + 1934.4 Contig42 m 28475 29512 - 100% + 1935.4 Contig42 p 276466 276828 - 98% + 1939.5 Contig56 p 277056 277634 95% + 1940.2 Contig49 p 78565 80157 + - 98 % 1943.3 Contig49 p 80136 81140 + - 98% + - 1945.4 Contig53 p 167507 169294 - 99% - 1946.2 Contig53 p 169298 170029 - 99% 1947.3 Contig50 p 106081 106968 - - 98% - 1949.4 Contig50 m 106981 107274 - 100% - 195.3 Contig49 p 22114 22965 - 98% 1950.2 Contig53 p 233014 234315 100% 1951.4 Contig53 p 232262 233 032 - 100% 1955.3 Contig55 m 386532 388040 + 92% 1960.2 Contig5O p 65972 66484 + 92% + 1961.3 Contig50 p 49060 49950 - 96% + 1966.2 Contig49 m 176980 177600 - 98% - 1968.1 Contig49 p 176650 176925 + - 97% - 197.3 Contig49 p 22941 24404 96% 1972.3 Contig55 m 238224 239414 99% 1976.2 Contig48 m 86408 88291 - 98% 1978.1 Contig48 m 85785 86507 - 97% 1979.1 Contig48 m 85012 85803 - - 99% 1983.1 Contig48 p 41412 42260 - - 99% 1986.2 Contig48 p 40082 41437 - 97% + 1989.2 Contig53 p 55808 57301 - 98% 199.1 Contig49 p 24389 25549 + - 96% 1990.1 Contig53 p 57129 58001 97% 1992.2 Contig50 p 96880 97956 - - 96% + 1998.3 Contig53 m 282043 283029 - - 98% 2.1 Contig54 p 7066 7698 - + 20.1 Contig54 m 32977 33345 + + 2000.1 Contig53 m 261939 262439 100% + 2006.2 Contig55 p 8818 9483 + + 2007.1 Contig55 p 413535 414476 100% 201.2 Contig49 p 25543 26778 97% 2016.2 Contig56 p 150223 150675 - - 100 % 2017.1 Contig56 p 149611 150183 - - 98% 2019.2 Contig5l m 186827 187576 + 99% 202.3 Contig53 p 147129 149489 + 99% 2020.1 Contig51 m 185959 186597 - 99% 2021.1 Contig51 m 185561 185980 - 99% 2022.1 Contig51 p 185514 185687 - 98% + 2024.2 Contig50 p 79435 79977 98% 2026.1 Contig45 p 44695 44994 80% + 2027.2 Contig45 m 42859 44145 + 2029.2 Contig45 m 41434 42672 - 95% + 2030.2 Contig49 m 26936 28129 + + 2031.2 Contig49 p 138614 138955 + 2034.2 Contig48 m 136325 137179 - 96% 2037.3 Contig49 p 35275 36714 + 96% 2039.1 Contig49 p 29682 30515 + + 204.1 Contig53 p 145639 147006 98 % 2041.2 Contig49 p 28480 29592 94% 2044.2 Contig48 p 57557 59509 - - 98% 2049.2 Contig49 m 44183 45454 89% + 205.1 Contig53 p 144761 145621 + 97% 2051.2 Contig55 p 12067 12564 + - 2053.2 Contig48 p 913 1896 + 98% + 2054.2 Contig5l p 9882 10940 - 97% 2056.1 Contig5l p 6907 7809 - 96% 2057.3 Contig5l p 3624 4694 99% 206.3 Contig53 p 144091 144813 95% 2060.3 Contig46 p 53835 54983 - 100% 2062.2 Contig46 m 55045 55689 + 100% + 2064.3 Contig46 m 56324 56575 100% + 2065.2 Contig46 p 56118 56603 100% + 2066.5 Contig46 p 56724 57 173 100% + 2067.5 Contig46 p 5700 58376 - 100% 2068.3 Contig48 p 130078 131586 + 98% + 207.3 Contig53 m 142476 143771 + 98% - 2070.4 Contig48 p 126562 128229 + 98% 2073.4 Contig5l m 34700 35431 - - 98% - 2075.1 Contig5l m 37420 37815 100% + 2078.2 Contig47 m 46681 46965 + + 2079.2 Contig47 m 45270 46547 93% + 2080.3 Contig39 p 2669 3373 - - 94% 2082.2 Contig46 p 39407 39649 - - 100% 2083.2 Contig46 p 38725 39456 + 100% - 2085.2 Contig46 p 38340 38777 + - 100% 2087.2 Contig55 p 48030 48989 - + + 209.2 Contig36 m 5843 6589 + 100% 2091.1 Contig55 m 316811 317566 97% - 2092.2 Contig55 p 316557 319145 99% 2095.2 Contig5l p 99001 100194 - 95% 2098.2 Contig5l m 98628 98909 95% '+ 2103.2 Contig52 p 101440 103845 + - 99% N 2104.1 Contig37 p 3175 3564 100% - CO

N 0)

CO

  2106.2 Contig37 p 2608 3153 - - 100% 2108.2 Contig45 p 81438 82382 - 99% 211.1 Contig36 p 4667 5851 - 100% 2112.2 Contig48 p 28628 30067 + 2116.2 Contig54 m 71452 71955 96% 2119.2 Contig4l p 75964 77661 + 98% 212.1 Contig36 p 4308 4799 - 100% 2120.2 Contig40 p 10617 11687 - - 97% + 2121.2 Contig4O p 15227 15976 + 97% 2122.2 Contig43 p 28807 30006 + 98% 2127.2 Contig4l p 62316 62687 - 99% 2129.1 Contig41 p 62699 63313 - 98% 213.1 Contig36 p 3226 4227 - 100% 2130.1 Contig4l p 63314 63889 + - 98% 2132.2 Contig4l p 63867 64478 - 98% 2133.1 Contig41 m 64548 64796 98% + 2135.1 Contig4l p 64932 65342 + 99% 2136.1 Contig41 p 65284 66171 100% 2137.1 Contig4l p 66209 66487 100 % 2138.2 Contig4l p 66491 67009 - - 100% 214.1 Contig36 p 2823 3278 - - 100% 2140.2 Contig4l p 66999 67553 - - 98% 2141.2 Contig5l m 16809 16967 + + 2143.5 Contig5l m 20064 21584 96% 2144.3 Contig55 p 267780 268817 - 91% 2146.2 Contig50 m 152863 154005 - - 98% 2147.1 Contig50 m 152485 152835 100% 2148.1 Contig50 p 151378 15 2307 100% + 2149.4 Contig53 p 126515 127813 - 99% 215.1 Contig36 p 2289 2777 - 100% 2150.1 Contig49 m 107367 107894 - - 97% 2151.2 Contig44 p 41026 42417 - - 96% 2152.2 Contig56 m 197442 198038 - 97% 2153.3 Contig47 p 11124 11363 + 2156.3 Contig52 m 49102 50409 - 98% 2159.2 Contig46 p 127607 128428 - 99% 216.2 Contig36 p 1033 2307 - - 100% 2160.2 Contig46 p 130192 131184 98% + 2162.2 Contig56 m 201913 203340 98% 2164.2 Contig56 p 203649 204509 98% 2166.2 Contig48 m 88413 90341 97% + 2167.2 Contig48 m 90554 92077 99% 2169.2 Contig45 p 67426 67854 + 97% 2170.1 Contig45 p 68018 68461 + 97% 2172.2 Contig55 p 83680 84168 + 2173.2 Contig55 p 83159 83683 - + 2174.1 Contig55 m 80578 80886 - + 2175.3 Contig55 m 80356 80577 - + + 2176.3 Contig55 m 110897 111364 + 2177.2 Contig55 p 111374 112039 - + 2180.2 Contig55 p 48956 50470 - + 2188.2 Contig5l m 56047 56799 100% 2191.4 Contig51 m 59014 59529 - 100% 2193.4 Contig48 p 33494 34777 - 100 % 2195.1 Contig48 p 34920 36389 - 99% 2196.1 Contig48 p 363 62 37102 - 99% 2197.1 Contig48 p 37090 37314 + + 2198.1 Contig48 m 37352 37684 - 99% 2199.2 Contig48 m 37725 38468 98% 220.1 Contig44 p 29972 30685 - + 2204.2 Contig56 p 364871 366475 + - 96% 2207.2 Contig56 p 366476 367105 - 96 % 2208.1 Contig56 m 367223 367516 77% + 2209.4 Contig56 m 367547 368536 96% 221.1 Contig44 p 29082 29993 - + 2212.4 Contig55 p 16754 18805 + + + 2213.2 Contig53 m 48480 48932 + 100% + 2217.3 Contig5l m 122528 124399 - 99% 2219.2 Contig54 m 124648 125064 98% 222.1 Contig44 p 28556 29101 + 2220.2 Contig54 p 124301 124963 - 99% 2221.3 Contig5l p 104753 105202 - 97% 2225.2 Contig56 p 176301 177230 97% 223.1 Contig44 m 27631 28530 - + 2230.2 Contig50 m 108772 109404 99% 2231.3 Contig50 m 107472 108779 99% + 2232.1 Contig46 m 116985 117551 - - 98% 2233.3 Contig46 p 116207 116686 + _ 98% 2235.2 Contig52 p 57282 59225 97% 2239.3 Contig52 p 132081 133076 + 2240.2 Contig52 m 133339 133824 98% 2241.2 Contig52 m 133818 134192 99 % 2242.1 Contig47 m 154849 155424 - 98% + 2244 .2 Contig55 p 34509 35120 + 2245.2 Contig55 p 35114 36196 + 2247.5 Contig55 p 36168 37979 + 2250.2 Contig45 p 11577 12230 + _ 95% + 2251.3 Contig53 m 27542 28039 92% + 2252.1 Contig51 p 130939 132033 - - 99% 2253.2 Contig51 p 130333 130923 98% 2255.2 Contig54 m 171626 172522 - 96% 2258.2 Contig55 m 104112 105362 + + 226.4 Contig44 m 26153 27034 96% + 2260.2 Contig55 m 105337 106014 + + 2261.3 Contig55 m 161261 162034 - - 93% + 2264.2 Contig56 p 435357 436682 - 96 % 2266.2 Contig56 p 434150 435448 - 99% 2268.2 Contig56 p 432873 434093 - - 99% 227.2 Contig50 p 45523 46464 - 93% 2270.2 Contig56 m 86198 86578 + 2271.1 Contig56 m 85954 86205 + + 2272.3 Contig55 m 234482 235996 - 99% 2274.2 Contig55 m 236004 237023 - 99% 2275.3 Contig55 p 127253 128290 - + + 2277.2 Contig55 p 128618 128899 + 2279.2 Contig49 p 113883 114656 - + + 228.1 Contig50 p 46477 46656 - - 97% + 2282.4 Contig56 p 206833 208641 - - 99% 2289.2 Contig48 p 123222 123761 - - 98% 2290.1 Contig48 p 122363 123283 98% 2291.2 Cont ig48 p 121301 122362 - 100% 2292.2 Contig55 p 261111 262802 95% + 2293.5 Contig54 p 154352 156745 97% 2295.3 Contig48 m 142854 143399 96% 2297.3 Contig48 m 143330 143803 - - 99% 2298.2 Contig55 m 134262 135566 - - 95% 2299.3 Contig56 p 114216 114683 - 95% 2301.2 Contig56 p 115076 117259 99% 2302.2 Contig5l m 21648 21992 98% 2308.2 Contig46 p 168348 168671 + + 2309.2 Contig46 p 166657 167811 + - 97% 2311.4 Contig55 m 371117 373702 - 98% 2312.1 Contig55 m 370829 371116 - 98 % + 2313.2 Contig55 m 369399 370625 - - 96% 2315.3 Contig49 p 110157 110999 93% 2317.2 Contig49 p 111016 112482 97% 2319.3 Contig42 m 55138 56562 - 100% 2320.3 Contig42 p 53588 55039 99% 2321.3 Contig47 m 105652 106263 - 98% 2322.2 Contig44 m 46545 47288 - 98% 2323.2 Contig44 m 45462 46322 - - 97% + 2324.4 Contig44 p 44152 45291 - 98% + 2328.2 Contig55 p 388278 390869 99% + 2330.2 Contig46 p 144380 146443 - 98% 2333.3 Contig46 p 146545 148728 - 98% 2335.2 Contig56 p 533008 534369 97% + 2336.2 Contig56 p 534412 536484 - - 98% - 2337.3 Contig5l m 146964 147656 - 99% 2339.4 Contig5l m 147601 148743 98% 234.2 Contig50 p 46705 48930 - 99% 2343.2 Contig55 p 305819 306838 98% 2344.4 Contig55 p 306980 309283 97% 2345.2 Contig47 m 103536 103991 96% + 2346.1 Contig47 p 103046 103429 - 91% + 2347.2 Contig47 p 101957 103012 - 92% + 235.2 Contig53 m 63083 64465 98% 2350.2 Contig48 m 17731 18108 - 83% + 2351.2 Contig48 p 17599 18432 94% 2352.2 Contig48 p 18433 19479 88% 2353.3 Contig48 m 19451 20626 95% 2354.2 Contig55 m 186307 186954 - 99% _ 2355.2 Contig54 m 100931 101824 - - 97% 2356.2 Contig53 p 176752 177408 - 100% + 2357.4 Contig56 p 228590 230416 - + 2358.3 Contig5l m 80568 81986 99% - 236.1 Contig53 m 62888 63082 98% + 2360.2 Contig56 p 520200 521270 + 98% - 2361.4 Contig56 m 521370 527024 91% + 2362.3 Contig5l p 152437 153357 + - 99% _ 2364.1 Contig51 p 153306 154490 99% + _ 2365.2 Contig5l p 154521 156299 + - 95% 2367.2 Contig50 m 15535 15933 + + + 2368.5 Contig54 m 83988 85529 - 94% 2369.3 Contig48 m 6 9875 70516 + - 100% 2371.1 Contig48 m 70539 71579 - 97% _ 2372.3 Contig48 m 71633 72022 97% - 2373.2 Contig48 p 47260 48243 + 99% 2374.2 Contig48 p 48553 49464 - + + 2375.3 Contig52 p 128218 128793 - 98% 2377.2 Contig52 m 127035 128015 - 99% _ 238.1 Contig53 p 61569 62993 - 98% + - 2381.2 Contig52 m 125894 127072 96% 2382.2 Contig52 m 125482 125799 100% 2383.4 Contig39 p 49143 49373 + - 2387.3 Contig55 p 297507 298577 99% - 2388.3 Contig55 m 296578 297459 97% 239.1 Contig53 p 60784 61458 97% 2391.2 Contig49 p 10897 11898 84% + 2392.2 Contig49 m 10206 10697 96% + 2395.3 Contig52 p 176847 177977 94% 24.1 Contig54 m 31557 33023 + 240.1 Contig53 p 59751 60809 99% 2400.2 Contig53 p 52389 53321 99% 2401.2 Contig53 p 53322 53972 + 98% 2402.3 Contig41 m 44912 46285 - 100% 2404.2 Contig41 m 43795 44931 - 98% 2406.3 Contig41 m 42737 43828 97% 2407.3 Contig51 m 191412 193793 98% 2409.3 Contig42 p 56686 57420 + 100% 241.2 Contig53 p 57980 59827 - 98% 2410.2 Contig42 p 57574 58845 + 100% 2412.2 C ontig44 m 11014 12684 97% 2413.1 Contig44 m 10652 10867 + 2414.2 Contig44 m 9382 10485 - + 2415.2 Contig47 m 112603 113577 - 95% 2418.2 Contig47 p 111783 112523 + 97%.

  2419.3 Contig47 p 110960 111712 98% 2421.2 Contig53 m 220002 221525 97% 2422.3 Contig48 m 116663 117175 - 98% + 2423.2 Contig48 m 117160 118278 98% 2424.3 Contig49 p 128735 129358 - 97% 2425.2 Contig49 p 129470 130117 - 97% 2426.2 Contig49 p 130209 130778 94% + 2427.4 Contig45 m 91643 92011 + 2428.2 Contig45 p 91233 91619 - + 2429.2 Contig45 m 90197 91141 99% 243.2 Contig56 m 148517 149470 99% 2430.2 Contig55 p 394309 395385 99% 2432.2 Contig49 m 126730 127992 97% 2434.2 Contig49 m 125457 126668 - 97% 2436.2 Contig56 m 302990 304480 - - 96% + 2438.2 Contig56 p 77301 77741 + _ 2439.2 Contig56 p 77137 77460 + 244.1 Contig56 m 147447 148508 99% 2441.2 Contig56 p 75770 77053 + 2442.2 Contig43 m 75266 76591 - - 99% 2443.2 Contig43 p 74407 75246 - 95% + 2445.4 Contig55 p 346267 349176 99% 2447.3 Contig55 p 345075 346076 - 98% 2448.3 Contig55 p 344088 344876 + - 97% 245.1 Contig56 m 146315 147349 - 100% + - 2450.3 Contig43 m 52511 54343 98% - 2453.4 Contig47 p 36235 39030 + _ 2456.2 Contig42 p 48965 49921 - 100% - 2457.2 Contig42 m 48149 48919 - 100% 2458.2 Contig56 p 200733 201881 - 98% 2459.1 Contig56 m 200112 200678 - 99% 2460.3 Contig43 m 22069 23802 + - 99% 2461.2 Contig43 p 21548 21760 + _ 2462.2 Contig43 p 21047 21406 + _ 2464.2 Contig43 m 20673 21026 + 2466.3 Contig52 p 266848 269556 - 95% - 2468.2 Contig54 m 143553 144497 - 97% 2469.2 Contig54 m 144767 146230 - 99% - 247.1 Contig56 m 145394 146179 - 99% - 2471.3 Contig54 p 146263 147339 - 98% 2472.2 Contig52 p 239763 240410 96% 2473.1 Contig52 p 240545 240859 100% 2474.1 Contig52 p 240853 241485 - 99% 2477.1 Contig5l p 30907 31392 - 98% - 2479.2 Contig5l m 31862 32737 - 95% + 248.2 Contig56 m 143990 145393 100% + 2481.4 Contig56 m 61231 62142 97% 2482.1 Contig56 m 60536 61048 - 96% - Ni 2483.2 Contig56 m 60143 60406 - 93% + CO Ni 0)

CO

  2485.3 Contig47 p 123935 124582 97% + 2486.3 Contig49 m 161677 163272 97% 2488.2 Contig49 m 143043 144032 + + 2489.2 Contig49 m 144070 144399 + + 249.4 Contig52 p 297549 299282 98% 2490.2 Contig49 p 144461 144931 + + 2492.2 Contig52 p 35616 35948 + - 95% + 2493.2 Contig52 p 34913 35578 - 98% 2495.2 Contig52 p 34434 34982 - - 98% 25.1 Contig54 m 31103 31582 + _ 250.1 Contig52 p 299279 300508 99% 2501.2 Contig4O p 38209 39480 + - 99% 2504.4 Contig4O p 37208 38215 - 99 % 2506.2 Contig47 m 132564 133628 - 98% - 2508.3 Contig47 m 133619 134782 98% 2509.3 Contig5O p 146573 147010 98% + 251.2 Contig52 p 300542 301417 - 99% + 2510.2 Contig50 p 144653 146515 97% - 2514.3 Contig55 p 289828 290118 - 100% - 2517.2 Contig44 p 86081 87181 + 95% 2518.4 Contig44 m 87240 87869 - 99% 252.2 Contig52 m 301431 302669 - - 98% 2520.4 Contig44 m 87791 88135 - 98% - 2521.4 Contig53 m 242561 243616 100% 2522.1 Contig53 m 243808 244155 + - 100 % + 2523.1 Contig53 p 244324 244743 - 100% 2524.2 Contig53 m 244779 245 492 - 97% 2526.3 Contig56 p 386531 387826 - 97% 2528.3 Contig56 m 311932 312699 88% + 2530.3 Contig47 p 29880 31814 - 95% - 2533.3 Contig47 p 28867 29787 _ 84% _ 2535.2 Contig4O m 54563 55675 - - 100% 2536.2 Contig4O p 55808 57139 - - 95% - 2538.2 Contig55 p 407509 408717 100% 254.2 Contig55 p 4093 6849 + + 2542.2 Contig5l m 105689 107065 - 98% 2544.3 Contig56 p 428750 432649 - 95% 2545.2 Contig54 m 113096 114103 90% + 2546.4 Contig54 m 113946 115451 - 94% 2549.3 Contig36 p 7391 8842 - 99% + 255.1 Contig55 p 6821 7174 + + 2550.2 Contig55 m 327807 329195 - - 98% 2551.2 Contig55 m 329159 329809 - - 97% 2553.3 Contig55 m 329939 330940 - 100% 2555.5 Contig56 p 369375 370547 + + 2557.4 Contig56 m 368573 369052 - 96% 2559.3 Contig4O p 34609 35655 99% 256.1 Contig55 p 7135 7797 + 2560.3 Contig4O p 33902 34498 - 99% 2562.2 Contig4O p 33385 33834 - 95% + 2565.4 Contig41 m 52865 53674 - 97% 2567.2 Contig41 m 4563 5330 - 99% 2568.1 Contig41 m 3950 4378 - 98% + 2569.3 Contig41 p 3162 3887 - 95% 25 70.2 Contig43 m 64993 66153 + - 99% 2571.2 Contig43 m 66126 67073 - 97% 2573.3 Contig55 m 71767 72372 - + 2576.2 Contig46 m 72302 73279 + 100% 2578.2 Contig46 m 73534 74286 - 100% + 2579.2 Contig48 m 66441 66896 - 98% 258.2 Contig55 p 7683 8804 + 2580.2 Contig48 m 65564 66331 - - 99% 2582.3 Contig56 p 465296 465898 - 94% 2585.2 Contig47 p 84972 86738 + 95% + 2587.2 Contig49 p 77654 78526 - 96% 2590.3 Contig51 p 204548 205471 99% 2591.3 Contig51 m 205599 206756 98% 2592.4 Contig55 p 361844 362254 97% + 2593.3 Contig55 m 361861 362634 - 99% 2595.4 Contig55 m 362913 363662 + - 97% 2597.4 Contig46 p 33657 34349 - - 100% 2598.3 Contig54m 180883 181581 + 97% 2599.4 Contig43 m 31671 33359 - 99% + 26.1 Contig54 p 30264 31076 + 2600.4 Contig43 m 33387 34418 - 99% + 2602.2 Contig44 m 12685 13578 100% 2604.3 Contig44 m 13579 15414 99% + 2605.3 Contig54 p 40025 42568 - + 2607.2 Contig54 p 51047 52288 + - 98% 2609.2 Contig54 p 49931 50938 - - 94% + 2611.1 Conti g54 p 49022 49240 83% + 2616.1 Contig54 p 43401 44285 + 2619.1 Contig54 p 42970 43425 + 262.3 Contig42 m 62121 63479 - 100% 2620.1 Contig54 p 42674 43009 - 97% 2622.1 Contig54 p 3813340073 - + 2624.1 Contig54 p 3 554 + 2625.2 Contig50 m 20085 21020 - + + 2626.1 Contig5O p 21133 21804 + 2627.1 Contig5O p 23499 24755 + - 98% 263.1 Contig42 m 63539 65284 100% + 2631.4 Contig5O p 24756 27710 - 99% 2637.1 Contig5O p 70315 70731 - 100% + 2639.1 Contig5O m 77314 77775 + 95% 264.2 Contig42 m 65185 66576 100% + 2643.1 Contig53 p 258216 259628 100% 2644.1 Contig53 p 257737 258120 + 100% + 2645.1 Contig53 m 252511 253491 100% 2646.1 Contig53 p 251907 252410 - 100% 2647.2 Contig53 m 251141 251743 - 100% 2648.2 Contig53 p 249860 250981 + - 99% 2649.1 Contig53 p 245702 246898 - + 2650.1 Contig53 p 241173 242501 + - 100% 2652.2 Contig53 m 239239 240552 - 100% 2653.1 Contig53 m 227848 228192 93% + 2654.1 Contig53 p 227495 227683 90% + 2655.1 Contig53 p 227254 227673 97% 2657.3 Contig53 p 225046 227253 98% 2659.2 Contig55 p 502 996 + 2660.1 Contig55 p 983 1276 + 2661.2 Contig55 p 1221 1838 + + 2662.2 Contig55 p 1823 2554 + + 2665.1 Contig55 p 24873 25163 - + 2666.1 Contig55 m 25296 25622 + 2667.1 Contig55 m 25607 26068 + + 2669.2 Contig55 m 246338 247576 99% + 267.3 Contig51 m 179257 180225 + - 98% 2670.1 Contig55 m 247577 248836 - 99% 2671.1 Contig55 p 248990 249631 - 97% 2674.1 Contig55 p 249701 252391 99% + 2677.2 Contig55 p 252653 254050 + - 100% 268.1 Contig51 m 179040 179276 - + 2680.1 Contig55 p 257935 258630 + 99% 2682.1 Contig55 p 262935 264578 - 93% + 2683.3 Contig55 p 268818 270377 - 96% 2685.2 Contig55 p 271681 272466 98% + 2688.2 Contig53 p 281205 281639 + + 269.1 Contig51 m 178010 179101 - 98% 2690.2 Contig53 p 280065 281204 - 97% + 2695.2 Contig49 p 148478 149104 93% 2696.2 Contig49 p 149173 150738 - 95% 2698.1 Contig49 m 152930 153349 - 98% 27.1 Contig54 p 29610 30263 + 270.1 Contig5l m 177065 177934 - 99% 2700.2 Contig49 m 153313 154554 - 97% 2702.2 Contig49 p 154 618 155514 - 97% 2704.4 Contig49 m 163203 164651 - 97% 2705.3 Contig49 m 164641 165852 - 98% 2706.2 Contig49 m 165977 166876 - - 94% 2709.1 Contig49 p 177567 178601 98% 271.1 Contig51 m 176141 177055 98% 2712.1 Contig51 m 25013 25828 + _ 2713.2 Contig5l m 25993 27000 + 2717.1 Contig5l m 27435 29141 - - 97% + 2718.1 Contig51 p 29268 30647 - 98% + 2721.3 Contig51 m 39661 41946 - - 98% + 2724.3 Contig51 p 42127 43302 - 97% + 2725.1 Contig51 p 43206 43565 100% 2726.1 Contig5l p 43667 43867 + + 2727.2 Contig49 p 46358 49045 + + 2728.1 Contig49 p 45792 46145- - - 97% 273.1 Contig51 p 175515 176069 - - 98% + 2730.1 Contig49 p 39326 40288 97% + 2732.1 Contig49 m 38090 38974 + 93% + 2733.1 Contig49 p 36823 37893 - - 89% 2737.2 Contig49 m 18508 19089 - 93% + 2738.2 Contig49 m 17487 18263 99% + 2739.3 Contig49 m 16733 17521 - - 99% - 2741.2 Contig44 m 102053 102259 + 2742.2 Contig44 p 102309 102515 - + _ 2743.2 Contig53 p 206346 206567 + _ 2745.1 Contig53 p 206934 207152 + + 2747.1 Contig53 m 212 435 213457 - 96% _ 2748.1 Contig53 p 213767 214243 97% + 2749.4 Contig53 m 214284 215546 + - 99% 2751.1 Contig4O m 23593 24363 - 99% 2752.1 Contig40 m 22782 23303 + 100% 2753.1 Contig40 m 22278 22781 98% + 2754.2 Contig4O m 21696 22277 99% 2755.1 Contig4O p 19564 21600 - - 98% + 2757.1 Contig4O p 18913 19374 98% 2759.1 Contig40 p 17938 18912 98% 276.1 Contig55 m 242556 242792 - 100% - 2760.1 Contig40 p 17730 17999 - + 2761.1 Contig4O p 17411 17758 - 100% - 2763.2 Contig40 m 16914 17111 + + 2765.2 Contig40 m 16013 16903 - 95% + 2767.1 Contig40 m 2006 3424 - + + 2769.2 Contig49 m 55789 57639 - 96% 277.1 Contig55 m 241772 242491 - 100% 2770.1 Contig49 p 57644 58357 - 96 % + - 2771.2 Contig49 p 58350 59543 97% 2772.1 Contig49 p 69554 70459 - 97% - 2775.1 Contig49 p 70567 70794 + 2777.1 Contig49 m 70880 71971 - 94% 2778.2 Contig49 m 71956 72480 - 97% 278.3 Contig55 m 239267 241183 98% 2780.2 Contig49 m 72516 73382 97% - 2781.1 Contig49 m 73383 73757 - 99% 2784.3 Contig42 p 79238 79564 + - 100% 2785.1 Contig42 p 75829 76677 100% - 2788.1 Contig42 p 74393 75838 100% - 2791.1 Contig42 p 71734 74157 - 100% 2792.1 Contig42 p 71391 71660 - + + 2793.1 Contig42 m 70547 71560 100% - 2794.2 Contig42 m 68614 70335 - 100% - 2795.1 Contig42 p 58861 59223 - 100% 2799.1 Contig48 m 38556 38960 - 99% + 2800.1 Contig48 p 39290 40063 97% + 2804.1 Contig49 p 112445 113809 98% 2806.1 Contig49 m 117016 117618 99% - 2807.1 Contig49 p 124936 125370 - - 95% - 2808.1 Contig49 p 128188 128580 - 98% 2810.1 Contig49 p 130891 132279 + 98% 2811.2 Contig49 p 132257 133306 - 98% + 2815.2 Contig41 m 53870 55639 + 2816.2 Contig41 p 56182 58359 + - 99% 2818.1 Contig41 m 58410 59606 - 98% - 282.2 Contig53 m 268047 268784 100% - 2820.1 Contig41 m 59607 60461 - 98% 2822.1 Contig41 p 60447 62309 + 97% 2824.1 Contig41 p 71460 71903 100% 2826.1 Contig41 p 78109 79644 99% + 2827.3 Contig41 p 79904 82522 99% + 2828.3 Contig41 p 82606 82911 + _ 283.1 Contig53 m 267495 268037 - - 1 00% - 2830.3 Contig45 p 21481 22104 - + + 2831.1 Contig45 p 22331 23041 82% 2833.1 Contig45 p 23134 24129 - 91% 2835.1 Contig45 p 26014 26910 + - 91% - 2838.1 Contig45 p 26911 28107 - 92% - 284.2 Contig53 m 266431 267564 - 100% 2840.1 Contig45 p 28121 29647 - 91% 2841.4 Contig45 p 29814 31133 - 95% - 2847.4 Contig45 p 38461 39105 - 95% + 2848.4 Contig45 m 39163 39426 + + 2849.1 Contig45 p 39757 40530 93% + 2858.1 Contig53 m 205210 205464 + 2859.2 Contig53 p 203633 204940 - 99% - 286.2 Contig53 m 265922 266464 + - 100% 2861.1 Contig43 p 73575 74438 - 97% 2862.1 Contig43 m 67685 68956 - 96% 2863.1 Contig43 m 67045 67788 - 94% - 2866.1 Contig43 p 63598 64923 - 97 % + 2868.1 Contig43 p 61643 63514 + 98% _ 2869.1 Contig43 m 61278 61583 100% 2873.1 Contig55 m 84965 85960 + + 2874.1 Contig55 p 84158 84934 + _ 2877.2 Contig55 m 79612 80280 - + 2878.2 Contig55 p 75141 75842 + 2879.3 Contig55 m 73627 74961 + + 2881.2 Contig55 m 72633 73565 + + IV 2882.2 Contig48 p 92029 92766 + - 99% - CO Ni 0)

CO

  2884.1 Contig48 m 78487 78768 94% + 2889.2 Contig56 m 428194 428649 + 99% 2891.2 Contig56 m 426200 428203 98% - 2893.2 Contig56 p 423595 426009 - 97% 2898.4 Contig56 m 420698 420934 + 29.1 Contig54 p 29232 29522 + 290.2 Contig53 m 262400 265921 + 100% 2900.2 Contig56 p 419278 420378 97% + 2905.2 Contig45 p 77708 79522 - 98% + 2906.2 Contig45 p 76746 77390 97% 2908.2 Contig45 p 75581 76588 - 98% + 2909.1 Contig45 p 74272 75552 98% 291.4 Contig44 p 65866 67161 - 99% 2910.1 Contig45 p 72535 74043 - 98% - 2911.3 Contig45 m 66824 67198 99% 2914.1 Contig45 p 61952 62623 97% 2915.2 Contig45 m 56619 59432 97% + 2916.1 Contig56 m 520040 520345 - 97% + 2917.1 Contig56 p 519483 520199 - 97% 2919.1 Contig56 m 515128 515355 + 292.1 Contig44 p 65323 65865 - - 99% + - 2920.1 Contig56 p 514374 514946 100% + 2921.3 Contig56 p 507266 510616 - - 96% + 2924.3 Contig44 m 22704 24785 - 96% + 2925.1 Contig44 p 20611 22620 99% 2926.1 Contig44 p 20406 20564 + + 2928.2 Contig44 m 19362 20231 - 99% 2929.1 Contig 44 p 18836 19348 - 99% 293.2 Contig44 p 64030 65301 - 98% + - 2932.2 Contig44 m 6328 8805 - + 2933.2 Contig44 m 5328 6305 - 94% - 2934.1 Contig44 m 3925 5202 97% + 2938.3 Contig44 p 205 3858 98% + 294.1 Contig44 p 63372 64055 - 99% + - 2941.1 Contig52 m 97049 98665 97% 2942.1 Contig52 m 94512 96995 99% 2943.1 Contig52 m 93920 94501 + 100% - 2949.2 Contig56 m 358365 359324 - 99% 295.1 Contig44 p 62864 63349 - - 100% 2951.2 Contig56 p 359726 361783 - + + 2952.1 Contig56 m 361896 363770 - 85% + 2953.2 Contig56 p 364225 364773 96% 2954.3 Contig52 m 23498 24508 - - 99% 2955.2 Contig52 p 29162 29581 - - 99% + 2958.2 Contig52 p 29575 30342 98% 2959.1 Contig52 p 30346 31104 + 97% _ 296.1 Contig44 p 62252 62626 + 99% _ 2960.1 Contig52 p 31112 32215 98% - 2961.1 Contig52 m 32318 33571 - - 98% 2962.1 Contig52 p 33682 34458 - 98% - 2963.2 Contig52 m 42366 43133 98% 2964.1 Contig52 m 43134 43991 98% _ 2965.1 Contig52 p 44163 44477 - 100% + 2966.1 Contig52 m 44480 45376 97% + 2967.1 Contig52 m 45421 45705 - 100% + 2968.3 Contig52 p 45890 48583 76% - 2969.1 Contig53 m 64558 64863 - - 98% 297.2 Contig44 p 61710 62090 - 99% 2970.2 Contig53 m 64881 65435 - 100% - 2972.3 Contig56 m 323201 324955 - + 2973.2 Contig56 m 322880 323161 - + + 2975.2 Contig56 m 322563 322895 + + 2976.1 Contig56 m 322361 322648 - + + 2978.1 Contig56 m 321511 322419 - + 2982.1 Contig56 m 319677 321527 + 2983.1 Contig56 p 319420 319680 - + _ 2985.1 Contig56 m 318799 319164 + + 2986.1 Contig56 m 318269 318838 + + 2987.1 Contig56 m 317642 318247 + + 2988.1 Contig56 p 317318 317605 + + 2990.1 Contig56 p 316851 317330 - + 2991.1 Contig56 m 315382 316488 - - 96% _ 2992.2 Contig56 p 314243 315259 - - 92% 2993.2 Contig56 p 313301 314026 - 95% _ 2994.2 Contig56 p 312863 313255 - - 95% 2995.1 Contig56 p 309823 311085 - - 97% + 2996.1 Contig56 p 309173 309691 + 98% + 2998.1 Contig56 m 308384 308848 + 97% 2999.3 Contig56 p 307366 308247 - - 92% 3.1 Contig54 p 6822 7124 + 30.1 Contig54 p 28991 29266 + + 300.2 Contig43 p 46 000 47781 - 98% - 3000.1 Contig56 p 304917 307223 98% 3001.1 Contig56 p 304644 304823 + + 3002.1 Contig56 m 301583 302824 - 96% 3003.1 Contig56 p 300856 301554 - - 99% _ 3005.2 Contig48 p 51996 52523 + 3008.1 Contig48 m 64939 65592 - 98% - 3009.2 Contig48 m 67167 68123 + + + 3011.2 Contig53 m 161789 162874 - + 3013.2 Contig53 m 161325 161795 96% 3014.1 Contig53 m 160720 161361 - - 97% 3015.1 Contig53 m 159996 160766 - 97% 3016.1 Contig53 m 159545 160066 + + 3017.1 Contig53 m 159194 159544 + + 3018.1 Contig53 m 158359 159219 96% + 3022.1 Contig53 p 154705 154980 - 100% + 3023.1 Contig53 p 154337 154546 + 3024.1 Contig53 p 152886 154184 - 99% 3027.1 Contig56 p 150941 151432 - 99% 3028.1 Contig56 p 150665 150934 - 100% - 3030.2 Contig55 m 106015 106557 + _ 3031.2 Contig55 m 106523 106960 + _ 3035.2 Contig55 p 107019 107624 - + N 3036.2 Contig55 m 110272 110826 + _ CO

N 0)

  304.2 Contig43 m 43061 45910 - 95% + 3041.1 Contig56 p 120462 121664 95% + 3042.1 Contig56 m 120097 120294 + + 3045.3 Contig56 p 118645 120087 - 99% 3046.3 Contig56 m 118221 118781 97% 3047.2 Contig56 p 117973 118644 99% 3049.1 Contig56 p 117222 118001 97% 305.2 Contig51 m 142891 143622 99% 3053.3 Contig48 m 126062 126499 86% 3054.3 Contig48 p 125624 126583 92% 3055.1 Contig48 p 124770 125705 98% 3057.1 Contig48 p 123677 124783 99% 3058.1 Contig48 p 120708 121190 100% + 3059.2 Contig55 p 419253 420044 + 99% 306.1 Contig51 m 141483 142922 99% 3060.1 Contig55 m 418655 419038 96% + 3061.2 Contig55 p 418602 419252 99% 3063.2 Contig55 p 417443 418627 99% 3065.1 Contig55 m 416733 417197 96% 3067.1 Contig55 p 408846 409169 100% 3068.1 Contig55 p 406331 407521 100% 3069.1 Contig55 m 405340 406062 - 99% 307.2 Contig5l p 140927 141469 97% 3070.2 Contig55 m 404293 405312 + 100% + 3072.2 Contig56 m 190992 192803 99% 3074.1 Contig56 p 198106 199032 96% + 3075.2 Contig56 m 204200 204562 95% + 3077.1 Contig53 m 21958 22719 97% 3078.2 Contig53 m 22682 23938 99% 3080.2 Contig53 m 23895 25349 100% 3081.2 Contig53 nor 25561 26097 - 98% + 3082.1 Contig53 m 26262 26786 - 98% 3083.1 Contig53 m 26732 27307 + 97% 3085.2 Contig53 p 28077 30950 98% + 3086.1 Contig53 p 31106 31714 + 100% 3087.1 Contig53 p 31707 32744 - - 99% 3088.1 Contig53 m 32771 33550 100% 309.2 Contig49 m 119391 122780 98% 3091.1 Contig53 m 37453 37764 100% + 3093.1 Contig53 m 39710 40480 98% 3095.1 Contig53 m 40462 41001 98% 3096.1 Contig53 m 40977 41246 100% 3097.3 Contig53 m 41324 42712 99% 310.1 Contig49 p 122902 123675 - 96% + 3101.1 Contig49 p 100453 102348 + 3102.2 Contig49 p 99671 100228 98% 3104.2 Contig49 m 96892 99459 97% 3105.2 Contig49 m 96450 96755 + 3106.2 Contig49 m 94616 96460 96% 3107.2 Contig49 m 94191 94412 + + 3109.2 Contig49 p 93743 94096 + 3110.1 Contig49 p 93148 93756 - + 3113.1 Contig49 p 91157 93160 + 3114.2 Contig49 p 90204 91163 + 3116.2 Contig49 m 89715 90125 + 3117.2 Contig5l m 181258 181983 - + 3118.1 Contig5O p 135939 136310 - 96% + 3119.1 Contig5O m 135659 136453 - 94% 312.3 Contig49 p 123904 124869 98% + 3121.2 Contig50M 136447 137154 - 95% 3124.2 Contig50 p 137300 138337 99% + 3127.1 Contig50M 138666 139430 - 100% + 3128.1 Contig5O p 144071 144601 - 99% 3129.2 Contig5O p 147083 148138 99% 3130.1 Contig5O p 148182 149018 - 97% 3131.1 Contig5O p 149155 149499 + - 100% 3132.1 Contig5O p 154060 154446 - 95% + 3133.2 Contig5O p 154385 155191 97% + 3134.1 Contig55 p 50672 51244 + 3135.1 Contig55 p 50443 50679 - + 3136.1 Contig55 p 43426 43785 + 3137.1 Contig55 p 42851 43375 + + + 3138.2 Contig55 p 41939 42838 + + 3142.2 Contig52 p 12546 13499 94% 3145.1 Contig5l p 100490 100798 - 98% + 3146.2 Contig5l m 100234 101040 98% 3147.1 Contig51 m 94805 95329 - 100% 3148.1 Contig5l p 93871 94731 + - 98% 3149.1 Contig5l m 92548 93645 - 99% + 315.3 Contig48 p 137887 138900 + 3150.1 Contig5l p 91763 92446 99% 3152.1 Contig46 p 37789 38376 + 100% 3153.3 Contig46 p 35885 37846 + - 100% 3157.1 Contig46 p 35466 35897 + 100% 3158.1 Contig46 p 35182 35460 + 3159.2 Contig46 p 34524 35318 + 100% 3160.1 Contig54 m 78711 79331 - - 87% + 3161.1 Contig54 m 77714 78490 - 99% 3163.1 Contig49 p 138969 139274 + 3165.1 Contig49 p 139471 139872 98% + 3166.1 Contig49 m 139958 140611 - 96% 3167.1 Contig49 p 140837 142129 - 100% 3169.1 Contig49 p 142184 142906 98% 317.1 Contig48 m 138934 139956 - 99% + 3172.2 Contig43 m 80019 80918 - 99% 3173.1 Contig43 p 81385 81654 + - 98% 3174.1 Contig43 p 81648 82529 - 96% 3175.1 Contig43 p 82516 83301 - 94% 3177.1 Contig43 p 83277 83762 - 98% 3178.1 Contig43 p 83973 84629 - 98% 3179.1 Contig43 p 84611 86452 + 99% 318.2 Contig48 m 139970 141388 99% + 3181.2 Contig43 m 88225 89379 99% 3184.3 Contig46 m 140860 142122 - 99% 3186.2 Contig46 m 137322 140789 - 99% + 3190.1 Contig46 m 126503 127390 - - 94% 3191.1 Contig46 m 125166 126344 97% + 3193.2 Contig46 p 124409 125110 98% 3196.3 Contig44 p 42479 43987 - 99% + 3198.1 Contig44 m 47234 47797 100% 3199 .1 Contig44 m 48054 49808 97% 3201.1 Contig44 p 53078 55018 + 100% 3205.3 Contig56 p 335981 340345 - 97% 3207.5 Contig56 p 340451 342949 - - 97% 321.3 Contig48 p 53567 54463 - + 3212.2 Contig43 m 23799 24497 + 98% 3217.3 Contig43 m 34496 35749 - 96% 3218.1 Contig43 p 35810 36511 + + 322.3 Contig48 p 54569 54796 - + + 3221.1 Contig43 p 36457 37890 - 100% 3223.1 Contig43 p 37875 38759 - 98% + 3224.3 Contig43 p 38946 41255 + 100% + 3226.2 Contig50 m 78822 79085 97% 3228.1 Contig5O m 84690 84905 + 323.2 Contig48 m 54848 56335 - 97% 3230.1 Contig5O m 84994 85458 - 90% + 3231.1 Contig5O m 85582 85800 + 3232.1 Contig5O m 85971 86342 - + + 3233.1 Contig5O m 86294 87133 - + 3234.3 Contig5O m 87124 87846 + 3235.3 Contig56 p 443439 444020 - 95% 3236.3 Contig56 m 444206 446461 - 98% + 3238.1 Contig56 m 452294 453229 95% 3239.1 Contig56 p 456141 456452 + 100% 324.3 Contig49 m 160975 161676 - + 3240.3 Contig56 m 456543 456878 - - 100% 3242.3 Contig53 m 7361 10084 98% + 3243.1 Contig53 m 6880 7188 99 % + 3244.2 Contig53 p 1210 1977 - 99% 3246.2 Contig47 p 71805 73802 - 95% 3248.1 Contig47 m 70560 71483 + 3249.2 Contig47 p 67801 68496 98% 325.1 Contig49 p 159347 160909 94% 3250.1 Contig47 m 67309 67623 - - 96% + 3251.1 Contig47 p 62996 63430 99% 3252.1 Contig47 p 62076 63032 98% + 3257.2 Contig33 p 933 1391 + 3258.2 Contig33 p 1363 2307 + 326.2 Contig49 p 155911 159276 - 96% + 3260.2 Contig55 m 398427 399434 + 99% + 3263.2 Contig55 p 397202 398425 98% 3265.1 Contig55 m 396103 396999 - - 98% '3267.1 Contig55 p 395435 396055 - 99% + 3269.1 Contig55 p 390859 394104 - 98% 327.2 Contig56 m 510713 512743 - 97% 3271.3 Contig5l m 64736 66802 - 99% 3272.1 Contig5l m 66845 67288 - 100 % 3273.1 Contig5l p 67395 67838 - 100% 3275.1 Contig5l p 67835 69160 - 97% + 3276.2 Contig5l m 69289 69438 93% + 3277.2 Contig5l p 69443 70258 - 98% 3278.1 Contig5l m 70313 70750 - 98% 328.1 Contig56 m 512598 513521 - 98% 3280.1 Contig5l m 70844 71740 - 99% 3281.1 Contig5l p 71741 72040 - 97% + 3282.3 Contig5l m 76582 77901 - 100% + 3283.1 Contig5l m 77820 78542 - 100% 3285.3 Contig43 p 11250 12326 - 95% 3288.3 Contig43 p 10583 11272 - - 97% 3290.1 Contig43 m 9457 10470 - 99% + 3291.2 Contig43 p 8871 9356 100% + 3295.2 Contig43 p 4645 7437 - - 100% 3297.3 Contig56 p 414188 415258 - 98% 3299.3 Contig56 m 412674 413180 + 33.1 Contig54 m 26172 28868 + 330.2 Contig56 m 513518 515047 - 99% + 3301.2 Contig56 m 411031 412473 98% 3303.2 Contig56 m 406350 407627 95% + 3304.2 Contig56 m 404967 406145 + - 99% 3306.4 Contig56 m 403870 404619 + - 100% - 3307.4 Contig56 p 400664 400867 + + 3308.4 Contig56 p 400486 400734 + + 331.2 Contig36 m 8894 10513 100% 3311.1 Contig52 p 55754 57133 - 98% + _ 3312.1 Contig52 p 59352 59669 98% 3314.2 Contig5l p 46 753 + + 3316.1 Contig5l m 1154 2896 96% + 3319.1 Contig5l m 11064 12434 96% + 3322.2 Contig53 p 91234 92052 98% 3323.1 Contig53 p 92027 92644 - 100% 3324.1 Contig53 p 92655 93068 + - 99% - 3326.2 Contig53 m 101235 102038 - 100% 3327.1 Contig52 p 221944 222768 - 96% + 3328.1 Contig52 p 222755 224497 - 98% 333.3 Contig36 p 10752 14054 - 100% 3331.1 Contig52 p 224570 225568 96% 3333.1 Contig52 p 228335 228760 - 99% 3334.2 Contig52 p 228944 229807 97% + 3336.2 Contig47 p 76579 77034 + 93% + 3337.2 Contig47 m 77247 77543 - 90% + 3338.1 Contig47 p 77766 78158 + + 334.5 Contig41 m 8929 11910 97% 3341.2 Contig47 p 78359 81394 - + + 3343.1 Contig47 m 81608 82249 + + 3345.2 Contig47 m 82458 84782 98% + 3346.2 Contig55 p 56297 58270 - + 3347.1 Contig55 p 58332 59138 + + _ 3348.2 Contig55 p 59139 60737 + 3349.3 Contig55 p 60738 61637 + 335.1 Contig41 p 12010 12723 - 98% 3350.3 Contig55 p 61771 62142 + 3351.3 Contig55 p 62162 63334 + + 3352.1 Contig55 m 63363 63833 - + 3353.1 Contig55 p 63922 65490 + + - 3354.1 Contig55 p 65511 66116 + + 3355.2 Contig55 m 68675 69007 - + 3356.2 Contig55 m 68952 69212 - + 3357.2 Contig55 m 69452 69934 + + 3359.2 Contig4O m 50090 52309 99% - 336.1 Contig41 p 12734 13735 - 99% 3360.1 Contig4O p 46986 47717 + - 89% + 3362.1 Contig4O p 46177 46929 - 97% 3363.2 Contig4O m 44988 45944 - 99% - 3365.2 Contig4O m 43915 44994 - - 95% 3367.1 Contig4O p 39438 40316 - 98% 3368.2 Contig52 p 82091 82516 97% + 337.2 Contig41 m 13745 15148 - 92% + 3371.2 Contig52 m 80548 81924 - - 100% 3374.1 Contig52 m 75741 76907 - 94% - 3376.1 Contig52 m 71343 72434 - 96% 3378.2 Contig52 m 69468 71318 - 98% 3385.1 Contig51 m 127494 128615 - 99% - 3386.1 Contig5l m 128733 129023 - 100 % 3388.1 Contig5l p 132395 133510 - 98% 3389.1 Contig51 p 15296 15880 + + 3390.1 Contig5l m 134639 134893 - 100% 3391.2 Contig5l m 134835 137117 99% 3394.1 Contig39 p 6091 6318 + + 3395.2 Contig39 m 6445 7326 + + 3396.1 Contig39 p 7740 8249 + + 3397.1 Contig39 m 8412 8972 - 89% 3398.1 Contig39 m 8984 9424 - 87% 3399.1 Contig39 m 9506 9724 - 92% + N 34.1 Contig54 p 25266 26048 - + + CO Ni 0) 3401.2 Contig39 p 10196 10510 + + 3402.2 Contig39 m 10565 11563 - 95% 3404.2 Contig39 m 11457 12302 91% 3406.2 Contig39 p 12883 1 3545 + + 341.6 Contig4l p 16002 16445 + + + 3411.2 Contig56 p 234499 235608 + 3413.2 Contig56 p 235844 236812 - + 3414.3 Contig56 m 237027 238826 + 3415.2 Contig48 m 7689 8420 - 97% 3416.1 Contig48 m 7125 7490 - 100% 3417.1 Contig48 p 6528 7109 100% 3418.1 Contig48 p 1 852 96% + 3419.3 Contig45 m 20115 20882 92% + 342.2 Contig53 p 234284 235549 - 100% 3421.2 Contig45 p 18675 20015 96% + 3423.3 Contig45 m 17254 18540 - 91% 3426.1 Contig45 m 16078 16782 - 97 % 3428.1 Contig45 m 15087 15905 - - 96% 3429.1 Contig45 p 12616 14904 - 95% + 343.1 Contig53 p 235534 235995 100% 3431.3 Contig45 p 10009 11346 - 98% 3432.2 Contig45 p 8936 10051 95% 3437.1 Contig5l m 50610 51767 96% + 344.1 Contig53 p 236025 236402 - 100% 3442.3 Contig5l m 54463 55263 98% 3444.1 Contig5l m 55371 55877 - 98% + 3445.3 Contig5l p 59617 60657 + 99% 3446.1 Contig5l p 60510 61739 98% 3447.1 Contig5l p 61720 62166 - 97% + 3450.2 Contig54 p 110251 111336 98% 3451.1 Contig54 p 109351 110169 - 95% + 3453.1 Contig54 p 107695 109209 90% 3454.1 Contig54 p 106841 107404 - 91% + 3455.3 Contig54 m 161013 162041 - - 97% + 3456.4 Contig54 m 160503 161009 + + 3459.3 Contig54 m 159106 160590 98% 346.2 Contig53 p 236327 237358 100 % 3461.4 Contig54 p 152359 154266 97% + 3463.1 Contig54 p 151330 152202 - 100% 3465.2 Contig54 p 149702 151381 + 100% 3466.1 Contig44 p 27076 27321 + 3468.2 Contig53 p 172891 174162 99% 347.1 Contig53 m 237431 238357 100% 3472.1 Contig5O m 98100 98402 97% 3473.1 Contig5O m 98526 99380 92% + 3476.1 Contig5O p 99459 100595 - 98% 3477.2 Contig5O p 100596 101333 99% 3480.4 Contig54 m 66923 68722 - 98% 3481.2 Contig54 m 66646 66918 - 100% 3483.3 Contig54 m 63171 63917 92% 3484.1 Contig54 m 62317 62967 - 93% + 3485.1 Contig54 p 61495 62223 87% + 3486.1 Contig54 m 61261 61521 + + 3488.1 Contig54 m 58908 61016 - 86% + 3489.2 Contig54 m 52297 53340 94% + 349.2 Contig53 m 238592 239380 100% 3494.2 Contig36 p 706 1026 + 100% 3496.2 Contig36 p 96 590 100% 3498.1 Contig 55 p 130156 130584 + + + 3499.1 Contig55 p 124882 125178 + + 35.1 Contig54 p 24187 25053 + 98% + 350.3 Contig49 p 65586 66236 98% + 3500.3 Contig55 p 123593 124777 - + + 3502.3 Contig51 m 210312 210839 + 97% 3503.2 Contig51 m 209099 210298 - 99% + 3504.1 Contig51 m 208578 209129 99% + 3506.1 Contig51 p 207724 208368 100% + 3507.1 Contig51 m 207278 207652 98% + 3508.2 Contig5l m 206726 207028 - 97% 3509.2 Contig5l p 203513 204547 98% 351.1 Contig49 m 66378 66824 - 91% 3511.2 Contig51 p 202374 203537 98% 3512.1 Contig51 m 200543 202108 - 97% 3514.1 Contig5l p 199903 200154 + + 3515.2 Contig51 p 199397 199897 - - 98% 3516.2 Contig51 p 198784 199077 100% 3517.3 Contig52 p 158419 159726 - 99% 3519.1 Contig52 p 161680 162921 - - 98% 3520.1 Contig52 m 163009 164394 + 97% 3521.2 Contig52 p 164484 165635 - 97% 3522.1 Contig52 m 165688 166524 - 99% 3524.1 Contig52 p 166701 167300 - 98% 3525.1 Contig52 p 167624 168361 99% 3527.1 Contig52 p 168334 168732 - 100% 3530.1 Contig56 m 37969 38598 + + 35 32.1 Contig56 p 38652 41942 + + 3533.1 Contig56 m 43296 44021 + 99% 3534.2 Contig56 m 43987 45666 + - 99% 3535.5 Contig56 p 45982 46656 - - 95% + 3536.2 Contig56 m 46690 47052 - 98% 3538.1 Contig5l m 157168 158121 - - 98 % 354.1 Contig49 m 66885 68309 - 97% 3540.2 Contig51 p 161362 163212 - - 93% 3541.1 Contig5l p 140157 140939 - 98% 3542.1 Contig5l p 139288 140169 99% 3543.1 Contig51 m 138482 139159 96% 3544.2 Contig5l m 137403 138500 98% 3545.1 Contig46 p 112319 113317 - 98% 3547.1 Contig46 p 111746 112207 - 99% 3548.2 Contig46 p 110195 111667 97% + 3550.1 Contig46 p 109101 110219 - 98% 3551.1 Contig46 p 108590 109123 + 100% 3554.4 Contig46 p 104831 105469 99% 3555.2 Contig46 p 104305 104856 - 99% 3556.2 Contig55 m 312219 312647 - 97% 3557.1 Contig55 m 317987 318523 98% + 3559.2 Contig55 m 319237 320562 97% + 3561.2 Contig53 p 82655 85069 99% 3562.3 Contig53 p 81579 82721 - - 99% 3563.2 Contig56 p 537264 537611 + 3564.2 Contig56 m 536875 537150 - 100% + 3566.1 Contig56 m 528497 529690 - 98% + 3568.3 Contig56 m 527089 528615 - 99% 357.2 Contig49 m 68395 69129 - 98% 3570.2 Contig49 m 9817 10080 + 3572.1 Contig49 m 12027 12509 96% 3574.1 Contig39 m 21501 22601 95% 3575.2 Contig39 m 20124 21500 + 98% 3578.2 Contig5l m 170732 172456 - - 88% + 3581.1 Contig51 m 164333 165085 - 93% 3582.2 Contig51 p 163197 164072 89% 3584.1 Contig39 m 51193 51399 + 3586.2 Contig39 p 46123 47250 - 88% 3588.2 Contig39 p 45192 45809 - 98% 359.2 Contig49 m 69080 69700 95% 3591.2 Contig53 p 217448 218038 - 100% 3592.1 Contig53 p 218007 218450 - 99% 3593.1 Contig53 p 218407 219393 - 98% 3594.1 Contig53 m 219507 219902 + + 3595.1 Contig53 m 221578 221850 - 97% 3596.1 Contig53 p 221926 222321 100% 3597.3 Contig53 m 222331 222921 - 98% 3598.3 Contig53 p 223164 223358 + + 3599.4 Contig53 p 223351 224187 - 99% 36.1 Contig54 p 22191 24158 98% 360.3 Contig49 p 136479 138278 97% 3600.2 Contig47 p 35321 36292 + 3601.1 Contig47 p 33973 35130 + 3602.2 Contig47 p 31894 33795 - 87% 3607.2 Contig45 m 85993 87189 97% 3608.1 Contig45 m 85559 85888 - 100% + 3609.1 Contig34 p 5143 5745 - 99% 3610.1 Contig34 p 5784 6974 99% + + 3611.2 Contig34 m 7103 7888 - 98% - 3612.2 Contig34 m 8026 8814 96%

* 3613.3 Contig34 p 9024 10349 97% 3614.3 Contig48 m 100655 101728 - 99% - 3617.2 Contig44 p 71658 72077 - 100% 3618.2 Contig44 p 72070 74055 + 99% 3619.1 Contig44 p 77256 77771 - 100% - 3621.2 Contig44 p 77720 79261 99% - 3622.3 Contig56 m 499393 500466 - 99% 3623.2 Contig56 m 498982 499392 100% 3625.2 Contig56 m 497609 498991 - 97% - 3626.1 Contig56 m 497301 497801 99% + 3629.2 Contig46 p 123454 124431 - 99% 3631.4 Contig55 m 39466 39723 - + + 3632.3 Contig55 m 31318 34410 - + 3633.3 Contig5O p 101324 102286 + 98% 3634.1 Contig5O p 102287 102892 100% 3636.1 Contig5O p 102978 103520 + 100% 3637.1 Contig50 p 103508 104485 + 98% - 3638.2 Contig50 p 104476 105135 - 97% 364.2 Contig49 p 134520 136475 - 98% - 3640.2 Contig5O p 105120 106100 - 99% - 3641.1 Contig5O m 109367 110134 99% - 3642.2 Contig5O m 110241 111392 - 99% 3645.3 Contig47 m 137198 137989 94% 3647.2 Contig47 m 134722 134958 - + 365.4 Contig49 p 133354 134355 - 98 % 3650.1 Contig47 m 131389 132657 97% 3651.1 Contig47 m 130551 131399 - 98% 3652.2 Contig47 m 129748 130578 - 98% 3653.3 Contig47 m 801 1010 - + 3655.1 Contig47 m 1280 1993 - + + 3657.1 Contig47 m 5811 6452 - + _ 3658.1 Contig47 p 6810 7100 + + 3659.2 Contig47 m 8757 9299 + + 366.2 Contig52 p 72814 73131 - 91% + 3661.4 Contig47 m 9263 10255 + + - 3663.1 Contig48 p 16350 17441 + + 3664.1 Contig48 p 15069 16226 + 3665.1 Contig48 p 14015 14953 - + 3666.2 Contig48 p 12768 14036 - + - 3667.1 Contig48 p 12363 12653 - 100% + 3669.1 Contig48 m 10859 11821 - 99% 3670.2 Contig48 p 9712 10764 - 97% + 3671.2 Contig48 m 8410 9171 - 96% - 3673.2 Contig47 m 47107 48360 - 94% 3674.2 Contig55 m 331754 332569 + - 3675.1 Contig55 m 332739 333086 - 98% 3676.2 Contig55 m 333068 334462 - 99% 3679.3 Contig55 m 334405 335460 99% 368.2 Contig52 m 73211 75703 - 93% 3680.1 Contig55 p 339922 341073 + 98% 3681.1 Contig55 p 341052 341744 97% - 3682.1 Contig55 p 341754 342179 95% 3683.2 Contig55 p 342284 342532 - - 100% 3684.2 Contig42 p 1367 2128 - 100% + 3685.1 Contig42 p 22 10 2536 - 100% 3686.1 Contig42 p 2533 4083 - 100% 3687.1 Contig42 p 4196 5224 100% - 3688.1 Contig42 m 5536 5817 100% 3694.2 Contig51 m 84535 85659 - - 99% - 3697.4 Contig5l m 88097 91603 - - 98% 3699.3 Contig52 p 207457 210069 96% + 37.1 Contig54 p 21218 22264 - 91% 3701.1 Contig52 p 206268 207071 97% 3702.1 Contig52 p 205289 206050 - 99% - 3703.1 Contig52 p 204682 205314 - 98% 3705.1 Contig52 p 203934 204731 98% 3706.2 Contig52 p 202699 203940 99 % 3708.1 Contig52 p 201767 202480 99% 3709.1 Contig52 p 201015 201863 - 96% 371.1 Contig56 p 214213 214563 + + 3710.1 Contig52 m 199795 200760 - 98% 3711.1 Contig52 m 199322 199801 100% 3712.2 Contig52 m 198472 199365 - 98% 3714.3 Contig56 p 286765 289398 97% + 3720.2 Contig48 p 112836 113633 - 97% + _ 3721.1 Contig54 p 149133 149618 - 100% 3729.1 Contig39 m 57019 57618 + 3730.1 Contig39 m 57909 58367 + + 3731.1 Contig39 m 58368 58904 + _ 3732.1 Contig39 p 59289 60173 + _ 3734.1 Contig39 p 60441 61568 + 3735.2 Contig39 p 61850 63517 - + + 373 7.1 Contig56 p 5344 6447 + - 94% + 3739.3 Contig56 p 4848 5291 - - 99% 374.2 Contig56 m 212175 213962 - 90% 3740.3 Contig56 m 4089 4625 100% 3741.1 Contig56 m 2635 3855 - - 98% + 3742.1 Contig56 m 2352 2624 92 % + 3743.1 Contig56 m 1999 2334 + - 96% + 3744.2 Contig56 p 629 1834 + + 3747.2 Contig46 m 3742 4659 + - 100% - 3748.1 Contig46 m 4653 6005 - 100% 3750.2 Contig46 p 6131 7858 + 100% 3752.2 Contig46 p 7797 8543 + 100% 3753.2 Contig46 p 8556 10478 + - 100% - 3754.2 Contig46 p 10557 11339 + 100% 3756.2 Contig46 p 11314 12657 - 100% 376.3 Contig56 p 151338 152423 + 98% 3760.3 Contig45 m 93555 95363 + - 99% 3761.1 Contig45 p 93268 93459 + + 3763.1 Contig45 p 92636 93379 - + 3764.3 Contig45 p 92316 92675 - + + 3765.1 Contig45 m 89250 90209 - 98% 377.1 Contig56 m 152501 153340 - 99% 3771.2 Contig54 m 165491 166123 99% 3772.2 Contig54 m 168194 169255 97% + 3778.2 Contig54 m 172504 172809 - 98% 3780.2 Contig54 m 102158 102685 - 95% 3783.1 Contig54 m 100438 100734 - 94% 3784.2 Contig54 m 99 175 100311 98% 3785.2 Contig54 m 98361 99386 99% 3788.1 Contig54 m 97597 98373 - 99% 3789.2 Contig54 m 96578 97606 - 98% 3791.1 Contig54 m 95344 96318 94% + 3792.1 Contig54 m 94897 95136 + + + 3793.3 Contig54 p 93867 94790 + - 94% 3796.3 Contig54 m 93107 93736 - 99% 3797.1 Contig54 m 92077 93171 - 96% 3798.1 Contig54 m 91480 91875 - 99% + 3800.4 Contig54 m 89808 90146 - 100% + 3801.2 Contig54 m 88195 89649 + 98% 3802.2 Contig56 p 180508 181905 100 % 3803.1 Contig56 p181817 182977 100% 3804.2 Contig56 p 182964 183833 - 98% 3807.2 Contig56 p 183917 184408 - 99% 381.6 Contig56 m 153410 156961 - 89% + 3810.1 Contig47 p 158615 159328 - 97% 3811.1 Contig47 m 157863 158390 - + 3814.1 Contig53 m 111272112147 + - 98% 3815.2 Contig53 m 116186 116506 - 100% 3816.2 Contig53 p 116694 117437 + 99% 3818.1 Contig53 m 117666 117950 100% 3819.2 Contig53 m 118126 118455 - - 100% 3821.1 Contig42 p 52422 53600 - 100% + 3822.2 Contig42 p 51526 52095 100% - 3824.2 Contig42 p 49884 51209 100% - 3826.1 Contig42 m 47150 48148 - - 100% 3827.2 Contig42 m 45005 46999 100% 3830.2 Contig41 p 7864 8817 96% + 3832.1 Contig41 p 6654 7868 97% - 3834.1 Contig41 p 5573 6613 - 96% + 3835.2 Contig41 p 2208 2951 - 96% 3837.3 Contig41 p 521 2047 92% 3838.3 Contig52 p 289389 291629 - 99% 384.3 Contig45 m 108189 109274 - + 3840.1 Contig52 p 291630 292769 - - 99% 3841.2 Contig52 p 292848 295433 85% 3846.2 Contig5l p 172718 175288 95% 3849.1 Contig52 m 314722 315453 - 99% 3850.1 Contig52 m 314297 314740 97% 3851.1 Contig52 p 314121 314300 - + 3853.2 Contig52 m 312450 313760 98% 3855.1 Contig52 m 307661 308464 - - 98% - 3857.3 Contig52 m 306327 307457 + 98% - 3859.2 Contig53 p 278522 279865 99% 3860.2 Contig53 p 277948 278538 - 100% 3863.2 Contig5O p 122748 123362 - 98% 3867.2 Contig50 m 121146 122486 - 99% - 3871.1 Contig56 p 252925 253329 + + 3872.1 Contig56 p 252637 252915 + + 3874.1 Contig56 m 252199 252504 - 95% + 3876.1 Contig56 p 251633 252130 - 92% 3878.1 Contig56 m 248247 251330 - + + 3884.2 Contig47 p 22460 22942 - 96% + 3887.1 Contig47 m 20607 21833 + + 3888.1 Contig47 m 20390 20593 + + 3889.1 Contig47 m 19632 20417 + _ 389.3 Contig45 p 59965 61974 - 98% 3890.2 Contig47 p 18284 19642 + + 3891.2 Contig47 m 17492 18145 + + 3892.3 Contig41 m 27384 28613 - - 99% 3895.2 Contig41 m 26209 27321 + - 99% 3898.2 Contig52 m 302744 303340 - 98% + 3899.2 Contig52 m 303353 303835 98% + 39.1 Contig54 p 20125 21258 93% 390.2 Contig45 p 59678 60028 99% 3901.2 Contig52 p 303849 304757 99% 3902.3 Contig52 m 304877 306370 - - 98% 3904.3 Contig56 p 278644 286721 - 97% + 3909.3 Contig52 p 121603 123297 97% + 3911.2 Contig52 p 123484 125370 - 99% 3913.2 Contig52 m 128905 130032 + - 100% 3914.3 Contig52 m 130020 131921 + - 99% 3916.3 Contig44 p 84579 85955 - 97% 3917.1 Contig44 p 83374 83652 - + 3919.1 Contig44 p 82297 83229 - 98% 3920.1 Contig44 p 81957 82331 - 100% 3923.2 Contig46 p 158658 160574 - - 99% 3924.2 Contig46 p 156244 157134 - 98% 3925.2 Contig46 m 1546 79 155944 99% + 3927.2 Contig46 p 149681 151072 98% 3928.1 Contig53 p 107241 109073 - 99% 3929.2 Contig53 p 109621 111270 + 99% 393.1 Contig48 p 108405 108956 100% + 3933.3 Contig54 p 115898 117001 - 96% + 3936.2 Contig55 m 236965 238269 - - 99% 3937.2 Contig55 m 233166 234512 - 98% 3938.2 Contig55 m 232591 233181 98% 3942.2 Contig46 p 97130 98077 - 99% 3950.2 Contig56 p 91527 93143 + - 94% 3953.1 Contig56 m 87959 89164 99% 3956.2 Contig53 p 50175 50906 98% 3957.1 Contig53 m 49907 50113 + + 3958.1 Contig53 m 48942 49568 + _ 97% 3959.2 Contig53 p 43842 45401 97% 396.4 Contig48 m 107186 108082 98% 3960.2 Contig53 m 42957 43676 - 93% 3962.2 Contig46 p 88158 88514 - 100% 3964.1 Contig46 p 87172 88179 100% 3965.1 Contig46 p 86726 87241 100% 3966.1 Contig46 p 85386 86165 - 100% 3967.1 Contig46 p 84548 85108 + 100% 3968.1 Contig46 p 84058 84474 100% 3969.1 Contig46 m 83279 83998 + 100% 397.2 Contig39 p 3491 4015 100% + 3970.1 Contig46 m 82868 83266 - 100% 3971.2 Contig46 m 82354 82878 - 100% 3972.2 Contig46 p 81539 82297 - 100% + 3974.2 Contig46 p 80784 81344 - 100% 3977.2 Contig53 m 187318 189588 - - 97% 3979.2 Contig53 p 185478 187220 + 98% 398.2 Contig39 p 3990 5279 - 96% + 3980.1 Contig53 p 184907 185500 - 98 % 3982.2 Contig53 m 184332 184934 + 98% 3985.1 Contig55 p 212031 212642 - 99% 3986.1 Contig55 m 210767 211888 - - 97% 3988.3 Contig55 p 209183 210673 96% 3989.1 Contig55 m 285321 285770 - 99% 399.2 Contig40 m 3481 5943 + + 3991.3 Contig55 m 280182 281885 - 95% 3993.2 Contig55 p 226063 226629 - 87% + 3994.5 Contig55 m 224983 225843 - 98% 3995.5 Contig55 m 223444 224850 - 98% 3996.2 Contig55 m 219910 220161 93% + 3998.3 Contig50 m 125025 125495 96% 3999.3 Contig50 p 123480 125441 - 99% 4.1 Contig54 p 5766 6818 + 400.1 Contig40 m 5934 6746 + 4000.2 Contig55 m 159161 159628 97% -4002.2 Contig55 m 157251 159182 + 95% 4003.1 Contig55 m 153639 155102 - 96% 4004.2 Contig55 m 151865 153652 98% 4005.2 Contig55 m 351176 352696 99% 4009.1 Contig55 m 352663 353715 99% 401.2 Con tig40 p 6795 8066 + 4010.1 Contig55 m 353830 354234 100% + 4012.1 Contig55 m 354228 355055 98% 4013.1 Contig55 m 355006 355788 - 100% 4014.1 Contig55 m 355789 356577 99% 4015.1 Contig55 m 356602 357495 - 99% 4016.1 Contig55 m 357458 358642 - - 98% 4017.4 Contig55 m 358638 360716 - 99% 402.2 Contig4O p 8321 9913 + + + 4020.2 Contig55 p 380396 382096 - 99% 4021.2 Contig56 p 95342 95935 - - 98% 4023.2 Contig56 p 95838 97349 - 99% 4025.1 Contig56 p 97336 98541 98% 4026.2 Contig56 p 98511 99701 + 97% 4030.1 Contig56 p 102167 102703 - 79% + 4032.3 Contig56 m 102700 103668 99% 4035.1 Contig56 p 71831 72199 - 80% + 4036.2 Contig56 p 71116 71400 + 4037.2 Contig56 m 70837 71115 + 4039.2 Contig56 m 69539 70852 - + 4040.1 Contig56 p 69187 69486 + 4041.1 Contig56 p 68024 69148 + 96% + 4042.1 Contig56 p 67106 67858 96% 4043.1 Contig56 m 66641 67078 - 98% 4045.2 Contig56 p 65724 66335 + + 4047.3 Contig56 m 16291 17385 + 99% 4048.3 Contig56 p 17493 19334 100% 405.3 Contig56 m 169767 171719 - 98% 4050. 1 Contig56 p 19403 20197 + - 98% 4051.2 Contig56 p 20206 20601 + - 98% 4054.2 Contig56 p 20585 21265 99% 4055.1 Contig56 m 21293 23185 - + + 4056.2 Contig56 m 23266 24495 99% 4058.2 Contig56 m 24583 24942 + + 406.1 Contig56 m 171982 172845 98% 4060.1 Contig47 m 148533 149945 - 97% 4061.1 Contig47 m 148048 148587 - 99% 4063.1 Contig47 m 146659 148047 97% 4065.3 Contig47 p 144790 146553 98% 4066.2 Contig47 p 144222 144818 96% 4067.2 Contig46 m 59556 59759 100% + 4068.2 Contig46 p 58873 60171 - 100% 407.4 Contig56 m 172815 174182 - 99% + 4070.3 Contig56 p 479535 480974 99% 4071.1 Contig56 m 478863 479441 95% + 4072.1 Contig56 p 475378 476064 98% 4073.1 Contig56 p 474278 475393 - 99% 4075.3 Contig45 m 95380 95859 98% 4076.1 Contig45 m 96123 96674 95% + 4078.1 Contig45 m 98517 99893 97% 408.3 Contig48 p 42286 43932 + 99% 4080.2 Contig45 p 100247 101554 + 97% 4082.2 Contig50 m 167817 169130 - - 92% 4083.3 Contig55 p 173810 174493 - 98 % + 4084.2 Contig55 p 172650 173840 - 97% 4087.2 Contig55 m 168470 169795 - - 97% 4088.2 Contig55 p 167432 168376 97% 409.2 Contig48 p 43914 45074 - 98% 4093.1 Contig55 p 304199 305635 - - 98% 4094.2 Contig55 p 302741 304198 - - 97% 4096.1 Contig43 m 20278 20760 + 4097.1 Contig43 p 20045 20302 - + 4098.1 Contig43 p 19655 20044 - + 410.1 Contig48 p 45028 45756 99% 4101.1 Contig43 p 19176 19379 + 4104.2 Contig50M 12430 13818 + 4105.1 Contig50M 13740 14561 + + 4106.1 Contig50M 14509 15180 + + + 4107.1 Contig50M 15176 15646 - + + 4108.1 Contig5O m 17675 18538 + + 4109.2 Contig5O m 18522 19115 + + + 4111.2 Contig42 p 18460 19557 100% 4112.1 Contig42 p 17634 18518 100% 4113.1 Contig42 p 17043 17633 100% 4115.1 Contig42 p 12639 13736 100% 4116.3 Contig42 p 12007 12717 - 100% 4118.3 Contig42 p 11344 12006 100% 4119.2 Contig42 p 10583 11368 100% 412.3 Contig48 p 45684 46946 + - 98% 4123.2 Contig39 p 34046 34300 75% 4126.2 Contig39 m 32977 33888 + + 4127.1 Contig39 m 32613 33146 + + 4128.1 Contig39 m 32401 32640 - + 4129.1 Contig39 m 31995 32513 + + 413.5 Contig45 m 48015 50384 + 4130.2 Contig39 m 31603 32019 + + 4131.3 Contig39 m 30592 31416 + 94% 4132.3 Contig39 m 30161 30625 99% 4133.1 Contig37 p 20866 21078 + 4134.1 Contig37 p 21059 21334 - - 100% 4135.1 Contig37 p 21381 21788 100 % 4136.1 Contig37 p 21789 22130 - 99% 4138.1 Contig37 p 22137 22697 - - 100% 4139.1 Contig37 p 22698 23012 - 100% 4140.1 Contig37 p 22960 23430 99% 4141.1 Contig37 p 23421 23987 100% 4142.3 Contig37 p 23941 24357 100% 4143.3 Contig37 p 24358 24873 - 100% 4144.3 Contig37 p 24855 25061 + 4145.3 Contig37 p 25049 25495 100% 4148.3 Contig37 p 25483 26826 - 99% 4149.1 Contig37 p 27019 27390 100% 415.2 Contig45 p 46532 47668 + 4151.1 Contig37 p 27411 27812 - 100% 4153.1 Contig37 p 27826 28449 + 4154.2 Contig37 p 28468 29460 99% 4156.3 Contig42 p 34991 35854 - - 100% 4157.2 Contig42 p 35845 37275 - - 100% 4158.1 Contig42 p 37269 38429 + 100% + 4159.1 Contig42 m 38443 39345 100% 4160.3 Contig42 m 41300 42163 100 % 4161.3 Contig42 m 42188 43207 - - 100% 4162.2 Contig5l p 117747 120260 97% 4164.1 Contig5l m 116858 117592 + - 99% 4165.1 Contig5l m 116295 116864 + - 97% 4167.4 Contig5l m 112666 116331 + 98% 4168.2 Contig47 p 116698 117213 98% + 417.3 Contig45 m 45095 45925 - + + 4170.1 Contig47 m 113730 116510 97% 4171.4 Contig56 p 384054 384602 + - 98% 4172.2 Contig56 m 385948 386391 98% 4174.1 Contig56 p 388061 388519 + - 100% + 4175.1 Contig56 m 388616 389545 - 98% 4177.2 Contig56 m 389619 391223 97% 4179.2 Contig55 m 189807 191867 + 418.4 Contig46 m 131572 132249 + - 100% 4181.1 Contig55 m 185668 186306 - + + 4184.1 Contig56 p 462305 462637 99% 4186.1 Contig56 p 461427 462320 - 98% 4188.1 Contig56 p 460258 461391 95% 419.2 Contig46 132432 133271 98% 4191.1 Contig56 p 458774 460276 - 98% 4192.2 Contig56 p 101959 103278 99% + 4195.3 Contig52 m 67104 68273 + 99% 4197.2 Contig52 m 61258 63633 99% 42.1 Contig54 p 19373 20170 + 95% 4200.2 Contig47 m 174124 174822 - 9 9% + 4203.2 Contig47 p 172808 174076 - - 100% 4205.2 Contig47 p 171437 172408 91% + 4206.2 Contig47 p 168685 171516 - 97% + 4209.2 Contig55 m 133049 134221 - + + 421.2 Contig46 p 133283 134725 99% + 4211.2 Contig54 m 134827 136197 92% 4212.1 Contig54 p 136221 137318 - - 97% 4214.3 Contig54 p 139523 141115 96% 422.3 Contig46 p 134726 135649 - 98% 4220.2 Contig45 m 107870 108175 + - 4221.3 Contig45 p 107390 107692 - 97% - 4222.3 Contig45 m 106907 107263 97% 4225.1 Contig47 p 105500 105769 - 94% + 4226.2 Contig52 p 174266 176896 - 98% 4227.1 Contig52 p 170259 171749 - 98% 4228.2 Contig52 m 168692 170233 99% 423.2 Contig47 m 13262 14566 + - 4231.2 Contig44 p 93455 94969 - 97% + 4232.3 Contig44 m 92543 93277 97% 4233.3 Contig50 p 5113 5352 + + 4234.3 Contig50 m 4788 5267 + + 4236.3 Contig50 m 2778 4787 - + - 4238.1 Contig50 m 2294 2842 - + + 4239.4 Contig50 p 1918 2205 + + 424.1 Contig47 m 12935 13252 - - 96 % 4242.2 Contig52 p 210147 211148 - - 95% 4243.2 Contig52 m 211272 211772 - 95% 42 44.1 Contig52 p 211897 212304 + + + 4246.2 Contig52 p 212331 213194 96% 4247.2 Contig48 p 20746 21615 76% + 4248.1 Contig48 p 24264 24533 + - 4249.1 Contig48 p 24436 25785 96% 425.1 Contig47 m 12661 12954 + + 4250.1 Contig48 m 25684 26193 + + 4251.2 Contig48 m 26261 27592 + + 4253.1 Contig46 m 164822 166306 - 100% 4254.2 Contig46 p 163752 164525 96% + 4255.1 Contig46 m 163658 164020 100% + 4259.2 Contig55 m 330931 331806 97% 426.3 Contig47 p 11669 12370 - + + 4262.2 Contig55 m 327355 327813 - - 98% - 4266.3 Contig48 p 146551 147867 99% 4267.5 Contig49 m 178670 180760 - 99% - 4269.3 Contig49 m 182594 183289 - 95% + 427.3 Contig55 m 313737 314516 - - 99% - 4272.3 Contig49 p 185939 186634 - - 98 % + 4273.1 Contig55 p 368190 369320 97% 4275.2 Contig55 p 367445 368293 + 97% 4276.2 Contig56 m 221531 223492 - + 428.1 Contig55 p 314611 315411 100% 4281.2 Contig56 p 220863 221168 + + 4282.2 Contig56 m 220040 220858 + 4284.2 Contig56 m 218914 219987 + - 4285.1 Contig56 m 218497 218913 + + 4288.2 Contig52 m 113583 114581 + - 97% - 4289.2 Contig52 m 114538 115254 + 99% 429.2 Contig55 m 315524 316543 98% 4291.1 Contig52 m 115152 115556 + - 98% 4293.2 Contig52 p 119803 120579 - - 99% - 4294.3 Contig5l m 146041 147027 - 99 % 4295.3 Contig51 p 148722 150056 - 99% 4296.1 Contig5l p 150005 151357 98% 4297.2 Contig5l p 151324 151899 - 97% 43.1 Contig54 p 18684 19421 - 95% 4301.1 Contig46 m 62455 63360 100% 4302.1 Contig46 m 61621 62454 - 100% 4303.1 Contig46 m 60495 61640 99% 4305.2 Contig55 m 164470 164892 - 90% + 4307.2 Contig55 m 159772 161094 95% + 4309.2 Contig56 m 15077 16219 97% + 431.1 Contig53 m 95892 96227 99% + 4310.1 Contig56 m 14610 15161 - 97% + 4311.1 Contig56 p 13958 14506 96% 4312.2 Contig56 m 12373 13725 98% 4316.4 Contig54 m 129491 131527 - 97% + 4319.2 Contig54 m 125030 125764 + 98% + 432.1 Contig53 m 94806 95345 99% + 4320.1 Contig49 p 191146 192534 + 99% 4321.2 Contig49 p 188394 191069 99 % 4322.1 Contig49 m 187330 188436 96% - 4323.1 Contig49 m 186671 187360 - 98% 4325.3 Contig5l p 216364 217314 97% + 4326.1 Contig5l p 217278 218063 96% 4327.1 Contig51 p 218064 219191 97% 4328.1 Contig5l p 219146 220381 + 98% 433.1 Contig53 p 93919 96957 99% + - 4332.1 Contig55 p 177722 178267 98% 4333.1 Contig55 p 178294 179169 95% 4334.1 Contig55 p 179170 180063 98% 4336.2 Contig55 p 180168 181493 100% - 4337.3 Contig55 m 193708 194001 + 97% 4338.3 Contig55 m 194087 194995 - 97% 4339.1 Contig55 m 194986 196857 97% 434.3 Contig53 p 93248 93892 99% 4340.2 Contig55 m 196896 198794 97% 4341.3 Contig46 p 22769 23065 100% + 4342.1 Contig46 p 23446 23700 + 4344.1 Contig46 p 23660 24961 - 100% 4345.1 Contig46 p 24955 25716 100% 4346.2 Contig56 m 158924 159877 99% - 4347.2 Contig56 p 159936 160262 + 98% 4349.2 Contig56 p 160489 161322 + - 100% 4350.2 Contig56 p 161323 162489 98% 4351.2 Contig56 p 162510 163424 98% 4352.3 Contig56 p 163425 164372 98% 4353.2 Contig56 p 486710 487144 100% + 4354.2 Contig56 p 486613 486870 + + 4355.2 Contig56 m 485369 486358 98% + - 4356.2 Contig56 m 484717 485379 - 99% 4357.3 Contig47 m 121371 122663 - 97% - 4358.2 Contig47 m 122641 123207 96% - 436.4 Contig49 p 104371 104940 96% + 4363.2 Contig47 p 127205 127927 - 98% 4364.2 Contig52 p 274900 275220 97% 4365.4 Contig50M 161394 161951 86% 4366.1 Contig5O m 160879 161298 91% 4367.1 Contig5O p 159936 160592 - 82% + 4369.1 Contig5O p 159079 159750 88% - 4370.1 Contig5O p 158463 159020 - 98% + 4371.1 Contig50M 157168 158067 99% 4372.3 Contig5O p 155848 157050 + - 98% - 4373.3 Contig51 m 105349 105768 - 97% 4374.4 Contig51 m 107058 108635 - 99% 4376.3 Contig52 p 246162 246848 - 97% - 4377.4 Contig52 m 246921 247985 96% + 4378.2 Contig56 p 56210 56911 - 95% - 4379.1 Contig56 p 56884 57786 - - 94% 4381.2 Contig56 p 57812 59134 + - 99% 4383.2 Contig56 p 59183 60082 + 97% 4384.2 Contig52 m 134261 135727 99% 4385.1 Contig52 p 135914 137590 99% + 4386.2 Contig52 p 137514 139124 - - 98% 4387.3 Contig45 p 117746 118360 93% IV 4388.1 Contig45 m 118391 119677 100% Ni o, 4389.2 Cont ig52 p 282782 284104 + 99% - 4391.1 Contig52 p 284105 284953 - - 97% 4392.1 Contig52 p 284954 285220 + 4393.1 Contig52 p 285109 285819 - 96% 4394.4 Contig52 p 285823 287865 - - 98% 4395.2 Contig41 m 17210 19366 - 99% 4396.1 Contig41 m 19330 19821 - 98% 4398.2 Contig41 m 20000 21013 99% 44.1 Contig54 p 17665 18708 94% _ 440.4 Contig56 p 280671 285386 - 95% 4402.2 Contig54 p 180142 180759 - 92% _ 4403.2 Contig54 p 179417 180214 91% 4404.1 Contig54 m 178929 179393 - 94% 4405.1 Contig54 p 178381 178899 98% 4406.1 Contig54 p 177700 178284 - - 99% 4407.1 Contig54 p 176950 177201 - + 4408.1 Contig54 m 176920 177180 98% + 4409.1 Contig54 m 176087 176728 - - 100% 4415.3 Contig5l m 214705 215997 - - 100% - 4419.2 Contig55 p 429883 430851 - 99% _ 4421.2 Contig49 p 599 1414 - + 4422.1 Contig49 p 1499 1792 + + 4424.1 Contig49 p 1861 2124 + + 4425.1 Contig49 p 2147 2680 - 94% - 4427.1 Contig49 m 3129 3356 + + 4428.1 Contig49 p 3412 3774 + + 4429.2 Contig49 m 3570 3890 91% + 443.3 Contig53 p 80802 81 404 99% 4431.2 Contig47 p 181989 184718 - 91% + 4432.2 Contig53 m 72795 73247 - 97% + 4433.1 Contig53 p 73488 74099 - 98% 4434.1 Contig53 m 74253 75062 - 92% + 4435.4 Contig53 p 75252 77324 - 94% + 444.2 Contig53 p 80346 80738 - 96% + 4440.1 Contig52 p 6110 6532 - - 99% 4442.1 Contig52 m 4989 5945 98% 4444.2 Contig52 260563 - 78% + 4454.4 Contig52 m 260752 261759 95% 4457.2 Contig50 p 130769 131809 - 97% 4462.3 Contig37 p 17413 18021 - 99% 4463.2 Contig 37 p 16754 17416 - 99% 4464.1 Contig 37 p 16396 16731 - - 100% 4465.3 Contig 37 m 15697 16179 100% 4466.3 Contig 37 p 15176 16408 - - 100% + 4468.2 Contig37 p 13110 15197 99% + 4469.2 Contig46 m 12750 13640 - 100% 447.2 Contig53 p 79932 80276 - - 100% 4470.1 Contig46 m 14843 15916 - 100% 4471.3 Contig46 m 17679 18281 + 100% 4472.2 Contig55 m 293013 293819 - - 99% 4473.4 Contig55 m 137527 138237 99% 4474.1 Contig55 m 138206 1387 15 100% 4475.1 Contig55 p 138772 139452 - 98% 4477.2 Contig55 p 139582 142005 - 98% + 4479.2 Contig55 p 142158 142640 99% 448.1 Contig53 p 79662 79931 - 100% 4480.4 Contig55 m 142691 143992 - 97% 4481.1 Contig55 m 30697 31317 - + + 4482.1 Contig55 p 29686 30615 + 4483.2 Contig55 m 28848 29474 + + 4484.1 Contig54 p 121446 122228 - - 97% + 4485.2 Contig54 p 120515 121345 + 98% 4487.1 Contig52 p 184719 185408 - 97% 4488.1 Contig52 p 183570 184718 - 100% 4489.3 Contig52 p 182170 183339 - 100% 4490.2 Contig56 m 72497 73351 - + 4491.3 Contig56 m 73671 73943 + + 4492.3 Contig56 p 74457 75404 + + 4493.1 Contig56 p 75398 75607 - + + 4496.2 Contig56 p 77914 78756 + + 4497.4 Contig56 p 275092 276381 - - 98 % + 4498.1 Contig56 p 273538 275025 - - 97% + 45.1 Contig54 p 17248 17664 - 80% + 450.1 Contig53 p 79261 79500 + 4500.1 Contig56 p 272747 273112 - + - 4503.1 Contig5l m 194051 195133 99% + 4505.3 Contig51 m 195204 195566 - - 100% + 4508.4 Contig54 p 131646 132248 - - 98% 451.3 Contig53 m 78146 7 9099 97% + 4510.1 Contig56 p 28978 31440 - - 100% - 4511.1 Contig56 p 31527 31847 98% + 4512.4 Contig56 p 32084 33979 98% 4516.3 Contig56 p 82740 83900 + + 4517.2 Contig47 p 96391 97248 - - 92% 4519.3 Contig47 p 92237 93889 97% 4520.1 Contig53 p 131377 132636 - 99% - 4521.1 Contig53 p 130727 131422 - 98% 4522.4 Contig53 p 130084 130770 - 95% 4523.1 Contig4O p 57063 57629 - 96% 4524.1 Contig4O p 57787 58506 + - 91% - 4525.2 Contig4O m 58554 60278 - 98% 4526.3 Contig55 m 364070 364414 - - 96% 4528.2 Contig56 m 226438 227223 - + 453.3 Contig48 p 5528 6304 - - 98% + 4530.1 Contig56 m 226119 226424 + 4531.2 Contig56 m 225684 226010 + - 4532.2 Contig56 p 223941 225431 - + + 4533.2 Contig43 m 12519 18197 + + 4535.2 Contig53 m 137909 139276 + 100% - 4536.1 Contig53 m 139327 140496 + 99% 4538.2 Contig53 m 140456 142003 - 99% IV 454.1 Contig48 p 3988 5505 - 93% IV 4540.2 Contig53 m 142103 142414 + 94% 4542.4 Contig48 p 72350 73981 + 99% 4546.3 Contig48 p 68632 69690 + 4547.4 Contig56 m 382744 38 3787 99% 4549.2 Contig55 p 94210 95664 + 4551.2 Contig47 m 162316 162594 - 100% 4552.4 Contig47 p 162799 163758 89% + 4553.2 Contig49 p 87651 88352 + + 4554.2 Contig49 m 87282 87542 + 4558.1 Contig49 m 85707 86597 - 97% + 4559.1 Contig49 m 83994 85562 + 98% 4560.2 Contig49 p 82681 83823 - - 92% + 4561.2 Contig49 p 81131 82534 - 98% 4564.2 Contig46 p 32890 33672 - - 100% 4566.1 Contig50M 174558 175169 96% 4567.2 Contig50 p 172530 174488 91% - 457.2 Contig48 p 2184 3791 - 94% - 4571.2 Contig46 p 71819 72220 - - 100% 4572.2 Contig46 m 74477 75556 100% 4573.4 Contig46 m 75541 77133 + 100% + 4574.2 Contig56 p 136288 137400 - 95% 4577.2 Contig52 m 281864 282706 - 98% 4578.1 Contig52 m 280373 281584 - - 99% 458.3 Contig52 m 92893 93930 98% - 4580.1 Contig52 m 279617 280120 - 90% 4581.2 Contig52 m 279189 279581 99% + 4584.3 Contig52 m 269691 270662 - 98% + 4587.2 Contig47 p 109974 110486 - 97% + 4588.2 Contig47 m 109240 109881 - 99% + 4589.1 Contig47 m 108456 109088 - 96% + 459.3 Contig52 m 9 2270 92908 99% - 4590.1 Contig47 p 107862 108332 - 100% 4591.2 Contig47 p 107343 107822 94% 4597.1 Contig53 m 195867 196286 - 100% + 4598.2 Contig53 p 196513 197271 99% 4599.2 Contig48 m 161403 162059 + 46.1 Contig54 p 16389 17111 + 93% 460.2 Contig52 p 91747 92295 98% 4600.2 Contig56 m 62433 63200 - - 97% _ 4601.1 Contig56 m 63160 63900 - - 97% + 4602.3 Contig56 p 63958 64875 98% 4604.3 Contig45 m 53037 53615 99% 4607.2 Contig56 m 373694 374998 - 99% + _ 4608.1 Contig56 m 373025 373588 - - 91% _ 4609.2 Contig56 m 372227 372832 - 87% + 4613.3 Contig56 p 370702 372222 + 95% + 4615.3 Contig46 m 2641 3060 100% + 4616.2 Contig46 p 1343 2314 + 99% 4618.1 Contig46 p 588 1376 - 100% - 462.2 Contig52 p 90969 91781 + 94% _ 4620.1 Contig46 p 136 441 - + 4623.2 Contig55 m 150381 150938 - 94% 4625.2 Contig52 p 149995 150963 - - 98% 4626.1 Contig52 p 149012 149989 99% _ 4627.2 Contig52 p 147984 149039 - 100% 4628.2 Contig52 p 147706 148005 100% 4629.2 Contig52 p 147294 147728 - - 98% + 463.2 Contig 52 m 90941 91528 - 95% + 4632.1 Contig55 m 181506 182885 - - 99% + 4633.2 Contig55 p 182895 183470 - 100% - 4634.2 Contig55 m 183488 185485 97% 4636.4 Contig56 p 393601 398376 + _ 464.2 Contig52 p 89686 90996 - - 95% 4640.2 Contig55 p 377831 380395 99% 4642.1 Contig55 m 376740 377243 - 98% + 4643.2 Contig55 m 375511 376461 - - 99% + 4644.3 Contig47 m 167115 168464 - 95% + 4645.2 Contig47 p 165886 167118 99% - 4647.2 Contig53 p 136661 137836 + _ 97% + 4649.1 Contig55 m 322872 323477 - 96% + 465.2 Contig52 p 88842 89729 99% 4650.3 Contig55 m 323544 327368 + 98% 4652.2 Contig53 p 72395 72793 - 97% 4653.2 Contig53 p 71489 72391 - 98% 4655.3 Contig53 p 68083 69438 + 99 %

  4656.2 Contig5O p 181581 183482 89% + 4657.1 Contig5O p 180604 181254 91% 4658.2 Contig5O p 180138 180596 96% 4659.2 Contig50 p 179570 179950 93% + 4660.2 Contig5O m 179180 179395 + + 4662.1 Contig5O m 178485 178745 + 4663.3 Contig5O m 177123 178034 + 97 % 4665.2 Contig52 m 110890 113277 98% 4666.2 Contig48 p 133569 134588 + 98% 4668.1 Contig48 m 132141 133445 98% 4669.2 Contig48 p 131759 132040 97% 4671.3 Contig53 p 121408 122550 97% 4672.1 Contig53 p 120729 121451 - 99% 4673.1 Contig53 m 120233 120505 100% 4676.2 Contig53 m 118452 119846 99% 4678.3 Contig56 m 480971 481381 82% + 468.3 Contig5O p 143679 144107 98% 4680.2 Contig56 m 481393 482142 98% 4683.3 Contig56 m 482069 483433 + 99% 4688.2 Contig56 m 168556 169680 98% + 469.3 Contig5O p 141568 143721 99% 4690.2 Contig56 m 166544 168484 98% + 4691.2 Contig56 p 165075 166451 - 99% 4692.5 Contig52 m 235587 236966 - 98% 4694.1 Contig52 p 233593 235266 - 98% 4695.1 Contig52 p 233502 233720 + + 4696.3 Contig52 m 231883 233508 99% 4699.3 Contig56 p 27452 28756 99% 47.1 Contig54 p 141191 141430 + 4701.2 Contig47 m 140087 140926 93% 4702.1 Contig47 p 139494 140090 - 94% 4703.2 Contig47 p 139054 139539 + 4704.2 Contig47 m 138309 139100 98% 4705.3 Contig40 p 63281 64168 - 98% 4706.3 Contig4O p 64231 64728 - - 97% 4709.1 Contig40 p 64725 65897 99% 4710.1 Contig40 p 66072 66860 + 98% 4711.1 Contig40 p 66832 67404 - 98% 4712.2 Contig40 p 67379 68674 - - 97% 4713.1 Contig56 p 51969 52322 - 93% + 4714.1 Contig56 m 50839 51837 - - 96% 4715.3 Contig56 p 50326 50817 - 95% 4716.2 Contig49 m 147260 148393 96% 4718.1 Contig49 p 146787 147245 - 96% + 4719.2 Contig49 m 145036 146628 + 95% 472.1 Contig50 p 140538 141176 98% 4721.2 Contig53 p 201197 201745 - 99% 4724.2 Contig53 p 200568 201215 - 100% 4725.2 Contig53 m 199470 200573 + 99% 4726.1 Contig53 p 198889 199224 98% + 4727.1 Contig53 p 198224 198724 - 99% 4729.3 Contig53 p 197390 198196 + - 100% 473.2 Contig50 p 139666 140541 - 97% 4732.3 Contig55 m 272544 272921 97% 4733.2 Contig55 m 274618 275526 - 98% 4734.2 Contig5l p 223928 224914 97% 4736.2 Contig51 m 222642 223916 - - 98% 4737.1 Contig5l m 222089 222667 - 100% 4739.1 Contig5l m 221437 222102 - 99% 474.2 Contig43 p 18701 19033 + + 4740.2 Contig5l m 220517 221473 - - 99% + 4742.3 Contig56 p 264520 265437 97% 4744.3 Contig55 m 293795 294718 - 98% 4746.1 Contig43 m 76572 76862 + - 97% 4748.1 Contig43 m 76881 77648 99% 4749.2 Contig43 m 77687 79966 - 98 % 475.1 Contig43 p 18407 18700 + + 4751.2 Contig55 m 202977 204695 97% 4752.2 Contig47 m 141084 142007 98% 4754.1 Contig47 p 142255 143601 97% + 4755.2 Contig47 m 143628 144191 98% 4757.2 Contig56 m 265449 266069 - 92% 4758.2 Contig56 m 266170 266652 95% 4759.2 Contig56 p 266570 267409 98% 4760.2 Contig56 m 267786 268739 - 95% + 4763.2 Contig39 m 41667 42947 - + 4764.2 Contig39 p 41153 41398 - + + 4766.2 Contig53 p 12665 13120 - - 100% 4767.2 Contig53 p 13062 13379 100% 4768.1 Contig53 m 13467 13820 99% 4769.1 Contig53 p 14000 1 4419 - 100% 4770.1 Contig53 p 14512 14700 + 4771.2 Contig53 p 14837 15913 - 96% 4773.3 Contig46 m 49233 50660 + - 100% 4774.1 Contig46 m 50654 50962 - 100% 4775.2 Contig46 m 50943 52103 100% 4776.3 Contig46 m 52470 53033 100% 4777.2 Contig47 p 119435 120775 - 96% + 4778.1 Contig47 p 118604 119269 - 88% + 4779.1 Contig47 p 118015 118479 - 97% 4780.2 Contig47 m 117261 117761 - 95% + 4782.3 Contig42 m 29466 30560 - 100% 4785.1 Contig55 m 201664 202824 - 96% + 4786.2 Contig55 m 199797 201254 + 98% 4788.3 Contig56 m 505287 505961 + - 98% 4790.3 Contig56 p 503795 505126 - 100% 4791.3 Contig56 m 504082 504483 100% 4793.2 Contig56 p 502045 503820 - 99% 4795.1 Contig55 p 350815 351099 87% + 4796.1 Contig55 p 350604 351089 + 96% 4797.1 Contig55 p 349121 350293 - 99% 48.1 Contig54 p 13647 13937 + 480.3 Contig53 p 230827 232278 99% 4800.2 Contig52 p 188179 188973 - 98% - 4801.1 Contig52 p 188964 189461 93% 4802.2 Contig52 p 189554 190114 94 % 4803.2 Contig52 p 150975 151721 - 99% 4804.1 Contig52 p 151758 152054 100% 4805.1 Contig52 p 152038 153312 + 99% - 4806.4 Contig52 p 153313 154311 + 97% 4809.2 Contig56 p 468423 469292 - 98% 481.1 Contig53 p 230355 230837 - 99% 4810.1 Contig56 p 469441 470094 98% + 4811.2 Contig56 m 470268 470777 + 97% 4813.2 Contig52 m 81928 83229 - 99% 4814.2 Contig52 m 83467 84225 - 99% 4815.2 Contig52 m 84536 84952 99% - 4817.4 Contig51 m 110877 112283 98% + 4818.3 Contig5l m 109314 110570 98% + 4819.2 Contig47 p 97143 98192 93% + 482.2 Contig53 m 228193 230004 - 98% 4821.2 Contig47 p 98266 99219 94% 4822.3 Contig50 m 8329 9435 + 4826.2 Contig56 m 472935 473642 + 99% 4830.2 Contig56 p 343121 344029 - 99% 4833.2 Contig56 p 344290 345072 98% 4834.4 Contig42 p 82282 82476 100% + 4835.4 Contig42 m 82095 82778 100% 4836.1 Contig42 p 81668 82159 100% 4837.1 Contig42 p 80754 81683 - 100% 4841.2 Contig42 p 79724 80797 - 100% 4844.2 Contig46 m 160720 161328 - 93% + 4845.4 Contig46 m 161597 163333 - 96% + 4847.2 Contig46 p 29223 29828 100% + 4848.3 Contig46 m 278 29 28851 + - 100% 485.3 Contig 55 p 2536 4023 + + + + 4850.2 Contig47 p 99385 101181 - - 93% + 4851.2 Contig47 p 101415 101942 - 94% _ 4855.2 Contig5l m 191116 191436 - 100% - 4856.2 Contig51 m 190797 191123 - 96 % 4859.2 Contig46 p 94693 95967 99% + 486.2 Contig55 p 3956 4243 + + 4860.1 Contig46 p 95971 96123 + + 4863.4 Contig52 p 315679 317031 - - 99% 4864.2 Contig52 p 317013 317423 - + 4865.2 Contig40 m 72015 72449 100% 4867.2 Contig52 p 139087 140526 92% 4868.2 Contig52 p 140406 141347 - - 98% 4869.3 Contig52 p 141335 141775 - 100% 4872.3 Contig47 m 189409 190986 + - 98% 4873.3 Contig47 m 188249 189448 98% - 4874.2 Contig52 p 143907 145352 - - 77% + 4875.1 Contig52 m 145418 145843 - 96% 4877.2 Contig52 m 145945 147057 98% - 4878.2 Contig53 m 202045 203496 99% - 488.2 Contig53 m 33534 34451 - - 99% 4880.2 Contig56 m 489804 490667 - + 4881.4 Contig56 m 490946 494197 - 94% 4883.2 Contig37 p 189 647 100% 4884.1 Contig37 p 629 1198 - - 99% 4885.2 Contig37 p 1299 1742 - - 100% 4887.3 Conti g52 p 252888 253451 - 97% 4888.1 Contig52 m 252280 252804 96% _ 4889.1 Contig52 m 251793 252218 - 100% 489.1 Contig53 m 34530 34715 + + 4891.2 Contig52 m 250785 251615 - - 99% 4894.1 Contig53 p 167095 167523 96% 4895.1 Contig53 p 166781 167182 + - 93% - 4897.2 Contig53 m 165348 166508 96% - 4900.3 Contig52 p 243257 246211 98% + 4901.3 Contig52 p 241486 243285 - 99% 4902.1 Contig55 p 310700 311026 + 4907.2 Contig48 m 143912 144691 98% 4908.3 Contig55 p 215762 221632 + 98 % 491.1 Contig53 m 34679 35737 97% + 4913.2 Contig39 m 14931 15887 + + 4914.2 Contig39 p 14302 14595 + + + 4916.2 Contig47 p 49917 50837 95% 4917.2 Contig47 m 48380 49735 94% + 4918.2 Contig41 m 24412 25359 - 99% 4919.1 Contig41 m 23043 24431 - 99% 492.4 Contig53 m 35824 36363 - 98% 4920.4 Contig49 m 6970 7851 - 94% 4923.2 Contig51 m 196361 198343 - 99% 4927.1 Contig45 m 50814 51575 + + 4929.2 Contig45 m 51754 52683 98% 493.4 Contig53 m 36559 37296 - 96 % 4930.2 Contig45 m 52692 52979 - 100% 4934.3 Contig47 m 53749 54948 98% 4935.2 Contig47 m 52309 53451 97% 494.2 Contig49 m 30690 31535 + 95% 4941.2 Contig5l m 16060 16500 97% + 4942.1 Contig51 m 15834 16097 + +4943.2 Contig5l m 15275 15778 - 92% + 4945.2 Contig55 p 116406 117425 + 4947.2 Contig55 p 115163 116416 - + 4948.4 Contig56 p 110012 113998 - 96% + 4951.2 Contig39 m 40214 40783 - 90% 4952.1 Contig39 m 39610 40287 - 81% + 4954.2 Contig39 m 39111 39632 93% 4955.4 Contig39 m 37811 39142 85% 4957.2 Contig52 p 155962 156318 98 % 4958.3 Contig52 p 154943 155851 96% 496.1 Contig49 p 31594 32652 85% + 4960.2 Contig51 m 14167 15003 96% + 4961.1 Contig51 m 13669 14061 - - 96% _ 4962.2 Contig51 m 13063 13476 - -96% + 4965.2 Contig42 p 24949 25446 100 % + 4966.2 Contig42 m 25547 27379 100% + 4968.2 Contig36 p 16308 16703 - - 100% 4969.3 Contig36 p 15689 16312 + _ 497.1 Contig49 m 32699 33202 90% + 4972.3 Contig36 p 14883 15563 - 100% - 4974.1 Contig56 m 501054 501593 + 99 % _ 4977.3 Contig56 p 500591 501079 100% + 4979.1 Contig56 p 506583 507191 99% 498.4 Cont ig49 p 33556 34560 92% 4980.3 Contig56 m 505912 506535 + - 99% 4984.2 Contig50 m 188128 188745 - - 97% 4987.2 Contig4O p 70541 71938 99% + 499.2 Contig54 m 72017 73159 97% - 4990.3 Contig52 p 264835 266655 - 94% + 4992.2 Contig52 p 264173 264472 - 98% + 4993.2 Contig52 m 263713 264231 99% 4995.1 Contig47 p 200711 201430 98% + 4998.2 Contig47 m 198880 200607 - 96% + 4999.2 Contig55 m 275562 276383 - 99% 50.1 Contig54 p 13299 13646 + - 82% - 500.2 Contig54 p 73382 74464 + 98% _ 5000.3 Contig55 p 276648 277070 + 98% 5001.1 Contig55 p 277565 278038 - 99% + 5003.2 Contig52 m 195444 196262 97% + 5005.3 Contig52 m 196424 197824 + 99% - 501.2 Contig54 p 74623 75396 - - 96% + 5010.2 Contig46 p 78136 79059 + 100% 5015.2 Contig46 p 79272 79613 - 100% - 5018.2 Contig52 m 231413 231898 98% + 5019.1 Contig52 m 230836 231474 - 99% 502.3 Contig54 m 75598 76065 + + 5021.3 Contig52 m 229852 230601 - 100 % 5022.2 Contig55 p 207980 209053 99% 5026.1 Contig55 m 362635 362964 + 98% 5028.2 Contig56 m 93235 94 818 + 97% + 503.3 Contig54 p 76245 77588 - 98% 5030.2 Contig46 p 148587 149702 - - 99% 5031.2 Contig39 m 27551 28276 - 97% + 5032.1 Contig39 m 28200 28625 98% + 5033.1 Contig39 m 28574 28948 + 99% + 5037.1 Contig41 p 46971 47156 - + 5038.1 Contig41 p 47157 47501 - 100% + 5039.2 Contig41 p 47714 49393 + 99% - 5041.2 Contig44 p 88262 88798 - 100% 5042.1 Contig44 m 88860 89207 98% + 5043.3 Contig44 p 88939 90213 + - 98% _ 5044.2 Contig49 m 14349 15251 - - 98% 5046.2 Contig49 m 15500 15922 - 98% 5047.3 Contig49 m 16011 16757 98% - 505.3 Contig47 m 4559 5503 + + 5050.2 Contig52 p 288634 289383 - - 98% 5052.4 Contig52 p 287980 288597 96% + 5054.2 Contig55 m 150905 151864 - 95% 5056.2 Contig55 p 147059 147427 - + 5058.2 Contig55 m 147683 147949 - + _ 5059.3 Contig55 m 147915 148292 + 506.3 Contig47 p 4108 4518 + + 5060.2 Contig42 p 31581 33122 - 100 % + 5061.4 Contig42 p 33331 35037 - 100% + 5062.3 Contig44 p 91473 92150 - 94% 5064.2 Contig44 p 90483 9124 4 - - 97% + 5065.2 Contig56 p 268942 269424 - 96% 5066.2 Contig56 m 269508 270020 97% 5068.3 Contig53 p 128031 128603 - 96% 5069.3 Contig53 m 128803 129348 - 97% 507.3 Contig47 m 3397 3723 - _ 93% 5071.2 Contig52 p 256486 257511 88% + 5072.2 Contig52 m 255557 256015 82% - 5075.4 Contig52 p 253679 256276 - - 94% 5076.2 Contig47 m 127987 128469 - - 87% 5077.3 Contig47 m 128463 129851 99% 5078.2 Contig55 p 117433 118752 + + _ 5080.4 Contig55 p 119493 120956 - + 5081.3 Contig55 p 118891 119469 + + 5082.3 Contig53 p 122604 124115 - - 98% + 5084.4 Contig56 m 375956 377518 - 96% _ 5087.2 Contig5O p 111723 112805 + + 5088.2 Contig55 m 145313 145738 + _ 509.1 Contig47 m 2774 3367 + 5090.2 Contig55 m 143953 145032 - - 99% 5092.3 Contig4O p 61746 62498 - 98% + 5093.3 Contig4O p 61021 61755 - 98% 5094.2 Contig4O p 60305 61030 - 98% _ 5097.1 Contig56 m 47312 48241 + 99% _ 5098.2 Contig56 m 47027 47311 - 100% + 510.2 Contig47 m 1971 2675 + + 5100.2 Contig52 m 68261 69484 - 96% 5103.4 Contig52 m 1910 93 191497 - 100% - 5104.3 Contig52 m 191571 193376 - 97% 5106.3 Contig55 m 120958 122001 - + + 5108.2 Contig55 p 122110 122373 + + 5113.3 Contig55 p 40350 40982 + + 5114.3 Contig55 p 40999 41910 + + 5115.2 Contig54 p 181805 182791 - 99 % - 5116.3 Contig54 p 182843 183412 - 97% - 5123.3 Contig53 p 182641 182940 100% - 5124.3 Contig53 m 183002 183481 + 5127.4 Contig53 m 183405 183953 98% 5129.4 Contig47 m 185037 188228 + - 99% 5132.3 Contig56 m 190423 190665 + + 5133.3 Contig56 p 189601 190266 99% 5134.4 Contig56 m 188552 189529 + 99% 5135.2 Contig54 m 111413 112909 - - 93% + 514.5 Contig49 m 102459 107018 - - 95% + 5146.2 Contig49 p 88433 89740 + + 5147.1 Contig55 p 122374 123642 + + 5151.1 Contig55 m Contig55 m 97828 98214 + 5153.1 Contig55 m 71343 71813 + 30361 30561 + + 5167.4 Contig43 m 89396 89701 + 5173.1 Contig45 m 87262 89307 - 96% 5174.2 Contig45 m 101564 102016 + 99% + 5176.1 Contig45 m 113642 113920 + + 5177.2 Contig45 p 114007 114765 - 99% 5178.1 Contig5l p 151974 152465 + 99% 5180.1 Contig5l m 137087 137341 - + 5188.2 Contig56 m 440810 442120 98% 5189.2 Contig56 m 442423 442962 + 100% + 519.3 Contig43 m 59604 61277 - - 100% 5193.2 Contig55 p 230456 232594 - - 97% 5194.1 Contig55 m 241056 241625 + 5195.2 Contig55 p 270293 271729 - 98% 52.1 Contig54 p 13132 13347 + 520.1 Contig43 m 59041 59676 99% + 5200.2 Contig5l p 62234 64525 - 99% 5201.2 Contig52 m 1785 2489 - + 5202.2 Contig52 m 2453 2761 + 5204.2 Contig52 m 2762 3238 + 5206.1 Contig52 p 11494 12612 + - 98% 5208.1 Contig48 p 51661 52008 + 521.2 Contig43 m 56667 58832 98% 5216.2 Contig41 m 29032 29880 - - 97% 5217.1 Contig55 p 45 509 - + 5219.1 Contig55 p 10464 11285 - + 5220.1 Contig55 p 23872 24702 - + 5224.2 Contig45 p 21155 21526 + + 5226.2 Contig5l m 195800 196339 99% 5227.2 Contig51 m 195579 195845 + 5229.1 Cont ig51 m 190023 190493 - 99% 523.2 Contig34 m 1137 2051 + 94% 5232.1 Contig51 m 180191 181312 93% 5238.1 Contig53 m 102305 103894 - 98% 524.2 Contig34 p 2016 3128 - 98% 5242.3 Contig56 m 327199 327939 + + 5243.2 Contig56 m 327951 328175 + + 5247.1 Contig56 p 345073 346131 - 97% 5250.2 Contig4O m 53596 54588 - 100% 5253.1 Contig40 m 62587 63249 - - 99% 5254.1 Contig40 p 68650 69366 - - 99% 5255.1 Contig40 p 69367 70545 + 99% 5256.2 Contig42 p 44544 44879 100 % 526.2 Contig34 p 3100 3735 - - 97% 5266.2 Contig44 m 57427 60807 - 89% + 5268.2 Contig5O m 134740 135327 98% 5269.1 Contig5O p 155067 155423 - 94% + 5270.2 Contig5O p 155164 155745 - 95% + 5273.1 Contig43 m 21791 22153 + 5277.3 Contig55 m 403006 404235 - 100% 5278.3 Contig55 m 402203 403054 - 99% + 528.2 Contig34 m 3861 4526 99% 5282.3 Contig54 p 164626 164874 + 5288.1 Contig53 m 162784 163212 + 5289.2 Contig53 m 163191 163865 - 94% 529.2 Contig34 m 4519 4866 100 % 5295.1 Contig55 m 342696 344141 - 99% 5297.2 Contig47 p 90488 91873 + + 530.3 Contig56 m 107831 108436 - 96% 5307.3 Contig55 m 278103 279803 97% 5309.1 Contig55 p 288995 289852 100% 531.4 Contig56 p 105919 107865 - 98% + 5311.1 Contig55 p 302427 302744 - - 100% 5312.2 Contig53 p 164165 164791 - - 96% + 5313.1 Contig53 m 164821 165249 - 87% 5316.1 Contig53 p 180979 182469 + - 99% 5317.2 Contig53 m 192709 193332 - - 97% 5318.2 Contig39 m 29538 30179 96% 5319.1 Contig39 m 29202 29537 - 97% + 532.2 Contig44 m 39785 40900 + 99 % 5321.1 Contig39 m 13921 14205 - + 5322.1 Contig39 m 13558 13917 - + 5324.1 Contig44 m 8763 9419 + 5328.1 Contig55 m 132518 133048 + 533.2 Contig44 p 38923 39735 - - 96% 5334.1 Contig48 p 137595 138359 - 83% 5337.1 Contig48 m 144919 145224 - + 5338.2 Contig48 m 145238 146323 - 100% 5340.1 Contig5O p 186391 187947 - 81% 5341.1 Contig5O p 185774 186055 - - 96% + 5342.2 Contig5O m 185006 185581 - - 94% 5344.2 Contig50M 184198 184968 - 90% 5349.3 Contig47 p 179148 181841 - + + 5354.3 Contig47 p 164077 164319 + 98% + 5359.2 Contig55 m 36366 3 364091 98% 536.3 Contig44 p 36111 38714 98% 5360.2 Contig55 p 361044 361610 - 99% + 5361.2 Contig55 m 360713 361897 - - 99% 5369.2 Contig56 p 206011 206253 - 100% 537.2 Contig42 p 61594 62016 + 100% + 5370.1 Contig56 p 206447 206899 - 98% 5373.1 Contig53 m 36255 36521 + + 5376.2 Contig53 m 17524 21840 - 99% + 5377.2 Contig53 p 16834 17466 95% + 538.1 Contig42 p 60700 61350 - 99% + 5380.3 Contig41 p 16574 17140 97% - 5381.1 Contig54 p 129885 130109 - 100% + 5382.1 Contig39 p 40834 41157 - + + 5386.1 Contig55 m 198790 199812 - 97% 5387.1 Contig56 p 86587 87405 + 5388.1 Contig56 p 87345 87626 - + + 539.3 Contig42 p 59488 60189 - 100% - 5390.1 Contig56 m 94884 95249 - 97 % 5391.2 Contig56 m 103725 105176 - 99% 5398.3 Contig46 p 103240 104304 - 99% 540.3 Contig42 p 59184 59567 100% 5402.1 Contig47 p 27185 28633 - 86% + 5404.2 Contig47 m 26133 27047 + + 5405.2 Contig56 m 259906 260877 + - 97% 5406.1 Contig56 m 253581 255119 - 97% - 5412.1 Contig47 p 106268 107311 - 97% 5413.1 Contig47 p 110 505 110849 - 100% + 5417.1 Contig47 m 120900 121331 - 99% 5420.1 Contig56 p 174276 174809 - + 5421.1 Contig56 p 174790 175281 - 97% + 5422.1 Contig56 p 175516 175929 96% + 5423.1 Contig56 p 176093 176353 - + - 5424.2 Contig56 m 187587 188366 - 98% + 5426.2 Contig40 p 36750 37220 - 100% 5427.1 Contig4O p 36055 36756 - 100% 5428.1 Contig40 p 35656 36054 - 100% - 5429.1 Contig40 p 33195 33449 97% - 543.1 Contig54 p 142846 143115 - 100% + 5437.2 Contig48 p 113664 113978 + - 94% + 5438.1 Contig48 m 104563 105147 + 544.2 Contig54 p 141103 142440 - 96% IV 5440.1 Contig51 m 224949 226127 - 97% + CO Ni 0)

CO

  5446.3 Contig46 p 67332 68681 100% 5447.1 Contig46 P 68866 69651 100% 5448.1 Contig46 p 71292 71837 - 100% 5453.2 Contig53 m 2 1057 + 99% 5455.1 Contig52 m 48635 49105 - 98% 5456.1 Contig52 m 197784 198467 - - 99% 5457.1 Contig52 m 195010 195438 - - 99% 5458.1 Contig56 m 1 294 + 5460.1 Contig46 p 79588 80679 + 99% 5462.2 Contig46 p 88889 90562 99% 5467.1 Contig5l p 11030 11305 - 95% + 5469.1 Contig55 p 430842 431012 + 5470.1 Contig55 p 430963 431283 100% 5471.2 Contig55 m 434805 435017 + 5473.1 Contig50 p 82659 83573 - + 5474.2 Contig50 p 87816 88361 - + 5476.1 Contig55 m 311846 312241 - 98% 5477.1 Contig55 m 311164 311460 - 100% 5478.2 Contig55 p 309284 309784 - 88% 5479.2 Contig46 m 3146 3784 - - 100% 548.3 Contig56 m 402228 403745 + 97% + 5481.1 Contig52 p 109609 110751 + 97% 5482.2 Contig52 p 120600 121508 - - 98% 5484.4 Contig5O m 170954 172321 94% + 5489.2 Contig46 p 22170 22781 + - 100% 549.5 Contig56 p 400978 402165 99% + 5492.2 Contig56 m 484133 484753 + 99% 5496.2 Contig42 p 24434 24973 - 100% + 5497.1 Contig42 p 23074 24090 + 100% 5498.1 Contig42 p 22116 23102 100% 5499.1 Contig42 p 21199 22125 - 100% 55.1 Contig54 p 12574 13131 - - 96% + 5500.1 Contig42 p 19572 21095 100% 5504.4 Contig56 m 227405 228223 + + 551.2 Contig48 p 118410 119204 - 94% 5514.2 Contig46 m 101816 102838 - 89% + 5515.2 Contig46 p 96370 97125 99% 5517.1 Contig50 m 12084 12476 + + 5520.1 Contig42 p 831 1391 + + + 5521.1 Contig42 p 297 830 - 100% 5523.2 Contig53 p 51398 52447 + 97% 5524.1 Contig53 p 50884 51435 - - 99% 5526.2 Contig36 m 6590 7255 + - 100% 5527.2 Contig5l m 83168 83683 - + 5528.2 Contig42 m 30570 31292 - - 100% + 553.1 Contig48 p 119189 119620 - + + 5530.2 Contig42 p 43383 44126 100% 5532.2 Contig56 m 52635 53546 97% 5533.2 Contig56 m 53673 53912 + 5534.2 Contig52 m 59770 61257 - 99% 5535.1 Contig52 p 62267 62506 97% + 5538.2 Contig37 m 29929 30444 99% 5539.1 Contig37 m 29484 29870 - - 98% + 5540.1 Contig37 p 29461 29862 - - 99% + _ 5542.3 Contig56 p 277693 278568 - - 98 % - 5546.1 Contig52 p 143354 143830 - 100% 5548.1 Contig52 m 142688 143068 100% + 5549.2 Contig52 p 141660 142481 99% - 555.2 Contig48 m 119679 120698 - - 96% 5550.3 Contig54 p 173129 174709 - 98% 5552.2 Contig54 p 174713 175861 - 99 % - 5554.2 Contig54 p 183792 184052 + 5555.2 Contig52 p 358 1134 + + 5556.1 Contig52 p 224 484 + + 5557.2 Contig56 m 391235 393079 - 95% + 5559.3 Contig52 m 270701 271255 - 97% + 5560.3 Contig52 m 271292 271954 - 98% 5563.1 Contig52 m 272495 272959 100% 5564.1 Contig52 m 273293 274750 - - 99% 5566.1 Contig47 p 195344 195577 + + 5569.1 Contig47 m 194808 195188 + - 98% + 557.2 Contig56 m 122756 125467 98% 5576.3 Contig5O p 879 1850 + 558.2 Contig56 p 122262 122726 - 98% 5582.4 Contig55 m 165100 167310 - - 94% 5584.2 Contig52 m 262416 263513 + + 5586.1 Contig47 m 123420 123806 - 96% 5587.3 Contig52 p 190081 190959 98% 5588.2 Contig52 p 181821 182123 + 100% 559.2 Contig56 p 121830 122159 97% 5592.2 Contig37 p 1743 2447 - 100% 5593.1 Contig37 m 12853 13182 98% 5 595.2 Contig37 p 12544 13098 - 100% 5596.3 Contig37 p 12164 12550 - 100% 5598.2 Contig45 p 116104 117363 + 99% 5600.2 Contig45 m 122515 122787 - 100% 5602.3 Contig5O p 162005 162481 97% 5605.2 Contig56 p 79041 79460 - + + 5606.2 Contig56 p 379119 379787 91% + 5607.2 Contig56 m 377512 378960 99% 5609.1 Contig56 m 375588 375899 + 561.3 Contig55 m 335735 337042 - 97% 5610.1 Contig56 m 375175 375633 92% 5611.1 Contig56 m 374824 375147 + 5615.1 Contig5O p 91012 91698 - + 562.1 Contig55 m 337055 337672 + - 99% 5620.3 Contig47 p 10879 11130 - - 96% 5621.1 Contig47 m 14589 15851 + + 5623.2 Contig47 m 16093 17499 + + 5626.2 Contig33 m 4971 5936 + 5630.1 Contig39 p 577 1083 91% 5633.2 Contig53 m 10360 11202 - - 98% 5634.2 Contig53 m 11203 11337 + + 5636.1 Contig53 m 11490 11912 99% + 5637.1 Contig53 p 12003 12689 99% 5638.2 Contig53 m 16224 16634 + 100% + 564.2 Contig55 m 337666 340092 - 98% 5642.1 Contig4l m 25302 26252 - 99% + 5644.3 Contig4l m 21132 22817 + _ 98% _ 5645.2 Contig42 p 85779 880 58 - - 100% - 5647.1 Contig42 p 85391 85759 - 100% 5648.1 Contig42 m 84306 84641 100% - 5649.1 Contig42 p 83688 85022 - 100% 5650.3 Contig42 p 82949 83656 - 100% 5652.2 Contig56 p 64957 65739 97% + 5654.2 Contig47 p 51771 52181 - 94% + 5655.2 Contig47 m 50958 51446 - - 99% - 5656.2 Contig48 p 157395 158135 - - 99% - 5660.1 Contig55 p 145939 146925 - + - 5662.1 Contig56 m 381808 382452 - + - 5668.2 Contig48 m 155278 157158 - 97% + 5669.2 Contig48 p 153548 155221 - 99% + 567.5 Contig55 p 13877 16723 - + + + 5671.2 Contig48 p 153153 153584 - 100% 5672.1 Contig46 p 2296 2640 + + + 5675.2 Contig56 m 324956 326062 + 5677.2 Contig56 m 326486 327133 - + - 568.2 Contig55 p 409176 410786 - 99% 5685.2 Contig47 m 191522 192799 - - 98% 5686.2 Contig47 p 192951 193427 98% - 5687.1 Contig47 p 193621 193965 - - 99% + 5688.2 Contig47 p 194152 194715 - 79% + 569.2 Contig55 p 410743 411600 - - 99 % 5690.2 Contig36 p 14241 14747 + 100% - 5694.2 Contig46 p 21689 22165 + - 100% 5695.1 Contig46 p 20906 21688 - - 100% 5696.2 Contig46 p 20113 20913 - 100% + 57.1 Contig54 p 11919 12803 91% + 5701.2 Contig4O m 52481 53623 - 99% IV 571.2 Contig55 p 411503 413557 97% C3) Ni C '> Cfl 5711.2 Contig55 p 229465 230373 98 % + 5719.2 Contig44 p 60988 61779 - 98% 572.2 Contig5O p 131938 133629 + - 98% 5720.1 Contig45 p 1 204 + + 5723.1 Contig45 p 218 523 - + 5724.2 Contig45 p 651 2195 - 89% + 573.1 Contig50M 133783 134067 100% 5730.1 Contig45 m 63648 63923 - 97% + 5735.2 Contig45 p 114761 115966 + 98% 5739.3 Contig53 p 283472 288685 + 574.2 Contig5O m 134078 134701 - 99% + 5741.1 Contig53 m 224214 224969 - 99% 5743.1 Contig55 m 435125 435313 + + 5747.1 Contig55 p 385787 386191 + - 96% + 5761.1 Contig49 p 34545 35045 + 5765.1 Contig48 m 84091 84564 + 5766.1 Contig48 p 92800 93363 + - 98% 5767.1 Contig48 m 113682 114005 93% + 5769.2 Contig48 m 114096 114503 - 99% 577.2 Contig39 p 56130 57014 + 5774.2 Contig39 p 1095 2222 79% + 5776.1 Contig39 m 31406 31666 - + + 5780.1 Contig54 m 166583 166912 - + 5796.3 Contig56 p 399743 400387 - - 96% 58.1 Contig54 m 11098 11802 + 5804.1 Contig51 m 210800 211321 + 100% 5806.2 Contig5l p 108987 109253 100% 5807.1 Contig47 m 137956 138348 - 99% 5808.1 Contig47 m 55003 55581 - - 97% 5809.1 Contig47 p 48148 48435 - 79% + 5812.1 Contig5O m 19757 20260 + + 5813.1 Contig5O m 19540 19761 + 5814.1 Contig5O m 19109 19555 + + 5816.1 Contig44 m 98666 99019 99% 5818.1 Contig44 m 91982 92296 + + 5821.1 Contig44 p 45218 45577 + + 5822.1 Contig44 p 27230 27472 + + 5823.2 Contig44 p 24801 26072 + 99% 5824.1 Contig43 m 80785 81201 - + 5829.2 Contig53 p 129374 130126 + 94% 583.2 Contig45 m 125324 125962 98% 5844.1 Contig55 m 28321 28734 - + 5846.2 Contig55 m 39236 39436 - + + 5848.1 Contig52 m 298199 298495 96% + 585.2 Contig45 m 124480 124830 99% 5856.1 Contig4O m 72914 73102 + 5857.1 Contig4O m 72492 72932 - 97% 5867.1 Contig53 p 37577 37750 94% + 587.2 Contig45 m 123642 124427 - 98% 5871.3 Contig56 m 210934 212142 - + 5872.1 Contig56 m 223532 223738 + + 5874.1 Conti g4O m 2 553 + 5875.1 Contig41 m 1 303 + 5876.2 Contig52 p 179252 179977 - - 99% 588.3 Contig45 m 122879 123670 96% 5890.1 Contig47 m 596 778 - + + 5892.1 Contig37 p 18006 18314 - - 100% 5894.3 Contig37 p 18311 19153 100 % 5895.3 Contig37 p 19163 19450 100% 5896.1 Contig37 m 30492 30977 - + 5897.1 Contig37 p 30844 31131 + 5898.2 Contig34 m 2 862 + + + 5899.1 Contig56 p 157044 157373 100% 59.1 Contig54 p 10665 11108 + 590.4 Contig48 p 158250 161354 - + + 5900.3 Contig50 p 176579 176953 - 84% + 5901.3 Contig50 m 175331 176827 - - 82% 5903.2 Contig46 m 18786 19751 - 100% + 5904.2 Contig46 p 77481 78152 - 100% 5905.1 Contig29 p 747 1703 97% 5906.1 Contig29 m 2 541 - + - 5907.1 Contig55 m 434953 435111 + 591.3 Contig55 p 131637 132476 + 5910.1 Contig55 m 377311 377523 98% + 592.3 Contig5O p 57113 58795 - - 94% - 5920.2 Contig5O p 91731 92939 97% + 5926.1 Contig49 p 59524 59913 - + 593.2 Contig5O m 56568 56918 96% + 5935.1 Contig39 p 9719 9898 87% + 594.1 Contig5O p 55956 56429 + 96% + 5944.1 Contig52 p 98412 98600 - 96% + 5947.1 Contig56 p 443846 444142 + 5950.1 Contig56 m 413084 413554 + + 5952.1 Contig5O p 32298 32483 + 5953.1 Contig5O p 27632 27916 + 5957.1 Contig44 p 83695 84627 + 596.3 Contig52 m 27403 29127 - - 99% + 597.2 Contig52 p 26966 27346 + 98% 5978.2 Contig46 m 18245 18802 100% - 5979.1 Contig46 m 70998 71240 - 100% + 598.2 Contig52 p 26619 26939 + 100% - 5983.1 Contig5l p 8510 8743 - + + 5985.1 Contig47 m 21 398 + 5986.2 Contig56 m 164438 164929 - 98% + 5987.1 Contig33 m 5866 6501 + + 5988.1 Contig56 p 537425 537688 + - 5996.1 Contig56 m 105163 105690 + 98% 5999.1 Contig56 p 49760 50065 - - 100% 60.1 Contig54 m 9838 10008 - + + 600.3 Contig52 p 25859 26539 + 6002.1 Contig56 p 48661 49746 - + 6004.1 Contig55 m 434692 434850 + + 6007.1 Contig55 p 337580 337705 100% + 601.4 Contig52 p 24684 25916 + IV 6015.1 Contig55 p 40166 40540 + + N o, 6016.1 Contig55 m 39777 40088 - + 6018.1 Contig54 m 184053 184367 + + 6019.1 Contig54 p 164875 165402 98% 602.4 Contig55 m 148411 149406 98% 6029.1 Contig53 m 120054 120221 - + 6036.1 Contig52 p 262003 262335 + + 6037.1 Contig52 p 255546 255887 - 81% 6038.1 Contig52 p 247180 247419 96% + 6039.1 Contig52 p 179971 181719 100% 604.3 Contig55 m 149566 150327 96% 6040.1 Contig52 p 178884 179285 + 6042.1 Contig52 p 154287 154949 - 97% 6044.1 Contig52 p 135288 135446 96% + 6049.1 Contig52 m 22855 23631 - + 6052.1 Contig52 m 1145 1837 + 606.3 Contig47 m 40856 42601 + - 95% + 6061.1 Contig51 p 19993 20172 94% + 6062.1 Contig50 p 188912 189430 - + 6064.1 Contig50 p 183848 184141 - 92% + 6066.1 Contig50 p 3 491 + 6070.1 Contig49 p 116472 116879 - + 6071.1 Contig49 p 86822 87034 + 6072.1 Contig49 p 86701 86892 + 6074.1 Contig49 p 3 614 + 6079.1 Contig48 m 126066 126479 - - 83% 6081.1 Contig48 m 107058 107270 + 6083.1 Contig48 p 81259 81510 + + 6086.1 Contig47 m 191153 191521 98% 6087.1 Contig47 m 69577 69876 + + 6089.1 Contig46 m 168652 169203 + 6093.1 Contig46 m 53278 53583 100% + 6094.1 Contig46 m 94 366 + 6097.1 Co ntig45 m 126102 134465 + 6098.1 Contig45 p 117531 117845 + 61.1 Contig54 p 9759 10058 + + 6106.1 Contig43 m 89715 89972 + - 6107.1 Contig43 m 86295 86489 + + 6108.1 Contig42 p 88359 88874 + 6110.1 Contig42 p 24187 24447 100% + 6117.1 Contig39 p 52705 55920 - + 6119.1 Contig39 m 1 531 - + 612.2 Contig47 p 42746 44959 - 96% 6121.1 Contig33 p 1 570 + 6122.1 Contig32 p 3158 3457 + + 6123.1 Contig32 m 3005 3130 + + 6125.1 Contig32 m 2799 3074 + - 6128.1 Contig32 m 1045 2223 - + 6130.1 Contig32 m 74 1048 + 6131.1 Contig3l p 1 2313 + 6132.1 Contig5 m 1232 1546 - + - 6133.1 Contig5 m 943 1218 + - 6134.1 Contig5 m 112 720 + 615.5 Contig4O p 534 1337 - + 616.4 Contig55 p 130624 131685 + 618.3 Contig53 p 2045 2461 100% 619.1 Contig53 p 2371 3357 97% 621.5 Contig53 p 3335 4654 - - 99% 622.3 Contig46 m 99282 101681 + - 99% - 623.2 Contig46 p 98038 99210 98% 627.1 Contig5l p 121353 122504 - - 93% - 628.3 Contig5l p 120526 121188 98% + 63.1 Contig54 m 9066 9281 + + 630.4 Contig56 p 332655 335864 - - 98% 632.2 Contig44 p 54982 55926 98% 633.3 Contig44 p 55984 57357 - 100% 634.4 Contig5l p 75669 76205 - 99% - 635.5 Contig5l m 75191 76447 - - 100% - 636.2 Contig5l m 74029 74943 100% 637.3 Contig5l m 71849 73939 - - 99% 64.3 Contig51 m 226279 228249 97% + 640.2 Contig56 m 193129 194091 - - 97% 641.3 Contig56 m 194043 196091 - 99% 643.3 Contig46 p 90559 92034 100% 644.2 Contig46 m 92079 93134 100% 645.4 Contig46 m 93128 93838 100% 647.5 Contig46 p 94033 94683 100% 65.1 Contig5l m 228321 228539 + + 650.3 Contig53 p 246861 248021 + 651.2 Contig53 m 248091 248534 - + 652.1 Contig53 p 248604 249497 - 96% 656.3 Contig49 p 63581 65569 - 94% + 657.3 Contig49 p 60518 63580 - 96% 659.2 Contig55 m 107629 108609 + 660.1 Contig55 m 108579 109169 + 661.3 Contig55 m 109132 110268 + 663.2 Contig44 p 49960 51945 - 98% 665.2 Contig44 m 51996 52349 - 98% 666.2 Contig44 p 52242 52985 - 100% 667.3 Contig53 m 89749 90402 - 95% 668.4 Contig53 p 88067 91228 + 97% 670.1 Contig49 m 117945 119357 97% 673.3 Cont ig39 m 18568 20133 97% + 675.6 Contig39 m 16069 18072 + - 95% 678.3 Contig39 m 36741 37847 + + 680.3 Contig39 m 36188 36706 - + 681.3 Contig39 m 35343 36095 - + 682.2 Contig39 p 34304 35275 + 683.2 Contig51 m 85735 87123 + _ 99% 684.5 Contig51 m 87313 88107 - - 99% 687.5 Contig53 p 4655 5932 + - 98% 688.1 Contig53 p 5916 6770 - 99% 692.1 Contig53 p 209993 210160 - - 97% + 693.1 Contig53 m 210303 210845 96% 694.3 Contig53 m 210846 212210 + 98% 696.2 Contig51 m 189586 190029 - 100% 697.1 Contig51 m 188795 189424 + - 98% 698.2 Contig5l m 187570 188787 - 99% 699.3 Contig4O m 40345 41484 96% 7.1 Contig54 p 1711 5829 + 701.2 Contig4O m 41465 42997 - 96% 704.4 Contig4O m 42928 43755 - 96% 704.4 Contig50 m 93538 94440 98% + 705.1 Contig5O m 94413 95726 99% 706.2 Contig50 p 95685 96212 97% 707.2 Contig50 m 95702 96757 97% - 709.1 Contig56 p 531595 531951 95% + 711.2 Contig56 m 530771 532873 98% - 712.2 Contig56 m 529698 530726 - 99% + 713.2 Contig55 p 27686 28 033 + + 715.1 Contig55 p 27284 27616 + + 716.1 Contig55 p 26900 27130 - + + 717.2 Contig55 p 26412 26885 + 38% + 719.4 Contig48 p 150832 153201 99% - 722.3 Contig48 p 150016 150708 - 97% 723.3 Contig48 p 148217 150046 - 99 % 727.3 Contig5l m 95296 98532 + 99% 728.2 Contig53 p 152475 152882 99% - 729.1 Contig53 p 151701 152474 99% 730.1 Contig53 p 151252 151707 97% - 731.2 Contig53 p 150075 151127 87% 732.3 Contig53 p 149594 150103 + - 100% 737.1 Contig55 m 112373 113413 - + - 738.2 Contig55 m 113352 113906 + 739.4 Contig55 m 113977 114864 - + 740.2 Contig53 p 47919 48266 - 100% - 741.2 Contig53 p 47095 47721 97% + 742.3 Contig53 p 45729 47141 + 99% 743.3 Contig50 m 31500 31961 94 % IV 744.3 Contig50 p 30803 31477 + Ni o, 747.3 Contig50 p 27917 30127 - 99% 748.3 Contig51 p 17140 18522 98% 749.1 Contig5l p 18871 19188 94% + 750.2 Contig51 m 19419 19598 - + + 751.2 Contig51 p 19507 19821 - 93% + 752.2 Contig51 m 19664 19837 - 92% + 753.2 Contig44 p 17613 18584 + - 98% 754.2 Contig44 m 16437 17450 98% 755.3 Contig44 m 15517 16344 97% 757.1 Contig48 p 97275 97922 - 99% 758.1 Contig48 p 97900 98550 98% + 760.2 Contig48 p 98779 100542 99% + 761.2 Contig55 m 85953 86924 - + + 762.2 Contig55 p 86954 87676 + + + 764.1 Contig55 p 87747 88268 - + + _ 765.1 Contig55 m 88340 89080 + 766.3 Contig55 m 89231 90691 + + + 767.3 Contig51 m 56793 58106 97% - 769.2 Contig51 m 58073 59020 - - 98% - 77.1 Contig44 p 103230 103448 - + + 770.3 Contig52 m 115526 116104 97% 771.4 Contig52 m 119924 117759 - 99% + 774.3 Contig52 p 117790 119229 - - 100% + 775.2 Contig52 p 119230 119802 + 99% 776.3 Contig42 m 6700 8211 - - 100% - 778.2 Contig42 m 8247 9074 100% + 779.4 Contig42 p 9150 10607 99% 783.2 Contig55 m 38018 38377 - + 785.4 Contig55 m 38404 39363 + + 787.3 Contig56 p 487168 489210 - - 99% - 789.4 Contig56 m 489432 489803 + 79.1 Contig44 p 102657 102878 + 790.3 Contig45 m 53670 56318 - 95% + 791.5 Contig54 m 90299 91600 - 97% 793.2 Contig46 m 13696 1 4010 100% + 794.2 Contig46 m 13863 14069 + + 795.2 Contig46 m 14074 14865 - 100% 796.2 Contig55 p 47244 48029 - + + 798.2 Contig55 p 45371 47254 + + + - 799.3 Contig55 p 43996 45474 + + 80.3 Contig53 p 205998 206204 + 801.3 Contig52 p 9080 9829 94% - 802.3 Contig52 p 9968 10765 - - 99% - 803.3 Contig52 p 10775 11470 + - 99% 806.2 Contig50 m 167060 167803 97% - 807.2 Contig5O p 165692 167020 93% - 808.4 Contig5O p 162640 165525 78% + 81.3 Contig53 m 205742 205948 + - 813.2 Contig53 p 275271 276566 100% 815.2 Contig53 p 276554 277786 97% - 817.7 Contig56 p 289615 295440 - - 93% + 818.2 Contig50 m 70763 71647 94% + 819.2 Contig5O m 71690 73171 100% 82.2 Contig44 m 101521 101775 - 100% + 821.2 Contig48 p 106064 106960 - 98% + 823.4 Contig48 m 105148 105969 98% - 825.4 Contig48 m 103305 104558 + - 98% 829.2 Contig42 p 66690 68411 + - 100% - 830.4 Contig55 p 382039 384633 95% + 832.3 Contig55 p 384667 385662 - 94% 833.3 Contig54 p 68959 71343 + 93% - 835.2 Contig55 p 282705 285299 - 99% 837. 2 Contig55 p 281957 282727 - - 100% 838.3 Contig48 m 30280 31686 99% + - 84.4 Contig44 m 99038 100735 96% - 840.2 Contig48 p 31793 32653 - 95% 841.3 Contig48 p 32857 33192 100% 843.2 Contig52 m 295435 296004 - 99% - 844.2 Contig52 m 296047 296436 - 99% 845.4 Contig52 m 296556 297314 98% 847.4 Contig55 m 254244 257435 99% 852.3 Contig54 m 167598 168224 - 98% 853.1 Contig54 m 166885 167625 - 98% 854.3 Contig54 m 166111 166785 96% 856.2 Contig55 p 212770 213318 - 97% + 857.2 Contig55 m 213377 215725 + - 98% 858.2 Contig4O p 26045 26566 - - 97% 859.2 Contig4O p 24703 26091 - 99% + 860.2 Contig56 p 232289 234031 + 862.1 Contig56 p 231881 232144 + + 863.1 Contig56 m 231159 231653 + 864.1 Contig56 m 230660 231064 77% 865.2 Contig50 p 126853 127977 - - 98% 866.2 Contig5O p 125624 126769 - 100% 869.2 Contig53 m 87390 87602 94% + 870.3 Contig53 p 86938 88077 + - 98% 872.2 Contig53 p 86339 86992 - 100% 873.2 Contig53 p 86027 86338 + 96% 874.2 Contig53 p 85470 86042 + 99% 875.5 Contig50 p 88330 89 613 + + 876.1 Contig50 p 89606 90100 - + 879.2 Contig50 p 90587 91051 + 880.3 Contig51 m 100986 102164 - - 99% 881.2 Contig51 m 102053 103141 + - 98% 882.3 Contig5l p 103303 104787 - 98% 884.3 Contig55 p 93167 94135 + + 885.2 Contig55 p 91494 93173 + 886.3 Contig55 m 90736 91527 - + + 887.4 Contig55 m 226955 229195 99% 888.3 Contig41 m 32336 33607 - - 99% 889.1 Contig41 p 31734 32231 + 99% 891.3 Contig41 p 29993 31594 98% + 893.4 Contig55 m 290434 292959 + - 99% 894.3 Contig54 m 123736 124005 98% + 895.3 Contig54 p 122576 123634 - 98% 897.2 Contig48 p 108957 111251 - 99% + 898.2 Contig48 p 111179 112054 - 98% 899.3 Contig48 p 112066 112842 - 98% 9.1 Contig54 p 1049 1552 + 901.2 Contig47 m 63514 64692 - 87% + 903.2 Contig47 p 64977 66098 - 94% + 905.2 Contig47 m 66185 67045 + + 907.4 Contig52 m 276498 279179 - - 99% 908.4 Contig52 m 274806 276458 97% 909.2 Contig41 m 74894 75811 98% 910.4 Contig41 p 72529 74787 98% + 914.3 Contig45 m 110599 112401 98% 915.3 Contig45 m 112344 113216 + 97 % 916.3 Contig53 m 65548 66546 - - 98% 917.3 Contig53 m 66654 66896 - - 100% 918.3 Contig53 p 66802 66963 100% + 919.1 Contig53 p 67100 67537 - - 92% 920.2 Contig53 m 67640 68068 - - 97% + 921.3 Contig44 m 98064 98678 98% 922.2 Contig44 m 97211 98074 + - 98% 923.3 Contig44 m 95217 97235 - 97% + 925.3 Contig41 p 36685 38610 - - 99% 926.4 Contig56 m 446531 447229 97% 928.1 Contig56 m 447359 448597 97% 929.2 Contig56 m 448649 450079 - 97% + 930.3 Contig49 p 52100 53491 - - 99% + 932.1 Contig49 p 53437 54480 - 98% 935.2 Contig49 m, 54481 55269 - 99% 936.3 Contig49 m 55263 55808 - 97% + 937.3 Contig52 m 37875 39305 + 99% 938.3 Contig52 m 35989 37614 90% 94.7 Contig53 p 288516 295643 + + 940.4 Contig53 m 103921 104814 98% 941.3 Contig53 m 104792 106147 - 100% 943.3 Contig53 m 106148 106648 - - 98% 944.3 Contig53 m 106644 107087 99% 946.3 Contig47 m 7965 8639 + 28% 947.3 Contig47 m 7565 7927 + 948.3 Contig47 p 7066 7596 + 949.3 Contig5O p 149500 151377 + 99% + 950.2 Contig47 m 60306 61823 - 8 5% 952.1 Contig47 m 59202 60149 - - 98% 953.2 Contig47 p 57651 59225 89% 956.2 Contig55 m 67701 68516 + 957.2 Contig55 m 66768 67700 + 959.2 Contig55 p 66489 66674 + + 96.6 Contig50 m 32725 33612 - - 99% 960.2 Contig55 p 66059 - 66436 + 964.3 Contig47 m 55765 57123 90% + 965.3 Contig53 p 115497 116042 + 100% + 966.2 Contig53 m 114682 115431 99% 967.2 Contig53 m 113522 114547 - 99% 969.2 Contig53 p 112570 113343 - - 99% 97.2Contig5O m 33710 33985 - 97% + 971.2 Contig52 m 248160 249020 98% + 972.3 Contig52 p 249094 250731 - - 96% 974.2 Contig51 p 5479 6735 - 98% 976.3 Contig5l p 5276 5569 94% 977.3 Contig51 p 4604 5275 94% + 979.3 Contig47 p 93871 95094 94% 980.1 Contig47 p 95095 95814 - 98% 981.2 Contig47 p 95787 96434 - 84% 982.3 Contig52 m 77475 78893 + 98% + 983.1 Contig52 m 78868 79611 98% 985.2 Contig52 m 79583 80569 99% 986.3 Contig41 m 33608 33868 100% 989.3 Contig41 p 34035 35312 98% + 99.1 Contig50 m 34081 34362 - 94% + 991.2 Contig41 p 35832 36698 - + 992.2 Contig45 p 68996 6 9385 100% + 993.2 Contig45 m 68458 69726 - 99% 994.2 Contig45 m 69800 72601 + 99% 995.2 Contig56 p 478195 478866 - - 91% 996.2 Contig56 p 477200 478231 - 98% 997.2 Contig56 p 476065 477177 - 99% 998.3 Contig46 m 40865 42739 - 100% + 999.2 Contig46 p 42796 43959 - 100% + ORF Best-BlastP 285 10.1 Best-BlastP =>> nrprot 47% Identities = 35/90 (38%), Positives = 55/90 (61%), Gaps = 5/90 (5%) dbjIBAC94688.1 j hypothetical protein [Vibrio vulnificus YJ016] Length = 343 1000.2 Best-BlastP =>> nrprot 62% Identities = 120/257 (46%), Positive = 162/257 (63%) , Gaps = 3/257 (1%) COG1024: Enoyl-CoA hydratase / carnithine racemase [Geobacter metallireducens] Length = 272 1001.3 Best-BlastP =>> nrprot 97% Identifies = 419/437 (95%), Positive = 425/437 (97%) gbIAAM00614.11 chemosmotic efflux system protein C-Iike protein [Legionella pneumophila] Length = 448 1002.2 Best-BlastP =>> nrprot 11% Identities = 35/129 (27%), Positive = 64 / 129 (49%), Gaps = 6/129 (4%) refIg_00108772.1 I CO G0642: Signal transduction histidine kinase [Nostoc punctiform] Length = 2053 1003.3 Best-BlastP =>> nrprot No Hits found 1005.2 Best-BlastP =>> nrprot 67% Identities = 126/243 (51%), Positives = 165/243 ( 67%), Gaps = 4/243 (1%) refINP_820690.1 dihydrodipicolinate reductase [Coxiella burnetii RSA 493] spIP24703IDAPB_COXBU Dihydrodipicolinate reductase (DHPR) gblAA091204.11 dihydrodipicolinate reductase [Coxiella burnetii RSA 493] Length = 239 1006.3 Best-BlastP => > nrprot 61% Identities = 96/211 (45%), Positives = 135/211 (63%), Gaps = 18/211 (8%) refINP_520174.1 l PROBABLE TRANSMEMBRANE NADH DEHYDROGENASE I (CHAIN J) OXIDOREDUCTASE PROTEIN [Ralstonia solanacearum] embICAD15760.11 PROBABLE TRANSMEMBRANE NADH DEHYDROGENASE I (CHAIN J) OXIDOREDUCTASE PROTEIN [Ralstonia solanacearum] Length = 210 1009.2 Best-BlastP =>> nrprot 79% Identities = 113/159 (71%), Positive = 132/159 (83%) %) refINP_297604.1 I NADH-ubiquinone oxidoreductase, NQ09 subunit [Xylella fastidiosa 9a5c] reflZP_00039600.1 I h ypothetical protein [Xylella fastidiosa Dixon] refIZP_00041894.1 J hypothetical protein [Xylella fastidiosa Ann-1] refINP_778493.1I NADH-ubiquinone oxidoreductase NQ09 subunit [Xylella fastidiosa Temeculal] pir! IC82822 NADH-ubiquinone oxidoreductase, NQ09 subunit XF0313 [imported] - Xylella fastidiosa (strain 9a5c) gbIAAF83124.11AE003884_9 NADH- ubiquinone oxidoreductase, NQ09 subunit [Xylella fastidiosa 9a5c] gblAA028142.1 I NADH-ubiquinone oxidoreductase NQ09 subunit [Xylella fastidiosa Temeculal] Length = 163 1010.2 Best-BlastP =>> nrprot 82% Identities = 223/332 (67%), Positives = 283/332 (85%) refINP_820424.1 I NADH dehydrogenase I, H subunit [Coxiella burnetii RSA 493] gbjAA090938.1 NADH dehydrogenase I, H subunit [Coxiella burnetii RSA 493] Length = 340 1011.5 Best-BlastP =>> nrprot 65% Identities = 374/800 (46%), Positives = 511/800 (63%), Gaps = 32/800 (4%) refINP_820425.1 I NADH dehydrogenase I, G subunit [Coxiella burnetii RSA 493] gbIAA090939.11 NADH dehydrogenase I, G subuni t [Coxiella burnetii RSA 493] Length = 787 1013.1 Best-BlastP =>> nrprot No Hits found 1014.2 Best-BlastP =>> nrprot 55% Identities = 163/485 (33%), Positives = 254/485 (52%) , Gaps = 36/485 (7%) refINP_711514.1 The putative amidase [Leptospira interrogans serovar lai str. 56601] gbIAAN48532.11AE011313_8 putative amidase [Leptospira interrogans serovar lai str. 56601] Length = 500 102.1 Best-BlastP =>> nrprot 92% Identities = 811/842 (96%), Positives = 830/842 (98%) gbIAAM00631.11 putative cation efflux transport [Legionella pneumophila] Length = 842 Best- BlastP =>> nrprot 76% Identities = 588/1008 (58%), Positives = 775/1008 (76%), Gaps = 4/1008 (0%) refINP_820092.11 transport, AcrB / AcrD / AcrF family [Coxiella burnetii RSA 493] gbIAAO90606.1 I transport, AcrB / AcrD / AcrF family [Coxiella burnetii RSA 493] Length = 1019 Best-BlastP =>> nrprot 47% Identities = 76/278 (27%), Positives = 135/278 (48 % [Acetyltransf, Acetyltransferase (GNAT) family] [Bacillus anthracis A2012] refINP_844481.1I acetyltransferase, GNAT family [Bacillus anthracis str.

  Ames] gbIAAP25967.1 I acetyltransferase, GNAT family [Bacillus anthracis str. Ames] Length = 295 Best-BlastP =>> nrprot 65% Identities = 89/178 (50%), Positives = 126/178 (70%), Gaps = 3/178 (1%) refINP_799717.1 J peptide methionine sulfoxide reductase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61550.1 I methionine sulfoxide reductase peptide [Vibrio parahaemolyticus] Length = 380 Best-BlastP =>> nrprot 54% Identities = 71/193 (36%), Positive = 108/193 (55%) , Gaps = 2/193 (1%) refINP_561497. 1 J conserved hypothetical protein [Clostridium perfringens] dbjJBAB80287. 1! conserved hypothetical protein [Clostridium perfringens str. 13] Length = 195 Best-BlastP =>> nrprot 67% Identities = 221/382 (57%), Positives = 274/382 (71%), Gaps = 2/382 (0%) refZOT_00032722.11 COG1228: Imidazolonepropionase and related amidohydrolases [Burkholderia fungorum] Length = 431 Best-BlastP =>> nrprot 99% Identities = 414/419 (98%), Positives = 418/419 (99%) gbIAAM00630.1 J Chemiosmotic efflux B protein system C [Legionella pneumophila ] Length = 419 Best-BlastP =>> nrprot 45% Identities = 70/234 (29%), Positives = 115/234 (49%), Gaps = 6/234 (2%) refINP_867781.11 Probable sepiapterin reductase homolog yueD [Pirellula sp.] EmbICAD75328.1 I probable sepiapterin reductase homolog yueD [Pirellula sp.] Length = 261 1032.3 Best-BlastP =>> nrprot 58% Identities = 131/317 (41%), Positives = 188/317 (59% ) PROGABLE ARGINASE PROTEIN [Ralstonia solanacearum] PROBABLE ARGINASE PROTEIN [Ralstonia solanacearum] Length = 325 1034.3 1035.3 Protein [Nostoc sp. PCC 7120] pirIIAE2198 hypothetical protein a1r3140 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB74839.1 ORF_ID: aIr3140 hypothetical protein [Nostoc sp. PCC 7120] Length = 455 1036.4 Best-BlastP =>> nrprot 61% Identities = 206/421 (48%), Positives = 258/421 (61%), Gaps = 8/421 (1%) refZOT_00043700.1 j COG0389 : Nucleotidyltransferase / DNA polymerase involved in DNA repair [Magnetococcus sp. MC-1] Length = 421 1037.1 Best-BlastP =>> nrprot 68% Identities = 71/123 (57%), Positives = 96/123 (78%) COG1974: SOS-response transcriptional repressors (RecA- mediated autopeptidases) [Magnetococcus sp. MC-1] Length = 238 1039.2 Best-BlastP =>> nrprot 59% Identities = 177/396 (44%), Positives = 241/396 (60%), Gaps = 5/396 (1%) refIZP_00094397.1 j COG0624: Acetylornithine deacetylase / Succinyl-diaminopimelate desuccinylase and related deacylases [Novosphingobium aromaticivorans] Length = 465 104.1 Best-BlastP =>> nrprot 99% Identities = 371/377 (98%), Positives = 376/377 (99%) gbIAAM00629. 1 j chemiosmotic efflux system B protein [Legionella pneumophila] Length = 377 1021.3 1022.2 1023.2 1024.2 1028.3 103.1 1030.3 Best-BlastP =>> nrprot 21% Identities = 43/131 (32%), Positives = 69/131 (52%) , Gaps = 8/131 (6%) gbIAAL78307.1 JAF288617 4 Dotl [Legionella longbeachae] Length = 212 Best-BlastP =>> nrprot 43% Identities = 124/492 (25%), Positives = 207/492 (42% ), Gaps = 95/492 (19%) refJNP 487180.11 hypothetical Best-BlastP =>> nrprot 63% Identities = 150/366 (40%), Positives = 220/366 (60%), Gaps = 25/366 (6) %) refjNP_795120.1 conserved hypothetical protein [Pseudomonas syringae pv. tomato str. DC3000] gblAAO58815.1 conserved hypothetical protein [Pseudomonas syringae pv. tomato str. DC3000] Length = 368 Best-BlastP =>> nrprot 82% Identities = 557/801 (69%), Positives = 663/801 (82%), Gaps = 1/801 (0%) reflNP_756480.1 I DNA gyrase subunit B [Escherichia coli CFT073] gbJAAN83054.1 1AE016769_169 DNA gyrase subunit B [Escherichia coli CFT073] Length = 805 Best-BlastP =>> nrprot 76% Identities = 264/406 (65%), Positives = 314/406 (77%) ref [Mw-1], [Shewanella oneidensis MR-1] gblAAN57091.11AE015843_3 malate oxidoreductase, putative [Shewanella oneidensis MR-1] Length = Best-BlastP =>> nrprot 59% Identities = 152/394 (38%), Positives = 236/394 (59%), Gaps = 12/394 (3%) reflNP_820159.1 I major facilitator family transporter [Coxiélla burnetii RSA 493] gbIAAO90673.1 Major facilitator family transporter [Coxiella burnetii RSA 493] Length = 443 1047.2 Best-BlastP =>> nrprot 59% Identities = 142/261 (54%), Positives = 179/261 (68%), Gaps = 1/261 (0%) refZNP_00102270.11 COG1075: Predicted acetyltransferases and hydrolases with the alp ha / beta hydrolase fold [Desulfitobacterium hafniense] Length = 364 Best-BlastP =>> nrprot 12% Identities = 33/98 (33%), Positives = 48/98 (48%), Gaps = 3/98 (3%) ReflNP_717311.11 hypothetical protein [Shewanella oneidensis MR-1] gb1AAN54755.11AE015616_1 hypothetical protein [Shewanella oneidensis MR-1] Length = 443 Best-BlastP =>> nrprot 48% Identities = 74/232 (31%), Positive = 112 / 232 (48%), Gaps = 10/232 (4%) reflNP_069069.1 I glutamine ABC transport, periplasmic glutamine-binding protein (glnH) [Archaeoglobus fulgidus DSM 4304] pir11G69278 ABC glutamine transporter, periplasmic glutamine-binding protein (gInH) homolog - Archaeoglobus fulgidus gbjAAB91001.11 glutamine ABC transport, periplasmic glutamine binding protein (glnH) [Archaeoglobus fulgidus DSM 4304] Length = 264 Best-BlastP =>> nrprot 14% Identities = 96/410 (23%), Positives = 164/410 (40%), Gaps = 57/410 (13%) pir11T31688 Ca2 ± transporting ATPase (EC 3.6.3. 8), plasma membrane - Paramecium tetraurelia gb (AAB81284.1 plasma membrane calcium ATPase [Paramecium tetraurelia] Length = 1160 1053.2 Best-BlastP =>> nrprot 64% Identities = 86/174 (49%), Positives = 114/174 (65%), Gaps = 2/174 (1%) refINP_820971.1 Phosphatase, putative [Coxiella burnetii RSA 493] gblAAO91485.11 phosphatase, putative [Coxiella burnetii RSA 493] Length = 184 1055.1 Best-BlastP =>> nrprot 59% Identities = 102/256 (39%), Positives = 144/256 (56%), Gaps = 16/256 (6%) ReflnP 820853.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbJAAO91367.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 1056.1 Best-BlastP =>> nrprot No Hits found 1058.3 Best-BlastP =>> nrprot 43% Identities = 112/511 (21%), Positives = 204/511 (39%), Gaps = 94 / 511 (18%) spIP08799IMYS2_DICDI Myosin II heavy chain, non muscle pir11A26655 myosin heavy chain [similarity] - slime mold (Dictyostelium discoideum) gbjAAA33227.1 myosin heavy chain Length = 2116 1040.3 1041.3 1 042.5 1044.3 1048.3 1049.2 1050.4 1059.2 Best-BlastP =>> nrprot 85% Identities = 302/423 (71%), Positives = 364/423 (86%), Gaps = 2/423 (0%) refINP_820394. 1 j citrate synthase [Coxiella burnetii RSA 493] spIP18789jCISY_COXBU Citrate synthase pirjjJQ1392 citrate (si) -synthase (EC 4.1.3.7) - Coxiella burnetii gbjAAA23307.11 citrate synthase (g1tA) (EC 4.1.3.7) gblAAO90908.1 citrate synthase [Coxiella burnetii RSA 493] Length = 430 1060.2 Best-BlastP =>> nrprot 57% Identities = 114/286 (39%), Positives = 168/286 (58%), Gaps = 7/286 (2%) refINP_813465.1 j purine nucleoside phosphorylase II [Bacteroides thetaiotaomicron VPI-5482] gbjAAO79659.1 I purine nucleoside phosphorylase II [Bacteroides thetaiotaomicron VPI-5482] Length = 292 1063.1 Best-BlastP =>> nrprot No Hits found 1065.3 Best-BlastP =>> nrprot 48% Identities = 124/365 (33%), Positives = 187/365 (51%), Gaps = 10/365 (2%) dbjIBAA31547.1 j metal-activated pyridoxal enzyme [Arthrobacter sp.] Length = 379 1066.2 Best-BlastP =>> nrprot 53% Identities = 124/294 (42%), Positives = 160/294 (54%), Gaps = 18/294 (6%) refJZP_00016110.1 j COG0596: Predicted hydrolases or acyltransferases (alpha / be hydrolase superfamily) [Rhodospirillum rubrum] Length = 286 Best-BlastP =>> nrprot 47% Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 11/70 (15%) ReflNP 489272.11 unknown protein [Nostoc sp. PCC 7120] pirjjAH2459 hypothetical protein a1r5232 [imported] - Nostoc sp. (strain PCC 7120) dbjlBAB76931.11 ORF_ID: alr5232 unknown protein [Nostoc sp. PCC 7120] Length = 204 Best-BlastP =>> nrprot 46% Identities = 103/273 (37%), Positives = 145/273 (53%), Gaps = 35/273 (12%) embjCAA75849.1 j hypothetical protein [Coxiella burnetii] Length = 309 Best-BlastP =>> nrprot 99% Identities = 1034/1047 (98%), Positives = 1041/1047 (99%) gbjAAM00628.1 Chemiosmotic efflux B protein system [Legionella pneumophila] Length = 1047 Best-BlastP =>> nrprot 99% Identities = 411/418 (98%), Positives = 416/418 (99%) pirjIT08882 proline / betaine transport protein homolog CitA-Legionella pneumophila embyCAA75171.1 j TphA protein [Legionella pneumophila] gbjAAC38182.1 CitA [Legionella pneumophila] embyCAA75337.1 j TphA protein [Legionella pneumophila] Length = 418 1072.4 Best-BlastP =>> nrprot 99% Identities = 966/973 (99%), Positive = 971/973 (99%) ) pirjjT18341 icmF protein - Legionella pneumophila embyCAA75172.1 IcmF protein [Legionella pneumophila] embyCAA75338.1 IcmF protein [Legionella pneumophila] Length = 973 1074.3 Best-BlastP =>> nrprot 67% Ide ntities = 343/638 (53%), Positives = 456/638 (71%), Gaps = 6/638 (0%) refINP 819606.11 fatty oxidation complex, alpha subunit [Coxiella burnetii RSA 493] gbjAAO90120.1 j fatty oxidation complex , alpha subunit [Coxiella burnetii RSA 493] Length = 642 1075.3 Best-BlastP =>> nrprot 75% Identities = 271/422 (64%), Positives = 333/422 (78%), Gaps = 1/422 (0% ) beta-Subunit of fatty acid oxidation complex, 3-keto-acyl-CoA-thiolase [Azoarcus sp. EbN1] Length = 426 1076.3 Best-BlastP =>> nrprot 56% Identities = 50/119 (42%), Positives = 70/119 (58%) refINP_902011.1 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbjAAQ60013.1 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 122 1067.1 1069.2 107.1 1071.3 Best-BlastP =>> nrprot 75% Identities = 137/226 (60%), Positives = 175/226 (77%), Gaps = 1 / 226 (0%) REFINP_384333.1 l PUTATIVE TRANSCRIPTION REGULATOR PROTEIN [Sinorhizobium meliloti] emblCAC41614.11 PUTATIVE TRANSCRIPTION REGULATOR PROTEIN [Sinorhizobium meliloti] Length = 230 Best-BlastP =>> nrprot 33% Identities = 65/262 (24%), Positive = 110/262 (41%), Gaps = 21/262 (8%) refINP_624872.1 l hypothetical protein SCF73.06c [Streptomyces coelicolor A3 (2)] embICAB57411.11 hypothetical protein SCF73.06c [Streptomyces coelicolor A3 (2 ) Length 333 Best-BlastP =>> nrprot 40% Identities = 71/229 (31%), Positives = 113/229 (49%), Gaps = 11/229 (4%) ref! ZP_00081514.1 COG1560: Lauroyl / myristoyl acyltransferase [Geobacter metallireducens] Length = 324 Best-BlastP =>> nrprot 36% Identities = 81/362 (22%), Positives = 140/362 (38%), Gaps = 52/362 (14%) refJZP_00133556.1 J COG5295: Autotransporter Adhesive [Haemophilus somnus 2336] Length = 3391 Best-BlastP =>> nrprot 67% Identities = 236/481 (49%), Positives = 325/481 (67%), Gaps = 12/481 (2% refINP 484210.11 alpha, alphatrehalase [Nostoc sp. PCC 7120] pirlIAF1827 alpha, alpha-trehalase [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB77690.11 alpha, alpha-trehalase [Nostoc sp. PCC 7120] Length = 495 Best-BlastP =>> nrprot 56% Identities = 191/581 (32%), Positives = 316/581 (54%), Gaps = 34/581 (5%) refIN 488098.1 J similar to isovaleryl -CoA dehydrogenase [Nostoc sp. PCC 7120] 1AC2313 pin hypothetical protein a1r4058 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB75757.1 I ORF_ID: aIr4058 similar to isovaleryl-CoA dehydrogenase [Nostoc sp. PCC 7120] Length = 602 1088.3 Best-BlastP =>> nrprot 40% Identities = 124/450 (27%), Positives = 202/450 (44%), Gaps = 37/450 (8%) refJNP_870622.11 Probable auxinresponsive -like protein [Pirellula sp.] promICAD77699.11 probable auxin-responsive-like protein [Pirellula sp.] Length = 559 1089.2 Best-BlastP =>> nrprot 48% Identities = 274/902 (30%), Positives = 444 / 902 (49%), Gaps = 54/902 (5%) refIZP_00123122.11 hypothetical protein [Haemophilus somnus 129PT] Length = 948 109.1 Best-BlastP =>> nrprot 96% Identities = 441/469 (94%), Positives = 456/469 (97%) gblAAM00627.1 j unknown [Legionella pneumophila] Length = 470 1090.1 Best-BlastP =>> nrprot 43% Identities = 28/84 (33%), Positives = 51/84 (60%), Gaps = 12/84 (14%) refIss_00025260.1 I hypothetical protein [Ralstonia metallidurans] Length = 241 1091.2 Best-BlastP =>> nrprot 45% Identities = 114/438 (26%), Positive = 192/438 (43%) , Gaps = 79/438 (18%) refINP_873428.1 conserved hypothetical protein [Haemophilus ducreyi 35000HP] gblAAP95817. 1 = conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 481 1092.3 Best-BlastP =>> nrprot 46% Identities = 64/221 (28%), Positives = 115/221 (52%), Gaps = 8/221 (3% ) COG1940: Transcriptional regulator / sugar kinase [Pseudomonas fluorescens PfO-1] Length = 271 1093.3 Best-BlastP =>> nrprot 74% Identities = 161/325 (49%), Positive = 232/325 (71%) ), Gaps = 16/325 (4%) refINP_819394.1 l sohB protein [Coxiella burnetii RSA 493] gblAAO89908.1 J sohB protein [Coxiella burnetii RSA 493] Length = 338 1094.1 Best-BlastP =>> nrprot 36% Identities = 30/50 (60%), Positive = 34/50 (68%), Gaps = 4/50 (8%) gbJEAA17424.1 J putative HSP protein [Plasmodium yoelii yoelii] Length = 929 1077.1 1078.2 1080.2 1081.2 1082.3 1087.2 1096.3 Best -BlastP =>> nrprot 70% dentities = 253/483 (52%), Positives = 333/483 (68%), Gaps = 17/483 (3%) refZOT_00127277.1 l COG2204: Response regulator containing Chey-like receiver , AAA-type ATPase, and DNA-binding domains [Pseudomonas syringae pv.

  syringae B728a] Length = 491 1098.3 Best-BlastP =>> nrprot 57% Identities = 136/330 (41%), Positives = 195/330 (59%), Gaps = 3/330 (0%) refINP_718989.11 conserved hypothetical protein [Shewanella oneidensis MR1] spIQ8EBR4ITRUD_SHEON tRNA pseudouridine synthase D (Pseudomonidylate synthase) (Uracil hydrolyase) gbIAAN56433.11AE015780_4 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 370 1099.2 Best-BlastP =>> nrprot 63% Identities = 158/328 (48%), Positives = 207/328 (63%), Gaps = 6/328 (1%) refINP 403834.1 conserved hypothetical protein [Yersinia pestis] refINP_671254.11 hypothetical protein [KIM Yersinia pestis] pirIIAH0022 conserved hypothetical protein YPO0180 [imported ] Yersinia pestis (strain C092) [Yersinia pestis C092] [Yersinia pestis C092] [Yersinia pestis C092] hypothetical protein [Yersinia pestis KIM] Length = 326 11.2 Best-BlastP =>> nrprot 39% Identities = 77/276 (27) %), Positives = 127/276 (46%), Gaps = 29/276 (10%) refIZP_00023 112.11 hypothetical protein [Ralstonia metallidurans] Length = 348 1101.4 Best-BlastP =>> nrprot 54% Identities = 128/359 (35%), Positives = 200/359 (55%), Gaps = 24/359 (6%) refINP_878747 .1 J histidinolphosphate aminotransferase [Candidatus Blochmannia floridanus] EmbicAD83523.1 I histidinol-phosphate aminotransferase [Candidatus Blochmannia floridanus] Length = 356 1102.2 Best-BlastP =>> nrprot 66% dentities = 203/427 (47%), Positives = 287 / 427 (67%), Gaps = 9/427 (2%) dbjIBAC94115.11 histidinol dehydrogenase [Vibrio vuinificus YJ016] Length = 431 1105.2 Best-BlastP =>> nrprot 36% Identities = 187/439 (42%), Positives = 279/439 (63%), Gaps = 1/439 (0%) refINP_715981.1 I sensory box protein [Shewanella oneidensis MR-1] gbIAAN53426.11AE015481_9 sensory box protein [Shewanella oneidensis MR-1] Length = 1515 1106.5 Best- BlastP =>> nrprot 99% dentities = 1366/1368 (99%), Positives = 1367/1368 (99%) gbIAAC69338.11 RNA polymerase B-subunit [Legionella pneumophila] Length = 1368 1107.2 Best-Blas tP =>> nrprot 66% Identities = 154/324 (47%), Positives = 219/324 (67%), Gaps = 3/324 (0%) refINP_657119.1 Chal_stil_syntC, Chalcone and stilbene synthases, C-terminal domain [Bacillus anthracis A2012] refINP_845551.11 3-oxoacyl- (acyl-carrier-protein) synthase III, putative [Bacillus anthracis str. Ames] 3-oxoacyl- (acyl-carrier-protein) synthase III, putative [Bacillus anthracis str. Ames] Length = 329 1109.3 Best-BlastP =>> nrprot 64% dentities = 150/329 (45%), Positives = 212/329 (64%), Gaps = 3/329 (0%) refINP_657117.11 3Beta_HSD, 3 hydroxysteroid dehydrogenase / isomerase family [Bacillus anthracis A2012] refINP_845549.1 13-beta hydroxysteroid dehydrogenase / isomerase family protein [Bacillus anthracis str. Ames] gbIAAP27035.1 3-beta hydroxysteroid dehydrogenase / isomerase family protein [Bacillus anthracis str. Ames] Length = 328 111.2 Best-BlastP =>> nrprot 97% Identities = 485/504 (96%), Positives = 493/504 (97%) spIQ8RNP41TYPH_LEGPN Putative thymidine phosphorylase (TdRPase) gbIAAM00626.1 I unknown [Legionella pneumophila] Length = 517 1111.3 Best-BlastP =>> nrprot 58% Identities = 109/270 (40%), Positives = 164/270 (60%), Gaps = 6/270 (2%) refINP_657116.11 hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] refINP_845548.1 conserved hypothetical protein [Bacillus anthracis str. Ames] gbIAAP27034. I preserved hypothetical protein [Bacillus anthracis str. Ames] Length = 283 1113.2 Best-BlastP =>> nrprot 31% Identities = 37/58 (63%), Positives = 42/58 (72%), Gaps = 3/58 (5%) refINP_759576.1 I Conserved hypothetical protein [Vibrio vulnificus CMCP6] gblAA009103.11AE016799_1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] Length = 116 1115.4 Best-BlastP =>> nrprot 26% Identities = 41/132 (31%), Positive = 70/132 (53%), Gaps = 10/132 (7%) refINP_710625.11 conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gbJAAN47643.1 (AE011231_6 conserved hypothetical protein [Leptospira interrogans serovar lai str 56601] Length = 359 1116.2 Best-BlastP =>> nrprot No Hits found 1118.2 Best-BlastP =>> nrprot 79% Identities = 277/452 (61 %), Positives = 359/452 (79%), Gaps = 1/452 (0%) gbJAAM00627.1 j unknown [Legionella pneumophila] Length = 470 1119.2 Best-BlastP =>> nrprot No Hits found 1122.1 Best-BlastP = > nrprot 64% Identities = 142/291 (48%), Positives = 196/291 (67%), Gaps = 5/291 (1%) refINP_716239.1 I hflC protein [Shewanella oneidensis MR-1] gblAAN53684.11AE015507_10 hflC protein [Shewanella oneidensis MR-1] Length = 297 1123.2 Best-BlastP =>> nrprot 62% Identities = 176/379 (46%), Positives = 237/379 (62%), Gaps = 24/379 (6% ) refINP_253629.1 I subunit HfIK protease [Pseudomonas aeruginosa PA01] proteinase subunit HflK PA4942 [imported] - Pseudomonas aeruginosa (strain PA01) gbJAAGO8327 11AE004907_5 subunit protease HflK [Pseudomonas aeruginosa PAO1] Length = 400 1124.2 Best-Bl astP =>> nrprot 36% Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 8/152 (5%) gblAAM09314.21 similar to Mus musculus (Mouse). Uridine cytidine kinase 2 [Dictyostelium discoideum] Length = 243 1125.2 Best-BlastP =>> nrprot 68% Identities = 193/382 (50%), Positives = 265/382 (69%) refINP_519762.11 PROBABLE ACETYLORNITHINE DEACETYLASE (ACETYLORNITHINASE) PROTEIN [Ralstonia solanacearum] embjCAD15343.11 PROBABLE ACETYLORNITHIN DEACETYLASE (ACETYLORNITHINASE) PROTEIN [Ralstonia solanacearum] Length = 397 1126.3 Best-BlastP =>> nrprot 55% Identities = 163/398 (40%), Positive = 239/398 (60% Gaps = 2/398 (0%) COG0477: Permeases of the major facilitator superfamily [Burkholderia fungorum] Length = 470 1127.3 Best-BlastP =>> nrprot 72% Identities = 360/650 (55%), Positives = 472/650 (72%), Gaps = 4/650 (0%) refINP245215.1 Acetoacetyl-CoA synthetase, putative [Pseudomonas putida KT2440] gblAAN68679.1 1AE016497 4 acetoacetyl-CoA synthetase, putative [Pseudomonas putida KT2440] Length = 650 1128.3 Best-BlastP =>> nrprot 50% Identities = 113/289 (39%), Positives = 170/289 (58%), Gaps = 13/289 (4%) ref Biotin synthesis protein [Chromobacterium violaceum ATCC 12472] gbjAAQ62035.11 biotin synthesis protein [Chromobacterium violaceum ATCC 12472] Length = 302 1132.2 Best-BlastP =>> nrprot 57% Identities = 85/221 (38%), Positive = 135/221 (61%), Gaps = 12/221 (5%) ref! ZP_00086846.1 COG1040: Predicted amidophosphoribosyltransferases [Pseudomonas fluorescens PfO-1] Length = 246 1133.3 Best-BlastP =>> nrprot 50% Identities = 103 / 346 (29%), Positives = 172/346 (49%), Gaps = 13/346 (3%) refJZP_00082200.1 COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Geobacter metallireducens] Length = 355 1134.3 Best -BlastP =>> nrprot No Hits found 1136.3 Best-BlastP =>> nrprot 62% Identities = 232/442 (52%), Positives = 307/442 (69%), Gaps = 1/442 (0%) refIZP_00043253. COG0790: FOG: TPR repeat, SEL1 subfamily [Magnetococcus sp. MC-1] Length = 831 1137.2 Best-BlastP =>> nrprot No Hits found 114.2 Best-BlastP =>> nrprot No Hits found 1142.4 Best-BlastP =>> nrprot 65% Identities = 222/454 (48%), Positive = 312/454 (68%), Gaps = 4/454 (0%) refINP820336.1 amino acid antiporter [Coxiella burnetii RSA 493] gbjAAO90850.1 amino acid antiporter [Coxiella burnetii RSA 493] Length = 474 1144.3 Best-BlastP =>> nrprot 64% Identities = 180/379 (47%), Positives = 254/379 (67%), Gaps = 4/379 (1%) refINP_800676.1! conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] spIQ87GZ9! CLCA VIBPA Voltage-gated CIC-type chloride channel cicA dbjIBAC62509.1! conserved hypothetical protein [Vibrio parahaemolyticus] Length = 467 1145.3 Best-BlastP =>> nrprot 72% Identities = 391/721 (54%), Positives = 522/721 (72%), Gaps = 11/721 (1%) reflZP_00110122 .1! COG0512: Anthranilate / para-aminobenzoate synthase component II [Nostoc punctiform] Length = 734 1148.2 Best-BlastP =>> nrprot 56% Identities = 334/906 (36%), Positives = 512/906 (56%), Gaps = 35 / 906 (3%) refINP_289628.1 adenylylating enzyme for glutamine synthetase [Escherichia coli O157: H7 EDL933] refINP_311963.1 J glutamate-ammonialigase adenylyltransferase [Escherichia coli O157: H7] pirIIH91120 glutamate-ammonia-ligase adenylyltransferase [imported] - Escherichia coli (strain O157: H7, substrain RIMD 0509952) IG85965 adenylylating enzyme for glutamine synthetase [imported] - Escherichia coli (strain O157: H7, substrain EDL933) gbJAAG58187.1 1AE005534_9 adenylylating enzyme for glutamine synthetase [Escherichia coli O157: H7 EDL933] dbjIBAB37359.1 J glutamate-ammonia-ligase adenylyltransferase [Escherichia coli O157: H7] Length = 946 115.2 Best-BlastP =>> nrprot 57% Identities = 53/167 (31%), Positives = 98/167 (58%), Gaps = 5/167 (2%) REFINP 490158.1! probable acetyltransferase [Nostoc sp. PCC 7120] pirJJAD2484 hypothetical protein a1r7052 [imported] - Nostoc sp. (strain PCC 7120) plasmid pCC7120alpha dbjIBAB78136.1 J ORF_ID: a1r7052 - probable acetyltransferase [Nostoc sp. PCC 7120] Length = 169 1152.2 Best-BlastP =>> nrprot 22% Identities = 39/137 (28%), Positives = 67/137 (48%), Gaps = 10/137 (7%) refINP_824638.1! putative lipase [Streptomyces avermitilis MA-4680] dbj! BAC71173.1! putative lipase [Streptomyces avermitilis MA-4680] Length = 286 1153.1 Best-BlastP =>> nrprot 46% Identities = 36/136 (26%), Positive = 67/136 (49%), Gaps = 15/136 (11% ) refINP_629974.1! putative integral membrane protein [Streptomyces coelicolor A3 (2)] pirJIT35887 hypothetical protein SC9B10.18 - Streptomyces coelicolor embJCAA15808.11 putative integral membrane protein [Streptomyces coelicolor A3 (2)] Length = 312 1156.3 Best-BlastP =>> nrprot 48% Identities = 114/437 (26%), Positives = 213/437 (48%), Gaps = 37/437 (8%) refJZP_00107812.1! COG4325: Predicted membrane protein [Nostoc punctiform] Length = 449 1157.4 Best-BlastP =>> nrprot 73% Identities = 550/943 (58%), Positives = 687/943 (72%), Gaps = 15/943 (1% COG0567: 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Pseudomonas fluorescens PfO-1] Length 943 Best-BlastP =>> nrprot 30% Identities = 61/269 (22%), Positive = 130/269 (48%), Gaps = 23/269 (8%) refINP_143635.1 J chromosome assembly protein [Pyrococcus horikoshii] pirJJF71190 Probable chromosome assembly protein - Pyrococcus horikoshii dbjJBAA30917.1 J 1179aa long hypothetical chromosome assembly protein [Pyrococcus horikoshii] Length = 1179 Best-BlastP =>> nrprot 29% Identities = 42/123 (34%), Positives = 47/123 (38%), Gaps = 27/123 (21%) refINP_639328.1 J hypothetical protein [ Xanthomonas campestris pv. campestris str. ATCC 33913] gbJAAM43210.1 hypothetical protein [Xanthomonas campestris pv.

  campestris str. ATCC 33913] Length = 131 1159.5 116.1 1160.2 Best-BlastP =>> nrprot 51% Identities = 136/392 (34%), Positives = 206/392 (52%), Gaps = 10/392 (2%) reflNP_085189.11 1810 orf [Shigella flexneri] reflNP_858160.1 hypothetical protein [Shigella flexneri 2a] gblAAK18345.11AF348706_34 IS10 orf [Shigella flexneri] gblAAL72480.11 hypothetical protein [Shigella flexneri 2a] Length = 407 1161.2 Best-BlastP =>> nrprot 75% Identities = 225/353 (63%), Positives = 269/353 (76%), Gaps = 2/353 (0%) refJNP_756808.11 Uroporphyrinogen decarboxylase [Escherichia coli CFT073] spIQ8FB74IDCUP_ECOL6 Uroporphyrinogen decarboxylase (URO-D) (UPD) gblAAN83382. 11AE016770_182 Uroporphyrinogen decarboxylase [Escherichia coli CFT073] Length = 354 1162.1 Best-BlastP =>> nrprot 62% Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (1%) refINP_289633.11 putative kinase [Escherichia coli 0157: H7 EDL933] refINP_311968.1 I putative kinase [Escherichia coli 0157: H7] pirIIE91121 probable kinase [imported] - Escheri chia coli (strain 0157: H7, substrain RIMD 0509952) pirl1D85966 probable kinase ygiG [imported] Escherichia coli (strain 0157: H7, substrain EDL933) gblAAG58192.11AE005535 4 putative kinase [Escherichia coli 0157: H7 EDL933] dbjf BAB37364.1 putative kinase [Escherichia coli 0157: H7] Length = 123 1163.2 Best-BlastP =>> nrprot 29% Identities = 46/156 (29%), Positives = 68/156 (43%), Gaps = 10/156 (6%) refINP_747191 .Beta. Conserved hypothetical protein [Pseudomonas putida KT2440] gblAAN70655.11AE016709_7 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 232 1168.2 Best-BlastP =>> nrprot 61% Identities = 64/117 (54%), Positives = 83/117 ( 70%) refINP_755691.1 l Hypothetical protein [Escherichia coli CFT073] gbjAAN82265.11AE016767_25 Hypothetical protein [Escherichia coli CFT073] Length = 365 1169.3 Best-BlastP =>> nrprot 99% Identities = 616/621 (99%), Positive = 618 / 621 (99%), Gaps = 1/621 (0%) gbIAAB09543.1 j LprpoD Length = 620 117.1 Best-BlastP =>> nrprot No Hits found 1171.3 B is-BlastP =>> nrprot 64% Identities = 104/241 (43%), Positives = 161/241 (66%), Gaps = 6/241 (2%) spIP13980ITRT3_ECOLI TraT complement resistance protein precursor pirJJC29835 TraTp protein - Escherichia coli plasmid pED208 gblAAA88375.11 traTp gene product gblAAM90725.21 TraT [Salmonella typhi] Length = 245 1172.2 Best-BlastP =>> nrprot No Hits found 1174.2 Best-BlastP =>> nrprot 74% Identities = 267/451 (59%), Positives = 334/451 (74%), Gaps = 9/451 (1%) refIZP_00065505.1 J COG0486: Predicted GTPase [Microbulbifer degradans 2-40] Length = 456 1176.5 Best-BlastP =>> nrprot No Hits found 1179.1 Best -BlastP =>> nrprot No Hits found 118.1 Best-BlastP =>> nrprot No Hits found 1180.2 Best-BlastP =>> nrprot 44% Identities = 66/232 (28%), Positives = 113/232 (48%), Gaps = 2/232 (0%) refINP_762946.11 AraC-type DNA-binding domain-containing protein [Vibrio vulnificus CMCP6] gblAA007936.1 1AE016811_177 AraC-type DNA-binding domain-containing protein [Vibrio vulnificus CMCP6] Length = 237 1182.3 Bes t-BlastP =>> nrprot 48% Identities = 88/274 (32%), Positives = 149/274 (54%), Gaps = 18/274 (6%) reflNP_520074.1 I PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] embjCAD15655 .11 PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 336 1183.4 Best-BlastP =>> nrprot No Hits found 1184.2 Best-BlastP =>> nrprot 54% Identities = 133/395 (33%), Positives = 216/395 (54%) %), Gaps = 6/395 (1%) refINP_618268.1 J amino acid transporter [Methanosarcina acetivorans str. C2A] gbjAAM06748.1 amino acid transporter [Methanosarcina acetivorans str. C2A] Length = 439 1186.2 Best-BlastP =>> nrprot 31% Identities = 52/171 (30%), Positives = 82/171 (47%), Gaps = 7/171 (4%) refINP_149698.1 1 235L [ Invertebrate iridescent virus 6] gbfAAK82096.11AF303741_235 235L [Chilo iridescent virus] Length = 265 1188.2 Best-BlastP =>> nrprot 99% Identities = 737/749 (98%), Positives = 746/749 (99%) spIQ9WXB91CATA_LEGPN Peroxidase / catalase (Catalaseperoxidase) dbjJBAA78342.11 catalase-peroxidase [Legionella pneumophila] gbjAAG37106.11AF276752_1 catalase-peroxidase [Legionella pneumophila] Length = 749 119.1 Best-BlastP =>> nrprot 51% Identities = 53/124 (42%), Positive = 77 / 124 (62%), Gaps = 2/124 (1%) dbjIBAA75251.11 Similar to IS1301 of Neisseria meningitidis [Actinobacillus actinomycetemcomitans] Length = 255 1190.4 Best-BlastP =>> nprot 56% Identities = 256/709 (36%) , Positives = 406/709 (57%), Gaps = 25/709 (3%) refJZP_00065821.11 COG1249: Pyruvate / 2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related nzymes [Microbulbifer degradans 2-40] Length = 704 1193.2 Best-BlastP =>> nrprot No Hits found 1194.3 Best-BlastP =>> nrprot 72% Identities = 223/383 (58%), Positives = 278/383 (72% ), Gaps = 1/383 (0%) refINP_636802.1 I glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. campestris str. ATCC 33913] gbIAAM40726.1 glutaryl-CoA dehydrogenase [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 387 1199.4 Best-BlastP =>> nrprot 80% Identities = 73/110 (66%), Positives = 90/110 (81%) refIZP_00067987.11 COG0091: Ribosomal protein L22 [Microbulbifer degradans 2-40] Length = 110 1201.1 Best-BlastP =>> nrprot 82% Identities = 150/220 (68%), Positives = 180/220 (81%), Gaps = 1/220 (0%) refINP_819288.1 I ribosomal protein S3 [ Coxiella burnetii RSA 493] spIO85388IRS3_COXBU 30S ribosomal protein S3 gblAAO89802.1 I ribosomal protein S3 [Coxiella burnetii RSA 493] Length = 227 1202.2 Best-BlastP =>> nrprot 89% Identities = 113/137 (82%), Positive = 124 / 137 (90%) refINP_742627.1 ribosomal protein L16 [Pseudomonas putida KT2440] gbIAAN66091.11AE016238_9 ribosomal protein L16 [Pseudomonas putida KT2440] Length = 137 1205.5 Best-BlastP =>> nrprot 16% Identities = 428/1182 (36%), Positives = 630/1182 (53%), Gaps = 81/1182 (6%) refIZP_00108802.1 J hypothetical protein [Nostoc punctiform] Length = 2315 1207.2 Best-BlastP =>> nrprot No Hits found 1208.1 Best-BlastP =>> nrprot 42 % Identities = 45/124 (36%), Positive = 55/124 (44%), Gaps = 4/124 (3%) pirlIF71456 hypothetical protein PH0308 - Pyrococcus horikoshii dbjIBAA29381.1 1215aa long hypothetical protein [Pyrococcus horikoshii] Length = 215 1209.2 Best-BlastP =>> nrprot 84% Identities = 346/487 (71%), Positives = 417/487 (85%), Gaps = 1/487 (0%) REFIZP_00087773.1 COG0516: IMP dehydrogenase / GMP reductase [Pseudomonas fluorescens PfO-1] Length = 506 121.1 Best-BlastP =>> nrprot 59% Identities = 58/101 (57%), Positives = 67/101 (66%), Gaps = 1/101 (0%) refZNP_00091135 ..11 COG2852: Uncharacterized protein stored in bacteria [Azotobacter vinelandii] Length = 150 1210.2 Best-BlastP =>> nrprot 81% Identities = 354/523 (67%), Positives = 427/523 (81%), Gaps = 1 / 523 (0%) refINP_708346.1 GMP synthetase [Shigella flexneri 2a str. 301] refINP_838070.1I GMP synthetase (glutamine-hydrolyzing) [Shigella flexneri 2a str. 2457T] gbJAAN44053.1 JAE015270_8 GMP synthetase [Shigella flexneri 2a str. 301] gblAAP17880.11 GMP synthetase (glutamine-hydrolyzing) [Shigella flexneri 2a str. 2457T] Length = 525 1211.3 Best-BlastP =>> nrprot 19% Identities = 47/90 (52%), Positives = 69/90 (76%), Gaps = 1/90 (1%) refINP_929783.1 hypothetical protein [ Photorhabdus luminescens subsp. laumondii TTO1] embICAE14921.1l unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 94 1213. 2 Best-BlastP =>> nrprot 65% Identities = 193/394 (48%), Positives = 248/394 (62%), Gaps = 22/394 (5%) refINP_249543. 1 chitin-binding protein CbpD precursor [Pseudomonas aeruginosa PA0I] pirIIF83538 chitin-binding protein CbpD precursor PA0852 [imported] - Pseudomonas aeruginosa (strain PAOI) gbJAAG04241. 1 IAE004520_4 chitin-binding protein CbpD precursor [Pseudomonas aeruginosa PAO1] Length = 389 1215. 3 Best-BlastP =>> nrprot 64% Identities = 172/363 (47%), Positives = 233/363 (64%), Gaps = 5/363 (1%) refINP_387138. 1 I CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] bICICAC47611. 1 l CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 367 122. 3 Best-BlastP =>> nrprot 69% Identities = 90/159 (56%), Positives = 115/159 (72%), Gaps = 4/159 (2%) refINP_779515. 11 chromosome partitioning protein [Xylella fastidiosa Temeculal] spIQ87BY1IPARB_XYLFT Probable chromosome partitioning protein parB gbIAAO29164. Chromosome partitioning protein [Xylella fastidiosa Temeculal] Length = 310 1220. 3 Best-BlastP =>> nrprot 77% Identities = 332/507 (65%), Positives = 395/507 (77%), Gaps = 3/507 (0%) dbjIBAB19801. 11 Piperidin-6-carboxylate dehydrogenase ['Flavobacterium' lutescens] Length = 510 1222. 5 Best-BlastP =>> nrprot No Hits found 1223. 2 Best-BlastP =>> nrprot 39% Identities = 73/287 (25%), Positives = 119/287 (41%), Gaps = 38/287 (13%) reflNP_521275. 1 I PROBABLE SIGNAL PEPTIDE PROTEIN [Ralstonia solanacearum] embICAD16942. 1d PROBABLE SIGNAL PROTEIN PEPTIDE [Ralstonia solanacearum] Length = 278 1224. 2 Best-BlastP =>> nrprot 88% Identities = 212/266 (79%), Positives = 237/266 (89%) embICAC35728. 1 l OXA-29 [Fluoribacter gormanii] Length = 266 1225. 2 Best-BlastP =>> nrprot 40% Identities = 90/292 (30%), Positives = 143/292 (48%), Gaps = 26/292 (8%) refINP_855062. 1 l CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp.  bovis AF2122 / 97] embICAD94271. 1 I CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp.  bovis AF2122 / 97] Length = 439 1226. 2 Best-BlastP =>> nrprot 55% Identities = 129/350 (36%), Positives = 190/350 (54%), Gaps = 22/350 (6%) refINP_629326. I putative sulfurylase [Streptomyces coelicolor A3 (2)] embICAC01308. 11 putative sulfurylase [Streptomyces coelicolor A3 (2)] Length = 392 1227. 1 Best-BlastP =>> nrprot 48% Identities = 66/202 (32%), Positives = 109/202 (53%), Gaps = 10/202 (4%) refIZP_00107215. COG0637: Predicted phosphatase / phosphohexomutase [Nostoc punctiform] Length = 242 1229. 3 Best-BlastP =>> nrprot No Hits found 123. 2 Best-BlastP =>> nrprot 59% Identities = 201/462 (43%), Positives = 284/462 (61%), Gaps = 28/462 (6%) refINP_253634. 1 N-acetylmuramoyl L-alanine amidase [Pseudomonas aeruginosa PA01] pir! IG83028 N-acetylmuramoyl-L-alanine amidase PA4947 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG08332. 1 JAE004907_10 N-acetylmuramoyl-L-alanine amidase [Pseudomonas aeruginosa PAO1] Length = 475 1230. 2 Best-BlastP =>> nrprot 81% Identities = 364/516 (70%), Positives = 429/516 (83%) refINP_819831. 11 peptide chain release factor 3 [Coxiella burnetii RSA 493] gblAAO90345. Peptide chain release factor 3 [Coxiella burnetii RSA 493] Length = 525 1231. 3 Best-BlastP =>> nrprot No Hits found 1235. 3 Best-BlastP =>> nrprot 28% Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 1/137 (0%) refINP_800044. 1! putative acetyltransferase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61877. 1! putative acetyltransferase [Vibrio parahaemolyticus] Length = 140 1236. 2 Best-BlastP =>> nrprot 65% Identities = 172/176 (97%), Positives = 174/176 (98%) gblAAM00633. 11 unknown [Legionella pneumophila] Length = 176 1237. 2 Best-BlastP =>> nrprot 50% Identities = 47/132 (35%), Positives = 73/132 (55%), Gaps = 4/132 (3%) refINP_832446. 1 Acetyltransferase [Bacillus cereus ATCC 14579] gbJAAP09647. 11 Acetyltransferase [Bacillus cereus ATCC 14579] Length = 141 1238. 2 Best-BlastP =>> nrprot No Hits found 1239. 2 Best-BlastP =>> nrprot No Hits found 124. 1 Best-BlastP =>> nrprot 63% Identities = 66/144 (45%), Positives = 95/144 (65%) refINP_716232. 1 conserved hypothetical protein TIGR00150 [Shewanella oneidensis MR-1] gb! AAN53677. 11AE015507_3 conserved hypothetical protein TIGR00150 [Shewanella oneidensis MR-1] Length = 152 1242. 2 Best-BlastP =>> nrprot 82% Identities = 138/191 (72%), Positives = 160/191 (83%) refINP_353171. 1 I AGR_C_216p [Agrobacterium tumefaciens] refINP_530843. 1! uracil phosphoribosyltransferase [Agrobacterium tumefaciens str.  C58 (U.  Washington)] spIQ8UJ06IUPP AGRT5 Uracil phosphoribosyltransferase (UMP pyrophosphorylase) (UPRTase) pirlIC97375 uracil phosphoribosyltransferase (UMP pyrophosphorylase) (uprtase) [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pir! IAI2592 uracil phosphoribosyltransferase [imported] - Agrobacterium tumefaciens (strain C58 , Dupont) gblAAK85956. 1 d AGR_C_216p [Agrobacterium tumefaciens str.  C58 (Cereon)] gbJAAL41159. 1 uracil phosphoribosyltransferase [Agrobacterium tumefaciens str.  C58 (U.  Washington)] Length = 209 1244. 2 Best-BlastP =>> nrprot No Hits found 1245. 1 Best-BlastP =>> nrprot No Hits found 1246. 2 Best-BlastP =>> nrprot 22% Identities = 82/298 (27%), Positives = 130/298 (43%), Gaps = 56/298 (18%) pirjIT09051 PepA protein Pseudomonas aeruginosa gbIAAC16023. ExoU [Pseudomonas aeruginosa] gblAAC38269. PepA [Pseudomonas aeruginosa] gb! AAP82959. 1! type III effector protein [Pseudomonas aeruginosa] Length = 687 1249. 2 Best-BlastP =>> nrprot 30% Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 9/119 (7%) EmbjCAD21525. 1! hypothetical protein [Taenia solium] Length = 155 125. 2 Best-BlastP =>> nrprot 59% Identities = 227/486 (46%), Positives = 293/486 (60%), Gaps = 4/486 (0%) ref! NP 820087. I conserved hypothetical protein [Coxiella burnetii RSA 493] gblAA090601. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 1250. 1 Best-BlastP =>> nrprot 64% Identities = 74/160 (46%), Positives = 105/160 (65%), Gaps = 1/160 (0%) reflNP_820968. 1 l dihydrofolate reductase [Coxiella burnetii RSA 493] gblAAO91482. 1 dihydrofolate reductase [Coxiella burnetii RSA 493] Length = 161 1251. 2 Best-BlastP =>> nrprot 68% Identities = 176/321 (54%), Positives = 222/321 (69%), Gaps = 4/321 (1%) refJNP_249284. 11 pyridoxal phosphate biosynthetic protein PdxA [Pseudomonas aeruginosa PA01] spIQ915U4IPXA1_PSEAE 4-hydroxythreonine-4-phosphate dehydrogenase 1 (4 (phosphohydroxy) -L-threonine dehydrogenase 1) pir1lA83572 pyridoxal phosphate biosynthetic protein PdxA PA0593 [imported] - Pseudomonas aeruginosa (strain PAOI) . gblAAG03982. 11AE004495_6 pyridoxal phosphate biosynthetic protein PdxA [Pseudomonas aeruginosa PAOI] Length = 328 1257. 5 Best-BlastP =>> nrprot 69% Identities = 242/415 (58%), Positives = 300/415 (72%), Gaps = 5/415 (1%) refJNP_820851. 1 l conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO91365. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 1258. 1 Best-BlastP =>> nrprot 67% Identities = 175/312 (56%), Positives = 217/312 (69%), Gaps = 2/312 (0%) refIZP_00125152. 11 COG0189: Glutathione synthase / ribosomal protein S6 enzyme modification (glutaminyl transferase) [Pseudomonas syringae pv.  syringae B728a] Length = 319 126. 2 Best-BlastP =>> nrprot 99% Identities = 470/475 (98%), Positives = 475/475 (100%) emblCAD42896. 1 I flagellin [Legionella pneumophila serogroup 1] Length = 475 1260. 3 Best-BlastP =>> nrprot 48% Identities = 92/211 (43%), Positives = 126/211 (59%), Gaps = 3/211 (1%) refINP_521080. 1 d PROBABLE LIPOPROTEIN PRECURSOR (VACJ) TRANSMEMBRANE [Ralstonia solanacearum] embiCAD16666. 11 PROBABLE LIPOPROTEIN PRECURSOR (VACJ) TRANSMEMBRANE [Ralstonia solanacearum] Length = 269 1261. 2 Best-BlastP =>> nrprot 66% Identities = 286/564 (50%), Positives = 370/564 (65%), Gaps = 8/564 (1%) gblAAB16855. 1 pyruvate decarboxylase [Arabidopsis thaliana] Length = 607 1264. 3 Best-BlastP =>> nrprot 39% Identities = 97/291 (33%), Positives = 159/291 (54%), Gaps = 16/291 (5%) reflNP_899726. 1 probable aminopeptidase [Chromobacterium violaceum ATCC 12472] gblAAQ57736. 1 probable aminopeptidase [Chromobacterium violaceum ATCC 12472] Length = 415 1265. 5 Best-BlastP =>> nrprot 58% Identities = 119/262 (45%), Positives = 162/262 (61%), Gaps = 6/262 (2%) refZNP_00051284. 1 J COG0656: Aldo / keto reductases, related to diketogulonate reductase [Magnetospirillum magnetotacticum] Length = 291 Best-BlastP =>> nrprot 20% Identities = 38/108 (35%), Positives = 55/108 (50%), Gaps = 8/108 (7%) reflNP_616727. I I conserved hypothetical protein [Methanosarcina acetivorans str.  C2A] gblAAM05207. 11 conserved hypothetical protein [Methanosarcina acetivorans str.  C2A] Length = 266 Best-BlastP =>> nrprot 46% Identities = 82/293 (27%), Positives = 144/293 (49%), Gaps = 33/293 (11%) ref1XP_313252. 1 l ENSANGP00000010487 [Anopheles gambiae] gbIEAA08759. 1 ENSANGP00000010487 [Anopheles gambiae str.  PEST] Length = 310 1267. 3 1268. 2 Best-BlastP =>> nrprot 37% Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 6/94 (6%) spIQ02910ICPN_DROME Calphotin pir1IA47282 calcium-binding protein caiphotin - fruit fly (Drosophila melanogaster) gbIAAA28405. 1! calcium-binding protein Length = 865 Best-BlastP =>> nrprot 70% Identities = 73/144 (50%), Positives = 102/144 (70%), Gaps = 2/144 (1%) refINP_241923. 1 BH1057 - unknown conserved protein [Bacillus halodurans] spIQ9RC411YA57_BACHD Hypothetical protein BH1057 pirjIA83782 hypothetical protein BH1057 [imported] Bacillus halodurans (strain C-125) dbjJBAA83958. 1! YHDE [Bacillus halodurans] dbj! BAB04776. 1 I BH1057-'unknown conserved protein [Bacillus halodurans] Length = 146 Best-BlastP =>> nrprot 61% Identities = 35/70 (50%), Positive = 53/70 (75%) spIP17724IGLB_TETPY Myoglobin (Hemoglobin) pir1IA36270 Hemoglobin Tetrahymena pyriformis dbjIBAA03015. 1 Hemoglobin [Tetrahymena pyriformis] Length = 121 1272. 4 Best-BlastP =>> nrprot 46% dentities = 89/318 (27%), Positives = 147/318 (46%), Gaps = 13/318 (4%) refINP_253021. 1 probable ferredoxin reductase [Pseudomonas aeruginosa PA01] pirfIG83104 probable ferredoxin reductase PA4331 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG07719. 11AE004849_6 probable ferredoxin reductase [Pseudomonas aeruginosa PAOI] Length = 308 1273. 4 Best-BlastP =>> nrprot 40% dentities = 54/200 (27%), Positives = 95/200 (47%), Gaps = 8/200 (4%) gbjAAM88782. 1 j hypothetical protein [Photorhabdus luminescens] Length = 247 1275. 2 Best-BlastP =>> nrprot 57% Identities = 107/291 (36%), Positives = 171/291 (58%), Gaps = 1/291 (0%) gblAAM88781. MhpE-Iike protein [Photorhabdus luminescens] Length = 312 1277. 2 Best-BlastP =>> nrprot 48% Identities = 100/294 (34%), Positives = 162/294 (55%), Gaps = 11/294 (3%) refINP_624285. 1 l UDP-N-acetylmuramyl tripeptide synthase [Thermoanaerobacter tengcongensis] gblAAM25889. 1 1 UDP-N-acetylmuramyl tripeptide synthase [Thermoanaerobacter tengcongensis] Length = 879 1278. 2 Best-BlastP =>> nrprot 43% Identities = 104/386 (26%), Positives = 176/386 (45%), Gaps = 49/386 (12%) gblAAN83921. 1 1 hypothetical protein [Aplysia californica] Length = 427 1279. 3 Best-BlastP =>> nrprot 76% Identities = 107/173 (61%), Positives = 136/173 (78%) ref1NP_439712. 1 Hypothetical protein hypothesis protein [Haemophilus influenzae Rd] spIP44255IYFCM_HAEIN HI1563 pir11D64036 hypothetical protein HI1563 - Haemophilus influenzae (strain Rd KW20) gblAAC23212. 11 conserved hypothetical protein [Haemophilus influenzae Rd] Length = 178 1280. 3 Best-BlastP =>> nrprot 15% Identities = 110/113 (97%), Positives = 110/113 (97%) gblAAO61471. 1 LidA [Legionella pneumophila] Length = 113 1282. 3 Best-BlastP =>> nrprot 44% Identities = 155/493 (31%), Positives = 230/493 (46%), Gaps = 37/493 (7%) gblAAC35592. 11 LphB [Legionella pneumophila] Length = 518 1283. 2 Best-BlastP =>> nrprot 59% dentities = 180/429 (41%), Positives = 260/429 (60%), Gaps = 9/429 (2%) refINP_716339. 1 j conserved hypothetical protein [Shewanella oneidensis MR-1] gblAAN53784. 11AE015516_6 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 433 1284. 2 Best-BlastP =>> nrprot 45% Identities = 25/75 (33%), Positives = 43/75 (57%) refINP_796782. 11 hypothetical protein VPO403 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC58666. 11 hypothetical protein [Vibrio parahaemolyticus] Length = 111,127. 4 1270. 2 1271. 3 1286. 3 Best-BlastP =>> nrprot 19% Identifies = 71/260 (27%), Positives = 123/260 (47%), Gaps = 17/260 (6%) gblAAK19884. 1 putative methoxymalonyl-CoA synthase [Polyangium cellulosum] Length = 863 1287. 3 Best-BlastP =>> nrprot 49% Identifies = 278/933 (29%), Positives = 458/933 (49%), Gaps = 56/933 (6%) refIZP_00089642. 1 I hypothetical protein [Azotobacter vinelandii] Length = 973 1288. 2 Best-BlastP =>> nrprot 14% Identifies = 39/130 (30%), Positives = 67/130 (51%), Gaps = 8/130 (6%) refIXP_314825. 1 ENSANGP00000011098 [Anopheles gambiae] gb! EAA10144. 1 I ENSANGP00000011098 [Anopheles gambiae str.  PEST] Length = 1842 129. 3 Best-BlastP =>> nrprot No Hits found 1293. 4 Best-BlastP =>> nrprot 62% Identifies = 91/182 (50%), Positives = 123/182 (67%), Gaps = 2/182 (1%) refIZP_00013245. COG2353: Uncharacterized conserved protein [Rhodospirillum rubrum] Length = 201-1294. 2 Best-BlastP =>> nrprot 59% Identifies = 77/177 (43%), Positives = 105/177 (59%), Gaps = 7/177 (3%) refINP_902948. Probably cytochrome b561 [Chromobacterium violaceum ATCC 12472] gbiAAQ60942. Probable cytochrome b561 [Chromobacterium violaceum ATCC 12472] Length = 180 1295. 1 Best-BlastP =>> nrprot 47% Identifies = 64/169 (37%), Positives = 91/169 (53%), Gaps = 1/169 (0%) refINP_422185. I preserved hypothetical protein [Caulobacter crescentus CB15] pirIIE87669 conserved hypothetical protein CC3391 [imported] - Caulobacter 1299. 3 protein [Pyrococcus abyssi] Length = 249 Best-BlastP =>> nrprot 50% Identities = 184/554 (33%), Positives = 274/554 (49%), Gaps = 94/554 (16%) refINP841634. 1 I Flagellar hookcrescentus gblAAK25353. Caprobacter crescentus CB15 Length = 427 Best-BlastP =>> nrprot 53% Identifies = 150/437 (34%), Positives = 246/437 (56%), Gaps = 6/437 (1%) gblAAD28727.  11AF112468_6 TraH protein precursor [Salmonella typhimurium] Length = 457 13. 1 Best-BlastP =>> nrprot 40% Identifies = 57/260 (21%), Positives = 111/260 (42%), Gaps = 28/260 (10%) refINP_125735. 1 I hypothetical protein [Pyrococcus abyssi] pirf IG75189 hypothetical protein PAB2321 - Pyrococcus abyssis (strain Orsay) embICAB48966. 11 Hypothetical 130. 4 associated protein 2 [Nitrosomonas europaea ATCC 19718] emblCAD85506. Flagellar hook-associated protein 2 [Nitrosomonas europaea ATCC 19718] Length = 481 1302. 2 Best-BlastP =>> nrprot 54% Identifies = 129/348 (37%), Positives = 197/348 (56%), Gaps = 10/348 (2%) reflZP_00130398. COG2200: FOG: EAL domain [Desulfovibrio desulfuricans G20] Length = 367.1303. 3 Best-BlastP =>> nrprot 80% Identifies = 168/252 (66%), Positives = 207/252 (82%) reflZPO0125838. COG0024: Methionine aminopeptidase [Pseudomonas syringae pv.  syringae B728a] Length = 260 1306. 5 Best-BlastP =>> nrprot 98% Identifies = 1033/1066 (96%), Positive = 1049/1066 (98%) gbIAAM00612. 1-chemiosmotic efflux system protein A-Iike protein [Legionella pneumophila] Length = 1066 1307. 4 Best-BlastP =>> nrprot 97% Identifies = 389/418 (93%), Positives = 407/418 (97%) gblAAM00611. 11 proline / glycine betaine transporter-like protein [Legionella pneumophila] Length = 422 131. 2 Best-BlastP =>> nrprot 26% Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 15/88 (17%) refINP_901795. 1 hypothetical protein CV2125 [Chromobacterium violaceum ATCC 12472] gbIAAQ59798. 1 j hypothetical protein CV2125 [Chromobacterium violaceum ATCC 12472] Length = 202 1314. 3 Best-BlastP =>> nrprot 57% Identities = 170/474 (35%), Positives = 278/474 (58%), Gaps = 14/474 (2%) refJZP_00129665. COG1538: Outer Membrane Protein [Desulfovibrio desulfuricans G20] Length = 494 1317. 3 Best-BlastP =>> nrprot No Hits found 1318. 4 Best-BlastP =>> nrprot 64% Identities = 110/230 (47%), Positives = 162/230 (70%), Gaps = 10/230 (4%) refINP_819966. 1 conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90480. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] Length = -414 1320. 3 Best-BlastP =>> nrprot 67% Identities = 365/741 (49%), Positives = 498/741 (67%), Gaps = 11/741 (1%) refJZP_00010561. COG0068: Hydrogenase ripening factor [Rhodopseudomonas palustris] Length = 772 1322. 2 Best-BlastP =>> nrprot 60% Identities = 173/452 (38%), Positives = 280/452 (61%), Gaps = 6/452 (1%) refINP 462786. 11 putative MFS family tranport protein (Salmonella typhimurium LT2) gbJAAL22745. 1 putative MFS family tranport protein [Salmonella typhimurium LT2] Length = 475 1323. 2 Best-BlastP =>> nrprot No Hits found 1324. 4 Best-BlastP =>> nrprot 28% Identities = 76/274 (27%), Positives = 130/274 (47%), Gaps = 35/274 (12%) gbJEAA21537. Plasmodium falciparum CDPK2 [Plasmodium yoelii yoelii] Length = 565 1325. 2 Best-BlastP =>> nrprot 71% Identities = 311/589 (52%), Positives = 419/589 (71%) refINP_820983. 1 arginyl-tRNA synthetase [Coxiella burnetii RSA 493] gbIAAO91497. 1 arginyl-tRNA synthetase [Coxiella burnetii RSA 493] Length = 592 1328. 2 Best-BlastP =>> nrprot 55% Identities = 121/344 (35%), Positives = 196/344 (56%), Gaps = 8/344 (2%) refINP_819936. 1 transport, putative [Coxiella burnetii RSA 493] gblAAO90450. 1 transport, putative [Coxiella burnetii RSA 493] Length = 376 1330. 5 Best-BlastP =>> nrprot 69% Identities = 372/682 (54%), Positives = 478/682 (70%), Gaps = 4/682 (0%) refJZP_00092220. COG1200: RecG like helicase [Azotobacter vinelandii] Length = 1006 1331. 3 Best-BlastP =>> nrprot 55% Identities = 125/409 (30%), Positives = 223/409 (54%), Gaps = 18/409 (4%) refINP_391052. 1 I alternative gene name: comB, yufA [Bacillus subtilis] spiP14203JYUXH_BACSU Hypothetical protein yuxH pirJIBVBSCB competence protein ComB (yuxH) Bacillus subtilis gbIAAA22318. 1 B competence protein embJCAB07900. 1 J unknown [Bacillus subtilis] emblCAB15162. 1 J yuxH [Bacillus subtilis subsp.  subtilis str.  168] Length = 409 1332. 3 Best-BlastP =>> nrprot 77% Identities = 308/477 (64%), Positives = 377/477 (79%) refINP_840694. Glycine cleavage system P-protein [Nitrosomonas europaea ATCC 19718] embJCAD84521. Glycine cleavage system P-protein [Nitrosomonas europaea ATCC 19718] Length = 483 1334. 3 Best-BlastP =>> nrprot No Hits found 1335. 2 Best-BlastP =>> nrprot No Hits found 1336. 3 Best-BlastP =>> nrprot 99% Identities = 365/371 (98%), Positives = 369/371 (99%) gbJAAM00605. 1 Florfenicol efflux pump-like protein [Legionella pneumophila] Length = 371 1338. 3 Best-BlastP =>> nrprot 76% Identities = 406/673 (60%), Positives = 510/673 (75%), Gaps = 8/673 (1%) refJNP_837722. Methionine tRNA synthetase [Shigella flexneri 2a str.  2457T] gbIAAP17531. Methionine tRNA synthetase [Shigella flexneri 2a str.  2457T] Length = 677 1339. 2 Best-BlastP =>> nrprot 79% Identities = 109/185 (58%), Positives = 151/185 (81%) refINP_770170. 1 J b1r3530 [Bradyrhizobium japonicum] dbjJBAC48795. 1 J b1r3530 [Bradyrhizobium japonicum USDA 110] Length = 206 1341. 2 Best-BlastP =>> nrprot No Hits found 1342. 3 Best-BlastP =>> nrprot 49% Identities = 73/251 (29%), Positives = 130/251 (51%), Gaps = 16/251 (6%) gbIAAM90720. 1 J TraF [Salmonella typhi] Length = 259 1344. 3 Best-BlastP =>> nrprot 14% Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 15/113 (13%) refJZP_00101173. 1 J hypothetical protein [Desulfitobacterium hafniense] Length = 367 1345. 3 Best-BlastP =>> nrprot 65% Identities = 173/366 (47%), Positives = 239/366 (65%), Gaps = 7/366 (1%) refINP_778380. 1 J conserved hypothetical protein [Xylella fastidiosa Temeculal] gbJAAO28029. 1 J conserved hypothetical protein [Xylella fastidiosa Temeculal] Length = 381 1346. 3 Best-BlastP =>> nrprot 69% Identities = 135/258 (52%), Positives = 183/258 (70%), Gaps = 5/258 (1%) refINP_841557. 1 J Uncharacterized protein family UPF0006 [Nitrosomonas europaea ATCC 19718] embJCAD85427. 1 J Uncharacterized protein family UPF0006 [Nitrosomonas europaea ATCC 19718] Length = 254 1353. 3 Best-BlastP =>> nrprot 43% Identities = 82/333 (24%), Positives = 152/333 (45%), Gaps = 43/333 (12%) refINP_819818. Multidrug resistance protein [Coxiella burnetii RSA 493] gbJAAO90332. Multidrug Resistance Protein [Coxiella burnetii RSA 493] Length = 331 1354. 2 Best-BlastP =>> nrprot No Hits found 1356. 2 Best-BlastP =>> nrprot 44% Identities = 72/242 (29%), Positives = 117/242 (48%), Gaps = 8/242 (3%) refINP_814508. 1 J amino acid ABC carry, amino acid-binding / permease protein [Enterococcus faecalis V583] gbJAAO80578. 1 J amino acid ABC carry, amino acid binding / permease protein [Enterococcus faecalis V583] Length = 722 1357. 2 Best-BlastP =>> nrprot 71% Identities = 90/146 (61%), Positives = 107/146 (73%) refINP_718466. 1 J Yail / YqxD family protein [Shewanella oneidensis MR-1] gbJAAN55910. 1JAE015727_10 Yail / YgxD family protein [Shewanella oneidensis MR-1] Length = 151 1359. 2 Best-BlastP =>> nrprot 99% Identities = 357/357 (100%), Positives = 357/357 (100%) embJCAD43479. 1 0-acetyltransferase [Legionella pneumophila] Length = 357 1360. 6 Best-BlastP =>> nrprot 39% Identities = 112/443 (25%), Positives = 195/443 (44%), Gaps = 75/443 (16%) refINP_845547. 1 J conserved hypothetical protein [Bacillus anthracis str.  Ames] gblAAP27033. 1 J conserved hypothetical protein [Bacillus anthracis str.  Ames] Length = 445 1361. 3 Best-BlastP =>> nrprot 46% Identities = 99/312 (31%), Positive = 162/312 (51%), Gaps = 25/312 (8%) refINP_250993.1 J hypothetical protein [Pseudomonas aeruginosa PA01] pirlot IA83358 hypothetical protein PA2303 [imported] - Pseudomonas aeruginosa (strain PAOI) gbJAAG05691. 1 JAE004656_3 hypothetical protein PA2303 [Pseudomonas aeruginosa PAO1] Length = 339 1362. 3 Best-BlastP =>> nrprot 96% Identities = 570/607 (93%), Positives = 588/607 (96%) gbJAAK00285. 11AF288536_7 unknown [Legionella longbeachae] Length = 607 1364. 2 Best-BlastP =>> nrprot 96% Identities = 505/534 (94%), Positives = 516/534 (96%) gbJAAK00286. 1 1A288536_8 possible sensor kinase protein [Legionella longbeachae] Length = 534 1366. 3 Best-BlastP =>> nrprot No Hits found 1367. 3 Best-BlastP =>> nrprot 58% Identities = 55/123 (44%), Positives = 83/123 (67%) reflZP_00047813. COG2391: Predicted transporter component [Magnetospirillum magnetotacticum] Length = 155 1368. 2 Best-BlastP =>> nrprot No Hits found 1369. 2 Best-BlastP =>> nrprot 63% Identities = 58/133 (43%), Positives = 92/133 (69%) refINP_800456. 1 j conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC62289. 1 I conserved hypothetical protein [Vibrio parahaemolyticus] Length = 139 1370. 5 Best-BlastP =>> nrprot 56% Identities = 66/135 (48%), Positives = 87/135 (64%), Gaps = 2/135 (1%) reflNP_819361. Preserved domain protein [Coxiella burnetii RSA 493] gbjAAO89875. Preserved domain protein [Coxiella burnetii RSA 493] Length = 214 1372. 2 Best-BlastP =>> nrprot No Hits found 1373. 1 Best-BlastP =>> nrprot No Hits found 1375. 2 Best-BlastP =>> nrprot 29% dentities = 51/102 (50%), Positives = 69/102 (67%) reflNP_790719. 11 conserved hypothetical protein [Pseudomonas syringae pv.  tomato str.  DC3000] gbjAAO54414. Presumed hypothetical protein [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 249 1376. 2 Best-BlastP =>> nrprot 40% dentities = 38/97 (39%), Positives = 53/97 (54%), Gaps = 3/97 (3%) refJZP_00030779. 1 I hypothetical protein [Burkholderia fungorum] Length = 182 1377. 5 Best-BlastP =>> nrprot No Hits found 1378. 5 Best-BlastP =>> nrprot No Hits found 1380. 3 Best-BlastP =>> nrprot 15% Identities = 51/177 (28%), Positives = 81/177 (45%), Gaps = 26/177 (14%) refJZP_00071821. COG3240: Phospholipase / Iecithinase / hemolysin [Trichodesmium erythraeum IMS101] Length = 418 1385. 2 Best-BlastP =>> nrprot 40% Identities = 61/216 (28%), Positives = 98/216 (45%), Gaps = 23/216 (10%) gbIAAK00282. 1 1AF288536 4 unknown [Legionella Iongbeachae] Length = 302 1386. 3 Best-BlastP =>> nrprot 57% Identities = 56/108 (51%), Positives = 72/108 (66%) gbjAAL17787. 11AF361470_8 hypothetical protein [Rhizobium leguminosarum bv.  trifolii] Length = 115 1387. 2 Best-BlastP =>> nrprot 58% dentities = 191/434 (44%), Positives = 267/434 (61%), Gaps = 11/434 (2%) refJZP_00030193. COG1538: Outer Membrane Protein [Burkholderia fungorum] Length = 509 1388. 2 Best-BlastP =>> nrprot No Hits found 139. 5 Best-BlastP =>> nrprot 10% Identities = 77/305 (25%), Positives = 150/305 (49%), Gaps = 30/305 (9%) gbjAAK01145. 2j 200 kDa immunoreactive glycoprotein [Ehrlichia canis] Length = 1421 1390. 5 Best-BlastP =>> nrprot No Hits found 1391. 1 Best-BlastP =>> nrprot 73% Identities = 119/193 (61%), Positives = 151/193 (78%), Gaps = 1/193 (0%) refJNP_820272. 1 j proton transport, putative [Coxiella burnetii RSA 493] gbjAAO90786. 1 j proton transport, putative [Coxiella burnetii RSA 493] Length = 200 1392. 2 Best-BlastP =>> nrprot 41% Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 2/81 (2%) refJZP_00092569. COG3293: Transposase and Inactivated Derivatives [Azotobacter vinelandii] Length = 249 1394. 2 Best-BlastP =>> nrprot 63% Identities = 55/150 (36%), Positives = 95/150 (63%), Gaps = 1/150 (0%) refIZP_00031963. 1 I COG0517: FOG: CBS domain [Burkholderia fungorum] Length = 150 1396. 3 Best-BlastP =>> nrprot 75% Identities = 204/328 (62%), Positives = 250/328 (76%) refINP 484922. Alcohol dehydrogenase [Nostoc sp.  PCC 7120] pirIIAD1916 alcohol dehydrogenase [imported] - Nostoc sp.  (strain PCC 7120) dbjIBAB72836. 1 alcohol dehydrogenase [Nostoc sp.  PCC 7120] Length = 328 1397. 2 Best-BlastP =>> nrprot 52% Identities = 56/149 (37%), Positives = 86/149 (57%), Gaps = 4/149 (2%) refINP_771277. Blr4637 [Bradyrhizobium japonicum] dbjlBAC49902. 1! b1r4637 [Bradyrhizobium japonicum USDA 110] Length = 173 1398. 2 Best-BlastP =>> nrprot 56% Identities = 261/666 (39%), Positives = 375/666 (56%), Gaps = 31/666 (4%) refINP_901612. Probable peptidase [Chromobacterium violaceum ATCC 12472] gbIAAQ59616. Probable peptidase [Chromobacterium violaceum ATCC 12472] Length = 660 1399. 3 Best-BlastP =>> nrprot 47% Identities = 135/479 (28%), Positives = 236/479 (49%), Gaps = 16/479 (3%) refINP 460415. 11 putative POT family, peptide transport protein [Salmonella typhimurium LT2] gbIAAL20374. 11 putative family peptide transport protein [Salmonella typhimurium LT2] Length = 501 1400. 2 Best-BlastP =>> nrprot 71% Identities = 245/484 (50%), Positives = 346/484 (71%), Gaps = 8/484 (1%) refINP_820418. 1 NADH dehydrogenase I, N subunit [Coxiella burnetii RSA 493] gbIAAO90932. 1 NADH dehydrogenase I, N subunit [Coxiella burnetii RSA 493] Length = 482 1402. 2 Best-BlastP =>> nrprot 73% Identities = 289/499 (57%), Positives = 367/499 (73%), Gaps = 1/499 (0%) refINP_820419. 1 NADH dehydrogenase I, M subunit [Coxiella burnetii RSA 493] gbIAAO90933. NADH dehydrogenase I, M subunit [Coxiella burnetii RSA 493] Length = 506-1405. 2 Best-BlastP =>> nrprot 98% Identities = 292/296 (98%), Positive = 293/296 (98%) embICAB43070. 1 DjIA protein [Legionella pneumophila] Length = 296 1406. 2 Best-BlastP =>> nrprot 97% Identities = 401/419 (95%), Positives = 408/419 (97%) embICAB43071. 11 3-Deoxy-D-manno-oct-2-ulosonic acid transferase [Legionella pneumophila] Length = 419 1407. 2 Best-BlastP =>> nrprot No Nits found 1409. 3 Best-BlastP =>> nrprot 60% Identities = 102/245 (41%), Positives = 157/245 (64%), Gaps = 3/245 (1%) refINP_819783. 1 competence lipoprotein ComL, putative [Coxiella burnetii RSA 493] gbIAA090297. 1 competence lipoprotein ComL, putative [Coxiella burnetii RSA 493] Length = 255 141. 4 Best-BlastP =>> nrprot 25% Identities = 116/527 (22%), Positives = 221/527 (41%), Gaps = 72/527 (13%) pir11T18296 myosin heavy chain - Entamoeba histolytica gbIAAB48065. 1 J myosin heavy chain [Entamoeba histolytica] Length = 2139 1410. 2 Best-BlastP =>> nrprot 50% Identities = 94/303 (31%), Positives = 159/303 (52%), Gaps = 8/303 (2%) refINP_931129. Recombination associated protein [Photorhabdus luminescens subsp.  laumondii TT01] embICAE16301. 1J recombination associated protein [Photorhabdus luminescens subsp.  laumondii TTO1] Length = 303 1412. 5 Best-BlastP =>> nrprot 61% Identities = 251/573 (43%), Positives = 359/573 (62%), Gaps = 17/573 (2%) refZNP_00110863. 1 J hypothetical protein [Nostoc punctiform] Length = 578 1413. 2 Best-BlastP =>> nrprot 36% Identities = 99/349 (28%), Positives = 168/349 (48%), Gaps = 18/349 (5%) refINP_284204. 1 putative acyl-CoA ligase [Neisseria meningitidis Z2491] pir1ID81839 probable acyl-CoA ligase (EC 6. 2. 1. -) NMA1482 [imported] Neisseria meningitidis (strain Z2491 serogroup A) embICAB84715. 1 putative acyl-CoA ligase [Neisseria meningitidis Z2491] Length = 517 Best-BlastP =>> nrprot 52% Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 2/70 (2 %) refIZP_00036213. 1 I hypothetical protein [Enterococcus faecium] Length = 77 Best-BlastP =>> nrprot 48% Identities = 75/253 (29%), Positives = 121/253 (47%), Gaps = 30/253 (11%) refJZP_00012801 . 11 hypothetical protein [Rhodopseudomonas palustris] Length = 255 Best-BlastP =>> nrprot 66% Identities = 64/129 (49%), Positives = 88/129 (68%) refIZP_00066647. 1 J hypothetical protein [Microbulbifer degradans 2-40] Length = 164 Best-BlastP =>> nrprot 71% Identities = 295/592 (49%), Positives = 421/592 (71%), Gaps = 2/592 (0 %) refINP_820066. 1! carry, putative [Coxiella burnetii RSA 493] gblAAO90580. 1 transport, putative [Coxiella burnetii RSA 493] Length = 593142. 2 Best-BlastP =>> nrprot 62% Identities = 108/225 (48%), Positives = 144/225 (64%), Gaps = 1/225 (0%) REFINP 455898. D-alanyl-D-alanine dipeptidase [Salmonella enterica subsp.  enterica serovar Typhi] refINP_805294. D-alanyl-D-alanine dipeptidase [Salmonella enterica subsp.  enterica serovar Typhi Ty2] pirllAE0669 D-alanyl-D-alanine dipeptidase [imported] - Salmonella enterica subsp.  enterica serovar Typhi (CT18 strain) embICAD01726. 1! D-alanyl-D-alanine dipeptidase [Salmonella enterica subsp.  enterica serovar Typhi] gbIAAO69143. D-alanyl-D-alanine dipeptidase [Salmonella enterica subsp.  enterica serovar Typhi Ty2] Length = 256 1420. 2 Best-BlastP =>> nrprot 80% Identities = 258/380 (67%), Positives = 309/380 (81%) refINP_820998. Cystathionine beta-lyase [Coxiella burnetii RSA 493] gb! AAO91512. Cystathionine beta-lyase [Coxiella burnetii RSA 493] Length = 387 1421. 3 Best-BlastP =>> nrprot 55% Identities = 280/736 (38%), Positives = 432/736 (58%), Gaps = 19/736 (2%) refINP900703. I conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ58708. 11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 936 1423. 2 Best-BlastP =>> nrprot 66% Identities = 226/450 (50%), Positives = 315/450 (70%), Gaps = 2/450 (0%) pirjJJC5798 FOF1-ATPase (EC 3. 4. -. - beta chain - Methanosarcina barkeri gblAAC38049. 1 ATP synthase beta subunit [Methanosarcina barkeri] Length = 469 1424. 2 Best-BlastP =>> nrprot 37% Identities = 27/106 (25%), Positives = 51/106 (48%) refIzP_00090544. COG0355: FOF1-type ATP synthase, epsilon subunit (mitochondrial delta subunit) [Azotobacter vinelandii] Length = 178 1425. 2 Best-BlastP =>> nrprot 50% Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 2/88 (2%) refINP_661922. 1! ATP synthase, putative [Chlorobium tepidum TLS] gblAAM72264. 11 ATP synthase, putative [Chlorobium tepidum TLS] Length = 1071429. 4 Best-BlastP =>> nrprot 26% Identities = 68/329 (20%), Positives = 131/329 (39%), Gaps = 32/329 (9%) embICAD27470. 1 I SPAPB18E9. 04c [Schizosaccharomyces pombe] Length = 800 1432. 3 Best-BlastP =>> nrprot 52% Identities = 105/294 (35%), Positives = 160/294 (54%), Gaps = 6/294 (2%) refINP_745744. 1 I transcriptional regulator, LysR family [Pseudomonas putida KT2440] gblAAN69208.  11AE016555_6 transcriptional regulator, LysR family [Pseudomonas putida KT2440] Length = 309 1414. 1 1415. 4 1417. 1 1418. 3 Best-BlastP =>> nrprot 52% Identities = 242/765 (31%), Positives = 388/765 (50%), Gaps = 49/765 (6%) refINP842403. ComEC / Rec2 [Nitrosomonas europaea ATCC 19718] embJCAD86320. ComEC / Rec2 [Nitrosomonas europaea ATCC 19718] Length = 799 Best-BlastP =>> nrprot 80% Identities = 428/631 (67%), Positives = 504/631 (79%), Gaps = 6/631 (0%) refINP245307.  1! ParE [Pasteurella multocida] gblAAK02454. 11 ParE [Pasteurella multocida] Length = 632 Best-BlastP =>> nrprot 8% Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%) refINP_618108. 11 cysteine protease (papain Cl family) [Methanosarcina acetivorans str.  C2A] gblAAM06588. Cysteine protease (Papain Cl family) [Methanosarcina acetivorans str.  C2A] Length = 340 Best-BlastP =>> nrprot 55% Identities = 163/398 (40%), Positives = 231/398 (58%), Gaps = 45/398 (11%) refINP_820093. 1 efflux transport, RND family, subunit MFP [Coxiella burnetii RSA 493] gbIAA090607. 11 efflux transport, RND family, subunit MFP [Coxiella burnetii RSA 493] Length = 380 1444. 3 Best-BlastP =>> nrprot 46% Identities = 189/523 (36%), Positives = 282/523 (53%), Gaps = 48/523 (9%) refINP_775139. 1 sphingosine-1-phosphate lyase 1 [Rattus norvegicus] embICAD55407. 1 sphingosine-1-phosphate lyase [Rattus norvegicus] Length = 5681446. 3 Best-BlastP =>> nrprot 71% Identities = 143/246 (58%), Positives = 181/246 (73%) refINP_793532. 1! conserved hypothetical protein [Pseudomonas syringae pv.  tomato str.  DC3000] gblAA057227. Presumed hypothetical protein [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 249 1448. 2 Best-BlastP =>> nrprot 50% Identities = 109/334 (32%), Positives = 172/334 (51%), Gaps = 25/334 (7%) refINP_106951. 1 similar to oxidoreductase [Mesorhizobium loti] dbjIBAB52737. Similar to oxidoreductase [Mesorhizobium loti] Length = 677 1449. 3 Best-BlastP =>> nrprot 52% Identities = 209/735 (28%), Positives = 369/735 (50%), Gaps = 69/735 (9%) refJZP_00042382. 1 J COG2114: Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Magnetococcus sp.  MC-1] Length = 726 1450. 2 Best-BlastP =>> nrprot 57% Identities = 168/388 (43%), Positives = 244/388 (62%), Gaps = 8/388 (2%) refINP_407479. 1J multidrug translocase [Yersinia pestis] refINP_671360. 1 j proton motive force efflux pump protein [Yersinia pestis KIM] pirJJAD0492 multidrug translocase [imported] - Yersinia pestis (strain C092) embJCAC93504. 1 I multidrug translocase [Yersinia pestis C092] gbIAAM87611. 1 JAE014008_5 Proton Motive Force Efflux Pump Protein [Yersinia pestis KIM] Length = 409 1451. 4 Best-BlastP =>> nrprot 65% Identities = 188/426 (44%), Positives = 278/426 (65%), Gaps = 4/426 (0%) refJZP_00034777. COG2252: Permeases [Burkholderia fungorum] Length = 433 1454. 2 Best-BlastP =>> nrprot 88% Identities = 500/638 (78%), Positives = 568/638 (89%) refINP_901459. 1 J protein kinase [Chromobacterium violaceum ATCC 12472] gbJAAQ59463. 1 J protein kinase [Chromobacterium violaceum ATCC 12472] Length = 642 1455. 2 Best-BlastP =>> nrprot 47% Identities = 52/155 (33%), Positives = 81/155 (52%), Gaps = 10/155 (6%) refINP_253150. 1 J conserved hypothetical protein [Pseudomonas aeruginosa PA01] pirjID83087 conserved hypothetical protein PA4460 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG07848. 11AE004860_4 conserved hypothetical protein [Pseudomonas aeruginosa PAOI] Length = 1751434. 3 1438. 4,144. 3 1440. 2 Best-BlastP =>> nrprot 80% Identities = 165/238 (69%), Positives = 194/238 (81%) refINP_719490. 11 ABC transporter, ATP-binding protein [Shewanella oneidensis MR-1] gbjAAN56934. 11AE015827_6 ABC transporter, ATP-binding protein [Shewanella oneidensis MR-1] Length = 243 Best-BlastP =>> nrprot 73% Identities = 105/185 (56%), Positives = 141/185 (76%), Gaps = 1 / 185 (0%) refJZP_00079751. 1 COG0512: Anthranilate / para-aminobenzoate synthase component II [Geobacter metallireducens] Length = 189 Best-BlastP =>> nrprot 68% Identities = 167/315 (53%), Positives = 214/315 (67%), Gaps = 20 / 315 (6%) refINP819187. 1 UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii RSA 493] gblAA089701. 11 UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii RSA 493] Length = 316 Best-BlastP =>> nrprot 66% Identities = 170/375 (45%), Positives = 241/375 (64%), Gaps = 16/375 (4%) refINP_773078. D-alanine - D-alanine ligase A [Bradyrhizobium japonicum] dbjjBAC51703. 1 l D-alanine - D-alanine ligase A [Bradyrhizobium japonicum USDA 110] Length = 373 Best-BlastP =>> nrprot 71% Identities = 94/205 (45%), Positives = 152/205 (74%) refJNP_841948 . 1 1 Prokaryotic-type carbonic anhydrase [Nitrosomonas europaea ATCC 19718] embICAD85837. Prokaryotic carbonic anhydrase type [Nitrosomonas europaea ATCC 19718] Length = 208 1467. 5 Best-BlastP =>> nrprot 65% Identities = 90/186 (48%), Positives = 126/186 (67%), Gaps = 2/186 (1%) refJNP_691260. 1 j hypothetical protein [Oceanobacillus iheyensis HTE831] dbjjBAC12295. 1j hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 189 1469. 4 Best-BlastP =>> nrprot 20% Identities = 112/493 (22%), Positives = 217/493 (44%), Gaps = 44/493 (8%) refJNP_563924. 1 nuclear matrix constitute protein -related [Arabidopsis thaliana] pirjjG86266 hypothetical protein F3F19. Arabidopsis thaliana gbIAAD31075.  11A0007357_24 Similar to gbjD64087 nuclear matrix constitute protein 1 (NMCP1) from Daucus carota.  [Arabidopsis thaliana] Length = 1128 1473. 4 Best-BlastP =>> nrprot 49% Identities = 44/143 (30%), Positives = 75/143 (52%), Gaps = 4/143 (2%) refjNP_810648. Chromate transport protein [Bacteroides thetaiotaomicron VPI-5482] gblAAO76842. 1 Chromate Transport Protein [Bacteroides thetaiotaomicron VPI-5482] Length = 185 1474. 4 Best-BlastP =>> nrprot 52% Identities = 125/314 (39%), Positives = 194/314 (61%), Gaps = 4/314 (1%) reflNP_103760. 1 day unknown protein [Mesorhizobium loti] dbjjBAB49546. 1 I unknown protein [Mesorhizobium loti] Length = 431 1475. 2 Best-BlastP =>> nrprot No Nits found 1476. 2 Best-BlastP =>> nrprot 81% Identities = 185/302 (61%), Positives = 246/302 (81%), Gaps = 1/302 (0%) refJNP_762779. 1 j Glutathione synthase; Ribosomal protein S6 enzyme modification [Vibrio vulnificus CMCP6] gbjAAO07769. 11AE016811_10 Glutathione synthase; Ribosomal protein S6 enzyme modification [Vibrio vulnificus CMCP6] dbjjBAC97337. Ribosomal Protein S6 Modification Protein [Vibrio vulnificus YJ016] Length = 301 1479. 3 Best-BlastP =>> nrprot 69% Identities = 223/407 (54%), Positives = 287/407 (70%), Gaps = 1/407 (0%) spIQ8GDU51ARLY_HELMO Argininosuccinate lyase (Arginosuccinase) (ASAL) gbIAAN87483. 1 Argininosuccinate lyase [Heliobacillus mobilis] Length = 458 148. 2 Best-BlastP =>> nrprot 55% Identities = 186/450 (41%), Positives = 279/450 (62%), Gaps = 14/450 (3%) refJZP_00060071. COG2200: FOG: EAL domain [Clostridium thermocellum ATCC 27405] Length = 8621456. 2 1457. 2 1461. 3 1463. 2 1466. 2 Best-BlastP =>> nrprot 51% Identities = 128/304 (42%), Positives = 191/304 (62%), Gaps = 9/304 (2%) refINP_126998. Ornithine carbamoyltransferase [Pyrococcus abyssi] spl09365610TC_PYRAB Ornithine carbamoyltransferase (OTCase) pine 1G75041 ornithine carbamoyltransferase (argf) PAB1502 - Pyrococcus abyssi (strain Orsay) emblCAB50228. 1 ArgF ornithine carbamoyltransferase [Pyrococcus abyssi] Length = 317 Best-BlastP =>> nrprot 22% Identities = 40/150 (26%), Positives = 71/150 (47%) refINP819099. 1 hypothetical protein [Coxiella burnetii RSA 493] gblAAO89613. 11 hypothetical protein [Coxiella burnetii RSA 493] Length = 250 Best-BlastP =>> nrprot 72% Identities = 126/223 (56%), Positives = 164/223 (73%) refJZP_00053873. COG1136: ABC-type antimicrobial peptide transport system, ATPase component [Magnetospirillum magnetotacticum] Length = 225 Best-BlastP =>> nrprot 64% Identities = 171/414 (41%), Positives = 268/414 (64%), Gaps = 4/414 (0%) refJNP_436895. 11 CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] pir1IC95886 conserved hypothetical protein [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB emblCAC48755. 1 d CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 413 1487. 3 Best-BlastP =>> nrprot 99% Identities = 266/268 (99%), Positives =

  268/268 (100%) embiCAB65183.11 enoyl reductase [Legionella pneumophila] Length = 268 1488.2 Best-BlastP =>> nrprot No Hits found 1490.4 Best-BlastP =>> nrprot 72% Identities = 536/927 (57%), Positive = 679/927 (73%), Gaps = 9/927 (0%) refINP_819435.11 isoleucyl-tRNA synthetase [Coxiella burnetii RSA 493] gblAAO89949.1 I isoleucyl-tRNA synthetase [Coxiella burnetii RSA 493] Length = 936 Best -BlastP =>> nrprot 69% Identities = 822/1621 (50%), Positives = 1137/1621 (70%), Gaps = 3/1621 (0%) refINP_820221.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90735.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 1619 Best-BlastP =>> nrprot 33% Identities = 58/170 (34%), Positives = 89/170 (52%), Gaps = 1/170 (0%) refiZP_00081963.11 COG0204: 1-acylsn-glycerol-3-phosphate acyltransferase [Geobacter metallireducens] Length = 234 Best-BlastP =>> nrprot 72% Identities = 60/104 (57%), Positives = 78/104 (75%) REFINP 458777.1 SugE protein [Salmonella enterica] subsp. enterica serovar Typhi] refINP_463202.1 putative DMT superfamily transport protein [Salmonella typhimurium LT2] refINP_807981.11 SugE protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] pirllAE1046 SugE protein [imported] - Salmonella enterica subsp.

  enterica serovar Typhi strain CT18 gbIAAL23161. 11 putative DMT superfamily transport protein [Salmonella typhimurium LT2] embICAD06818.  I. SugE protein [Salmonella enterica subsp.  enterica serovar Typhi] gbIAAO71841. 11 SugE protein [Salmonella enterica subsp.  enterica serovar Typhi Ty2] Length = 105 1497. 2 Best-BlastP =>> nrprot 66% Identities = 189/335 (56%), Positives = 236/335 (70%) refiZP_00125893. 1 COG0389: Nucleotidyltransferase / DNA polymerase involved in DNA repair [Pseudomonas syringae pv.  syringae B728a] Length = 354 15. 1 Best-BlastP =>> nrprot 63% Identities = 181/393 (46%), Positives = 248/393 (63%), Gaps = 20/393 (5%) refINP_890078. 1 integrase phage [Bordetella bronchiseptica] emblCAE34037. I integrase phage [Bordetella bronchiseptica] Length = 407 150. 2 Best-BlastP =>> nrprot 52% Identities = 130/266 (48%), Positives = 172/266 (64%), Gaps = 8/266 (3%) refZER_00029131. COG3243: Poly (3hydroxyalkanoate) synthetase [Burkholderia fungorum] Length = 642 1481. 3 1482. 4 1484. 2 1485. 1493. 6 1494. 2 1495. 1 1501. 3 Best-BlastP =>> nrprot 72% Identities = 139/276 (50%), Positives = 200/276 (72%), Gaps = 2/276 (0%) refINP_519387. 11 PROBABLE SNGLYCEROL-3-PHOSPHATE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [Ralstonia solanacearum] embJCAD14968. 1 PROBABLE SN-GLYCEROL-3-PHOSPHATE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [Ralstonia solanacearum] Length 282 1503. 4 Best-BlastP =>> nrprot 65% Identities = 183/364 (50%), Positives = 239/364 (65%), Gaps = 15/364 (4%) refINP 407240. Glycerol-3-phosphate transport, ATP-binding protein [Yersinia pestis] pirIIAH0461 sn-glycerol-3-phosphate transport, ATP-binding protein ugpC [imported] - Yersinia pestis (strain C092), and embicAC93260. 1-sn-glycerol-3-phosphate transport, ATP-binding protein [Yersinia pestis C092] Length = 357 1505. 4 Best-BlastP =>> nrprot No Hits found 1507. 3 Best-BlastP =>> nrprot 64% Identities = 226/496 (45%), Positives = 318/496 (64%), Gaps = 4/496 (0%) refINP_231057. 1 thermostable carboxypeptidase 1 [Vibrio cholerae 01 biovar eltor str.  N16961] pirlIB82202 thermostable carboxypeptidase 1 VC1414 [imported] Vibrio cholerae (strain N16961 serogroup 01) gbIAAF94571. 11 thermostable carboxypeptidase 1 [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 524 1508. 4 Best-BlastP =>> nrprot 38% Identities = 85/279 (30%), Positives = 141/279 (50%), Gaps = 9/279 (3%) refINP_622993. 1 J predicted nucleotideutilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [Thermoanaerobacter tengcongensis] gbjAAM24597. 1 J predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis MoeA enzyme [Thermoanaerobacter tengcongensis] Length = 412 151. 2 Best-BlastP =>> nrprot 70% Identities = 128/248 (51%), Positives = 176/248 (70%), Gaps = 4/248 (1%) refINP902034. 1 acetoacetyl-CoA reductase [Chromobacterium violaceum ATCC 12472] gbJAAQ60036. Acetoacetyl-CoA reductase [Chromobacterium violaceum ATCC 12472] Length = 246 1510. 3 Best-BlastP =>> nrprot 64% Identities = 136/259 (52%), Positives = 177/259 (68%), Gaps = 1/259 (0%) refJZP_00083725. COG3186: Phenylalanine-4-hydroxylase [Pseudomonas fluorescens PfO-1] Length = 263 1511. 3 Best-BlastP =>> nrprot 99% Identities = 217/219 (99%), Positives = 218/219 (99%) gblAAL79360. 1 J GacA regulatory protein [Legionella pneumophila] Length = 219 1513. 4 Best-BlastP =>> nrprot 61% Identities = 181/448 (40%), Positives = 276/448 (61%), Gaps = 20/448 (4%) refINP_820336. 1 amino acid antiporter [Coxiella burnetii RSA 493] gbJAA090850. 1 amino acid antiporter [Coxiella burnetii RSA 493] Length = 474 1515. 2 Best-BlastP =>> nrprot 73% Identities = 127/255 (49%), Positives = 188/255 (73%), Gaps = 1/255 (0%) refINP_249886. I hypothetical protein [Pseudomonas aeruginosa PA01] pir1IF83497 hypothetical protein PA1195 [imported] - Pseudomonas aeruginosa (strain PA01) gbIAAG04584. 1 JAE004549_11 hypothetical protein PA1195 [Pseudomonas aeruginosa PAOI] Length = 254 1516. 3 Best-BlastP =>> nrprot 39% Identities = 69/269 (25%), Positives = 123/269 (45%), Gaps = 14/269 (5%) refINP_826905. 1 J hypothetical protein [Streptomyces avermitilis MA-4680] dbjJBAC73440. 1 hypothetical protein [Streptomyces avermitilis MA-4680] Length = 290 1517. 3 Best-BlastP =>> nrprot 58% Identities = 164/368 (44%), Positives = 244/368 (66%), Gaps = 1/368 (0%) refJZP_00034488. 1 J COG0156: 7-keto-8-aminopelargonate synthetase and related enzymes [Burkholderia fungorum] Length = 429 Best-BlastP =>> nrprot 53% Identities = 126/333 (37%), Positives = 184/333 (55%) , Gaps = 4/333 (1%) refIZP_00034487. 1 I COG0784: FOG: Chey-like receiver [Burkholderia fungorum] Length = 333 Best-BlastP =>> nrprot 50% Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 8 / 120 (6%) refINP_459344. I putative outer membrane lipoprotein [Salmonella typhimurium LT2] gbIAAL19303. 1 I putative outer lipoprotein membrane [Salmonella typhimurium LT2] Length = 119 Best-BlastP =>> nrprot 56% Identities = 69/170 (40%), Positives = 107/170 (62%) refINP_541215. 1 I HDED PROTEIN [Brucella melitensis] refINP_700223. 1 I conserved hypothetical protein [Brucella suis 1330] pirIIAD3539 hdeD protein [imported] - Brucella melitensis (strain 16M) gbIAAL53479. 1 I HDED PROTEIN [Brucella melitensis 16M] gblAAN34228. 1 JAE014598_9 conserved hypothetical protein [Brucella suis 1330] Length = 187 1522. 2 Best-BlastP =>> nrprot 32% Identities = 77/231 (33%), Positives = 127/231 (54%), Gaps = 1/231 (0%) refINP_691224. 1 j hypothetical protein [Oceanobacillus iheyensis HTE831] dbjIBAC12259. 1 J hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 243 1523. 2 Best-BlastP =>> nrprot No Hits found 1524. 3 Best-BlastP =>> nrprot 21% Identities = 48/129 (37%), Positives = 76/129 (58%), Gaps = 4/129 (3%) refINP_561262. 1 probable transcriptional regulator [Clostridium perfringens] dbjIBAB80052. 1 probable transcriptional regulator [Clostridium perfringens str.  13] Length = 249 1525. 3 Best-BlastP =>> nrprot 51% Identities = 137/384 (35%), Positives = 217/384 (56%), Gaps = 24/384 (6%) gblAAM73854. 11AF454865_1 putative phospholipase C [Legionella pneumophila] Length = 423 1528. 4 Best-BlastP =>> nrprot 65% Identities = 214/446 (47%), Positives = 291/446 (65%), Gaps = 6/446 (1%) spIQ8PMU6IRUMA_XANAC 23S rRNA (Uracil-5 -) - methyltransferase rumA (23S rRNA (M-5-U1939) -methyltransferase) Length = 444 1529. 2 Best-BlastP =>> nrprot 77% Identities = 253/394 (64%), Positives = 309/394 (78%) refINP_416880. 1 I putative aminotransferase [Escherichia coli K12] spIP77434IYFDZ ECOLI Hypothetical aminotransferase yfdZ pirIIH65011 probable transaminase (EC 2. 6. 1. -) b2379 [similarity] - Escherichia coli (strain K-12) gbIAAC75438. 1I putative aminotransferase [Escherichia coli K12] dbjlBAA16249. 11 PROBABLE ASPARTATE AMINOTRANSFERASE (EC 2. 6. 1. 1) (TRANSAMINASE A) (ASPAT).  [Escherichia coli] Length = 412 Best-BlastP =>> nrprot 99% Identities = 436/437 (99%), Positives = 437/437 (100%) gblAAM00622. 1 = chemiosmotic efflux system C protein C [Legionella pneumophila] Length = 445 Best-BlastP =>> nrprot 52% Identities = 38/108 (35%), Positive = 64/108 (59%) refINP819878. I conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90392. 1 j conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 123 Best-BlastP =>> nrprot 71% Identities = 360/746 (48%), Positives = 523/746 (70%), Gaps = 17/746 (2 %) reflZP_00126361. COG0317: Guanosine polyphosphate pyrophosphohydrolases / synthetases [Pseudomonas syringae pv.  syringae B728a] Length = 747 1519. 2,152. 3 1521. 2,153. 2 1530. 2 1531. 3 1532. 3 Best-BlastP =>> nrprot 52% Identities = 217/688 (31%), Positives = 341/688 (49%), Gaps = 49/688 (7%) refINP_249777. 1 J flagellar hookassociated protein 1 FIgK [Pseudomonas aeruginosa PAOI] pirllD83511 flagellar hook-associated protein 1 FIgK PA1086 [imported] - Pseudomonas aeruginosa (strain PAOI) gbjAAG04475. 11AE004539_17 flagellar hook-associated protein 1 FIgK [Pseudomonas aeruginosa PAO1] Length = 683 1533. 1 Best-BlastP =>> nrprot 52% Identities = 120/413 (29%), Positives = 218/413 (52%), Gaps = 12/413 (2%) refJNP_718794. Flagellar hookassociated protein FIgL [Shewanella oneidensis MR-1] gblAAN56238.  FIELD [Shewanella oneidensis MR-1] Length = 403 1536. 3 Best-BlastP =>> nrprot 59% Identities = 259/616 (42%), Positives = 374/616 (60%), Gaps = 9/616 (1%) refINP_900243. 1! potassium uptake protein [Chromobacterium violaceum ATCC 12472] gblAAQ58249. 1! potassium uptake protein [Chromobacterium violaceum ATCC 12472] Length = 621 1539. 2 Best-BlastP =>> nrprot No Hits found 154. 1 1542. 2 hydratase / isomerase family protein [Coxiella burnetii RSA 493] gblAAO91347. 11 enoyl-CoA hydratase / isomerase family protein [Coxiella burnetii RSA 493] Length = 356 1545. 3 Best-BlastP =>> nrprot 74% Identities = 319/546 (58%), Positives = 411/546 (75%), Gaps = 7/546 (1%) reflNP_745048. 1 glutaminyl-tRNA synthetase [Pseudomonas putida KT2440] gblAAN68512. 1 IAE016483_3 glutaminyl-tRNA synthetase [Pseudomonas putida KT2440] Length = 567 1547. 2 Best-BlastP =>> nrprot 66% Identities = 132/266 (49%), Positives = 182/266 (68%), Gaps = 2/266 (0%) refINP_520102. 1 d PROBABLE TRYPTOPHAN SYNTHASE (ALPHA CHAIN) PROTEIN [Ralstonia solanacearum] embICAD15683. 1 PROBABLE TRYPTOPHAN SYNTHASE (ALPHA CHAIN) PROTEIN [Ralstonia solanacearum] Length = 265 1548. 2 Best-BlastP =>> nrprot 55% Identities = 83/198 (41%), Positives = 129/198 (65%), Gaps = 1/198 (0%) reflNP_866390. 1 ATP synthase a subunit [Pirellula sp. ] embICAD78171. ATP synthase a subunit [Pirellula sp. ] Length = 228 1549. 1 Best-BlastP =>> nrprot 66% Identities = 46/73 (63%), Positives = 61/73 (83%) refIZP_00034461. 1 COG0636: FOF1-type ATP synthase, subunit c / Archaeal / vacuolar-type H ± ATPase, K subunit [Burkholderia fungorum] Length = 82 1550. 2 Best-BlastP =>> nrprot 50% Identities = 63/254 (24%), Positives = 125/254 (49%), Gaps = 10/254 (3%) refINP_617341. 1 H (+) - transporting ATP synthase, subunit B [Methanosarcina acetivorans str.  C2A] gbIAAM05821. 1 1 H (+) - transporting ATP synthase, subunit B [Methanosarcina acetivorans str.  C2A] Length = 329 1552. 3 Best-BlastP =>> nrprot 87% Identities = 381/511 (74%), Positives = 452/511 (88%), Gaps = 1/511 (0%) refIZP_00065462. 1 COG0056: FOF1-type ATP synthase, alpha subunit [Microbulbifer degradans 2-40] Length = 513 1555.  2 Best-BlastP =>> nrprot 79% Identities = 189/288 (65%), Positives = 231/288 (80%), Gaps = 2/288 (0%) refINP_254242. ATP synthase gamma chain [Pseudomonas aeruginosa PA01] pir11D82952 ATP synthase gamma chain PA5555 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG08940.  11AE004967_11 ATP synthase gamma chain [Pseudomonas aeruginosa PAOI] Length = 286 Best-BlastP =>> nrprot 98% Identities = 312/322 (96%), Positives = 317/322 (98%) gblAAM00621. 1! chemosmotic efflux system C protein [Legionella pneumophila] Length = 322 Best-BlastP =>> nrprot 63% Identities = 161/342 (47%), Positives = 225/342 (65%), Gaps = 5/342 (1% ) ref1NP_820833. 1 I enoyl-CoA 1556. 2 Best-BlastP =>> nrprot 92% Identities = 395/458 (86%), Positives = 423/458 (92%), Gaps = 1/458 (0%) pirlID64071 H ± transporting twosector ATPase (EC 3. 6. 3. 14) beta chain - Haemophilus influenzae (strain Rd KW20) Length = 468 1557. 3 Best-BlastP =>> nrprot 90% Identities = 227/291 (78%), Positives = 265/291 (91%) refINP_820381. Succinyl-CoA synthetase, alpha subunit [Coxiella burnetii RSA 493] spIP53591 ISUCD_COXBU Succinyl-CoA synthetase alpha chain (SCS-alpha) gb! AAO90895. Succinyl-CoA synthetase, alpha subunit [Coxiella burnetii RSA 493] Length = 294 1559. 2 Best-BlastP =>> nrprot 80% Identities = 269/384 (70%), Positives = 314/384 (81%) refINP_250279. Succinyl-CoA synthetase beta chain [Pseudomonas aeruginosa PA01] spIP53593ISUCC_PSEAE Succinyl-CoA synthetase beta chain (SCS-beta) pir1IA83446 succinyl-CoA synthetase beta chain PA1588 [imported] - Pseudomonas aeruginosa (strain PAOI) gblAAG04977. Succinyl-CoA synthetase beta chain [Pseudomonas aeruginosa PAO1] Length = 388 1560. 2 Best-BlastP =>> nrprot 59% Identifies = 115/277 (41%), Positives = 166/277 (59%), Gaps = 11/277 (3%) refINP_442598. 1 J PIeD gene product homologue [Synechocystis sp.  PCC 6803] pirIIS76977 pleD-4 protein - Synechocystis sp.  (strain PCC 6803) dbjIBAA10669. 1, s1r0302 [Synechocystis sp.  PCC 6803] Length = 768 1562. 3 Best-BlastP =>> nrprot 34% Identities = 51/213 (23%), Positives = 94/213 (44%), Gaps = 27/213 (12%) refINP_705294. 1 I hypothetical protein [Plasmodium falciparum 3D7] embICAD52531. 1 I hypothetical protein [Plasmodium falciparum 3D7] Length = 1936 1563. 3 Best-BlastP =>> nrprot 64% Identities = 95/200 (47%), Positives = 134/200 (67%), Gaps = 1/200 (0%) refgP_00087981. COG1335: Amidases related to nicotinamidase [Pseudomonas fluorescens PfO-1] Length = 208 1564. 3 Best-BlastP =>> nrprot 81% Identities = 321/467 (68%), Positives = 380/467 (81%) refINP_820039. 1 I nicotinate phosphoribosyltransferase, putative [Coxiella burnetii RSA 493] gbIAAO90553. 1 nicotinate phosphoribosyltransferase, putative [Coxiella burnetii RSA 493] Length = 468 1566. 3 Best-BlastP =>> nrprot 25% Identities = 34/120 (28%), Positives = 47/120 (39%), Gaps = 18/120 (15%) gbIAAQ23913. 11 metallothionein IIE [Crassostrea virginica] Length = 149 1567. 2 Best-BlastP =>> nrprot 28% Identities = 58/293 (19%), Positives = 127/293 (43%), Gaps = 21/293 (7%) pirlIT14867 interaptin-slime mold (Dictyostelium discoideum) gblAAC34582. 11 interaptin [Dictyostelium discoideum] Length = 1738 1569. 6 Best-BlastP =>> nrprot 62% Identities = 310/738 (42%), Positives = 456/738 (61%), Gaps = 24/738 (3%) refINP_796632. 1 I primosomal protein N '[Vibrio parahaemolyticus RIMD 2210633] dbjIBAC58516. 1 I primosomal protein N '[Vibrio parahaemolyticus] Length = 734 157. 2 Best-BlastP =>> nrprot 90% Identities = 886/1061 (83%), Positives = 973/1061 (91%) gbIAAM00612. Chemiosmotic efflux system protein A-like protein [Legionella pneumophila] Length = 1066 1570. 4 Best-BlastP =>> nrprot 74% Identities = 612/1047 (58%), Positives = 788/1047 (75%), Gaps = 9/1047 (0%) reflZP_00034374. COG0841: Cation / multidrug efflux pump [Burkholderia fungorum] Length = 1098 1575. 2 Best-BlastP =>> nrprot 50% Identities = 46/122 (37%), Positives = 71/122 (58%), Gaps = 7/122 (5%) refINP_925923. 1 I MarR family transcriptional regulatory protein [Gloeobacter violaceus] dbjIBAC90918. 1 I MarR family transcriptional regulatory protein [Gloeobacter violaceus] Length = 143 Best-BlastP =>> nrprot 63% Identities = 425/983 (43%), Positives = 617/983 (62%), Gaps = 35/983 (3) %) refINP_288121. 11 putative oxidase [Escherichia coli O157: H7 EDL933] refINP_310421. 1 putative oxidase [Escherichia coli O157: H7] pir11B90928 probable oxidase [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) pir1IF85776 probable oxidase ydiJ [imported] - Escherichia coli (strain O157: H7, substrain EDL933) gblAAG56674. 11AE005391_11 putative oxidase [Escherichia coli O157: H7 EDL933] dbjIBAB35817. 1 putative oxidase [Escherichia coli O157: H7] Length = 1018 Best-BlastP =>> nrprot 67% Identities = 135/246 (54%), Positives = 173/246 (70%), Gaps = 3/246 (1% ) refINP 436290. 11 Hypothetical protein [Sinorhizobium meliloti] pirIID95392 protein [imported] - Sinorhizobium meliloti (strain 1021) magapiasmid pSymA gblAAK65702. Hypothetical protein [Sinorhizobium meliloti] Length = 408 Best-BlastP =>> nrprot 44% Identities = 36/124 (29%), Positives = 68/124 (54%), Gaps = 5/124 (4%) refINP_635420. 11 conserved hypothetical protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] gblAAM39344. 11 conserved hypothetical protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] Length = 143 158.  2 Best-BlastP =>> nrprot 74% Identities = 139/205 (67%), Positives = 165/205 (80%), Gaps = 1/205 (0%) refINP_478237. 1 ORF_ID: aII7590 unknown protein [Nostoc sp.  PCC 7120] pirlIAC2538 hypothetical protein al17590 [imported] - Nostoc sp.  (strain PCC 7120) plasmid pCC7120beta dbjlBAB77233. ORF_ID: a1I7590 unknown protein [Nostoc sp.  PCC 7120] Length = 217 1581. 4 Best-BlastP =>> nrprot No Hits found 1582. 2 Best-BlastP =>> nrprot 76% Identities = 99/138 (71%), Positives = 115/138 (83%), Gaps = 2/138 (1%) refINP_233004. Peptide methionine sulfoxide reductase [Vibrio cholerae 01 biovar eltor str.  N16961] pirlIC82439 peptide methionine sulfoxide reductase VCA0615 [imported] Vibrio cholerae (strain N16961 serogroup 01) gblAAF96516. 1 peptide methionine sulfoxide reductase [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 394 1584. 3 Best-BlastP =>> nrprot 79% Identities = 574/901 (63%), Positives = 711/901 (78%), Gaps = 7/901 (0%) refINP_285794.  11 preprotein translocase; secretion protein [Escherichia coli O157: H7 EDL933] refINP_308129. 1 J preprotein translocase SecA [Escherichia coli O157: H7] refINP_752070. 1 Preprotein translocase secA subunit [Escherichia coli CFT073] pirlIF90641 preprotein translocase SecA [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) pir1IF85492 preprotein translocase, secretion protein [imported] Escherichia coli (strain O157: H7, substrate EDL933 ) gbJAAG54402. 11AE005186_8 preprotein translocase; secretion protein [Escherichia coli O157: H7 EDL933] dbjIBAB33525. 1 j preprotein translocase SecA [Escherichia coli O157: H7] gb17AAN78614. 11AE016755_114 Preprotein translocase secA subunit [Escherichia coli CFT073] Length = 901 1585. 2 Best-BlastP =>> nrprot 54% Identities = 115/350 (32%), Positives = 194/350 (55%), Gaps = 31/350 (8%) refINP642273. 1 l flagellar protein [Xanthomonas axonopodis pv.  citri str.  306] gbIAAM36809. 1 flagellar protein [Xanthomonas axonopodis pv.  citri str.  306] Length = 337 1586. 2 Best-BlastP =>> nrprot No Hits found 1587. 4 Best-BlastP =>> nrprot 43% Identities = 139/387 (35%), Positives = 203/387 (52%), Gaps = 19/387 (4%) refINP_643897. Oxidoreductase [Xanthomonas axonopodis pv.  citri str.  306] gblAAM38433. Oxidoreductase [Xanthomonas axonopodis pv.  citri str.  306] Length = 443 1577. 1578. 3 1579. 4 1589. 3 Best-BlastP =>> nrprot 79% Identities = 138/220 (62%), Positives = 179/220 (81%), Gaps = 2/220 (0%) refINP_820222. 1 DNA-binding response regulator [Coxiella burnetii RSA 493] gbJAA090736. 1 DNA-binding response regulator [Coxiella burnetii RSA 493] Length = 223,159. 1 Best-BlastP =>> nrprot 54% Identities = 44/97 (45%), Positives = 57/97 (58%), Gaps = 14/97 (14%) refINP_747491. 11 hypothetical protein [Pseudomonas putida KT2440] gblAAN70955. 11AE016739_8 hypothetical protein [Pseudomonas putida KT2440] Length = 91 1590. 1 Best-BlastP =>> nrprot 69% Identities = 92/172 (53%), Positives = 126/172 (73%) refINP_819923. Intracellular septation protein A [Coxiella burnetii RSA 493] gbIAA090437. Intracellular Septation Protein A [Coxiella burnetii RSA 493] Length = 181 1591. 4 Best-BlastP =>> nrprot 56% Identities = 183/441 (41%), Positives = 275/441 (62%), Gaps = 13/441 (2%) refJZP_00065233. COG0741: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM / invasin domains) [Microbulbifer degradans 2-40] Length = 543 1592. 3 Best-BlastP =>> nrprot 62% Identities = 130/295 (44%), Positives = 191/295 (64%) refINP 406039. 1 J putative membrane protein [Yersinia pestis] refINP_669001. 11 hypothetical [Yersinia pestis KIM] pirjlAB0306 probable membrane protein YP02505 [imported] - Yersinia pestis (strain C092) emblCAC91310. 1 putative membrane protein [Yersinia pestis C092] gblAAM85252. 1 IAE013771_7 Hypothetical [Yersinia pestis KIM] Length = 312 1594. 2 Best-BlastP =>> nrprot 57% Identities = 83/248 (33%), Positives = 138/248 (55%), Gaps = 14/248 (5%) refINP_842295. 1 possible BioH, catalyzes some early step in biotin biosynthesis [Nitrosomonas europaea ATCC 19718] embICAD86210. 11 possible BioH, Catalysts some early step biotin biosynthesis [Nitrosomonas europaea ATCC 19718] Length = 259 1595. 3 Best-BlastP =>> nrprot 52% Identities = 130/329 (39%), Positives = 199/329 (60%), Gaps = 2/329 (0%) refINP_790344. 1! 8-amino-7-oxononanoate synthase [Pseudomonas syringae pv.  tomato str.  DC3000] gbJAA054039. 1 1 8-amino-7-oxononanoate synthase [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 396 1598. 6 Best-BlastP =>> nrprot 75% Identities = 189/307 (61%), Positives = 240/307 (78%) gbIAAG47791. 11AF311738_7 BioB [Mesorhizobium loti] emb (CAD31399. BIOTIN SYNTHASE PROTEIN [Mesorhizobium loti] Length = 331 1599. 4 Best-BlastP =>> nrprot 48% Identities = 481/1746 (27%), Positives = 836/1746 (47%), Gaps = 149/1746 (8%) refINP_932226. I putative conjugative transfer protein Tral [Vibrio vulnificus YJ016] dbjIBAC97749.  1 putative conjugative transfer protein Tral [Vibrio vulnificus YJ016] Length = 1924 16. 1 Best-BlastP =>> nrprot 60% Identities = 34/55 (61%), Positives = 42/55 (76%) refINP 890077. I putative phage excisionase [Bordetella 160. 1 1601. 3 hydrolase, family 3 [Chlorobium tepidum TLS] gbjAAM71338. 11 glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] Length = 372 1602. 2 Best-BlastP =>> nrprot 52% Identities = 133/394 (33%), Positives = 207/394 (52%), Gaps = 17/394 (4%) refINP_798008. I putative SAM-dependent methyltransferase [Vibrio parahaemolyticus RIMD 2210633] dbjlBAC59892. 1 putative SAM-dependent methyltransferase [Vibrio parahaemolyticus] Length = 418 bronchiseptica] emblCAE34036. 1 putative phage excisionase [Bordetella bronchiseptica] Length = 84 Best-BlastP =>> nrprot 35% Identities = 36/95 (37%), Positives = 43/95 (45%), Gaps = 7/95 (7%) gblAAF86199. 1 JAF238885_2 VrrB [Bacillus anthracis] Length = 265 Best-BlastP =>> nrprot 61% Identities = 166/370 (44%), Positives = 236/370 (63%), Gaps = 17/370 (4%) refINP_660996. 1 l glycosyl 1603. 3 Best-BlastP =>> nrprot 10% Identities = 40/105 (38%), Positive = 55/105 (52%), Gaps = 5/105 (4%) pdbI1NORIA Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 1606. 2 Best-BlastP =>> nrprot 64% Identities = 136/270 (50%), Positives = 178/270 (65%) reflZP_00065849. 1 l COG0266: Formamidopyrimidine-DNA glycosylase [Microbulbifer degradans 2-40] Length = 271 1607. 2 Best-BlastP =>> nrprot 55% Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 1/78 (1%) refINP_820114. 11 hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90628. 1! hypothetical protein [Coxiella burnetii RSA 493] Length = 105 1608. 2 Best-BlastP =>> nrprot 70% Identities = 201/383 (52%), Positives = 279/383 (72%) refINP_903067. 1 probable stearoyl-CoA 9-desaturase [Chromobacterium violaceum ATCC 12472] gbIAAQ61061. Probably stearoylCoA 9-desaturase [Chromobacterium violaceum ATCC 12472] Length = 405 1611. 5 Best-BlastP =>> nrprot 75% Identities = 206/338 (60%), Positives = 260/338 (76%), Gaps = 1/338 (0%) refIDP_00085994. COG0128: 5enolpyruvylshikimate-3-phosphate synthase [Pseudomonas fluorescens PfO-1] Length = 679 1615. 2 Best-BlastP =>> nrprot 64% Identities = 291/607 (47%), Positives = 389/607 (64%), Gaps = 17/607 (2%) refINP_826054. I putative oxidoreductase [Streptomyces avermitilis MA-4680] dbjIBAC72589. 1 putative oxidoreductase [Streptomyces avermitilis MA-4680] Length = 642 1617. 3 Best-BlastP =>> nrprot 62% Identities = 77/167 (46%), Positives = 107/167 (64%), Gaps = 3/167 (1%) refINP_820461. Alkylhydroperoxidase AhpD family core domain protein [Coxiella burnetii RSA 493] gbIAAO90975. 1 Alkylhydroperoxidase AhpD family core domain protein [Coxiella burnetii RSA 493] Length = 177 1618. 3 Best-BlastP =>> nrprot 97% Identities = 159/162 (98%), Positives = 159/162 (98%) spIP536371SODC_LEGPN Superoxide dismutase [Cu-Zn] precursor dbjIBAA06223. 1 [Cu, Zn] -superoxide dismutase [Legionella pneumophila] gbIAAB36467. 1 periplasmic copper-zinc superoxide dismutas; CuZnSOD [Legionella pneumophila] Length = 162 1623. 4 Best-BlastP =>> nrprot 46% Identities = 115/438 (26%), Positives = 202/438 (46%), Gaps = 28/438 (6%) refINP_873416. I preserved hypothetical protein [Haemophilus ducreyi 35000HP] gbIAAP95805. 11 conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 665 1624. 4 Best-BlastP =>> nrprot 42% Identities = 121/543 (22%), Positives = 225/543 (41%), Gaps = 73/543 (13%) refIDP_00089633. 1 I hypothetical protein [Azotobacter vinelandii] Length = 642 1625. 3 Best-BlastP =>> nrprot 90% Identities = 317/379 (83%), Positives = 345/379 (91%) gbIAAP88975. 11 S-adenosylmethionine synthetase [Amoeba proteus symbiotic bacterium] Length = 381 1626. 3 Best-BlastP =>> nrprot 83% Identities = 321/427 (75%), Positives = 368/427 (86%) refINP_821004. 1 adenosylhomocysteinase [Coxiella burnetii RSA 493] gbIAAO91518. 11 adenosylhomocysteinase [Coxiella burnetii RSA 493] Length = 429 1628. 3 Best-BlastP =>> nrprot 56% Identities = 118/268 (44%), Positives = 154/268 (57%), Gaps = 21/268 (7%) refINP271454. 1 bl14814 [Bradyrhizobium japonicum] dbjIBAC50079. BII4814 [Bradyrhizobium japonicum USDA 110] Length = 262 1629. 1 Best-BlastP =>> nrprot 54% Identities = 88/251 (35%), Positives = 138/251 (54%), Gaps = 19/251 (7%) refINP_771455. 1 bII4815 [Bradyrhizobium japonicum] dbjIBAC50080. 1 bII4815 [Bradyrhizobium japonicum USDA 110] Length = 235 163. 1 Best-BlastP =>> nrprot 74% Identities = 237/426 (55%), Positive = 324/426 (76%) refIDP_00072043. COG0334: Glutamate dehydrogenase / leucine dehydrogenase [Trichodesmium erythraeum IMS101] Length = 428 1631. 3 Best-BlastP =>> nrprot 60% Identities = 264/625 (42%), Positives = 366/625 (58%), Gaps = 65/625 (10%) refINP_771456. [Bradyrhizobium japonicum] dbjIBAC50081. [Bradyrhizobium japonicum USDA 110] Length = 649 1632. 3 Best-BlastP =>> nrprot 69% Identities = 276/567 (48%), Positives = 411/567 (72%), Gaps = 4/567 (0%) refINP_819875. 11 ABC transporter, ATP-binding / permease protein [Coxiella burnetii RSA 493] gbiAAO90389. 11 ABC transporter, ATP-binding / permease protein [Coxiella burnetii RSA 493] Length = 589 1633. 2 Best-BlastP =>> nrprot 63% Identities = 142/305 (46%), Positives = 203/305 (66%), Gaps = 11/305 (3%) refINP 438232. Tetraacyldisaccharide 4'-kinase-like protein [Haemophilus influenzae Rd] spiP444911LPXK_HAEIN Tetraacyldisaccharide 4'-kinase (Lipid A 4'-kinase) piriIG64141 probable tetraacyldisaccharide 4'-kinase (EC 2. 7. 1. 130) HI0059 [similarity] - Haemophilus influenzae (strain Rd KW20) gblAAC21737. 11 conserved hypothetical protein [Haemophilus influenzae Rd] Length = 332 1635. 4 Best-BlastP =>> nrprot 16% Identities = 86/371 (23%), Positives = 164/371 (44%), Gaps = 39/371 (10%) piriIT24806 hypothetical protein T1 0G3. 5 - Caenorhabditis elegans Length = 1164 1636. 2 Best-BlastP =>> nrprot 73% Identities = 660/1159 (56%), Positives = 841/1159 (72%), Gaps = 16/1159 (1%) refINP_454838. 11 DNA polymerase III, alpha chain [Salmonella enterica subsp.  enterica serovar Typhi] refINP_804113. 11 DNA polymerase III, alpha chain [Salmonella enterica subsp.  enterica serovar Typhi Ty2] piriIAI0530 DNA polymerase III, alpha-chain [imported] - Salmonella enterica subsp.  enterica serovar Typhi (strain CT18) embiCAD08689. 1 DNA polymerase III, alpha chain [Salmonella enterica subsp.  enterica serovar Typhi] gblAAO67962. 1 DNA polymerase III, alpha chain [Salmonella enterica subsp.  enterica serovar Typhi Ty2] Length = 1160 1638. 2 Best-BlastP =>> nrprot 76% Identities = 256/395 (64%), Positives = 304/395 (76%), Gaps = 3/395 (0%) refINP_642338. 13-ketoacyl-CoA thiolase [Xanthomonas axonopodis pv.  citri str.  306] gbiAAM36874. 3-ketoacyl-CoA thiolase [Xanthomonas axonopodis pv.  citri str.  306] Length = 401 1639. 4 Best-BlastP =>> nrprot No Hits found 1641. 5 Best-BlastP =>> nrprot 63% Identities = 190/434 (43%), Positives = 282/434 (64%), Gaps = 5/434 (1%) refINP_793501. 1 J trigger factor [Pseudomonas syringae pv.  tomato str.  DC3000] gbIAAO57196. 11 trigger factor [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 436 1642. 3 Best-BlastP =>> nrprot 82% Identities = 150/203 (73%), Positives = 178/203 (87%), Gaps = 1/203 (0%) refINP 455045. ATP-dependent proteolytic protease subunit protease [Salmonella enterica subsp.  enterica serovar Typhi] refINP_459444. 11 proteolytic subunit of clpA-clpP ATP-dependent serine protease, heat shock protein F21. [Salmonella typhimurium LT2] refINP_806142. 11 ATP-dependent proteolytic subunit proteolytic subtype [Salmonella enterica subsp.  enterica serovar Typhi Ty2] spIQ9LC07! CLPP_SALTY ATP-dependent Proteolytic proteolytic subunit clpP (Endopeptidase Clp) piriiACO558 ATP-dependent clp protease proteolytic chain [imported] - Salmonella enterica subsp.  enterica serovar Typhi strain CT18 dbjIBAA94668. 11 serine protease subunit [Salmonella typhimurium] gbIAAL19403. 1 proteolytic subunit of clpA-clpP ATP-dependent serine protease [Salmonella typhimurium LT2] embiCAD08907. 1! ATPdependent clp proteolytic protease subunit [Salmonella enterica subsp.  enterica serovar Typhi] gblAAO70002. 11 ATP-dependent proteolytic subunit proteolytic subtype [Salmonella enterica subsp.  enterica serovar Typhi Ty2] Length = 207 1643. 4 Best-BlastP =>> nrprot 97% Identities = 791/816 (96%), Positives = 800/816 (98%) gbIAAM00615. 1 Tutc-Iike protein response [Legionella pneumophila] Length = 816 1644. 6 Best-BlastP =>> nrprot 59% Identities = 171/417 (41%), Positives = 246/417 (58%), Gaps = 9/417 (2%) refINP_772134. 1 bII5494 [Bradyrhizobium japonicum] dbjIBAC50759. BII5494 [Bradyrhizobium japonicum USDA 110] Length = 415 1645. 1 Best-BlastP =>> nrprot 59% Identities = 76/172 (44%), Positives = 110/172 (63%) refINP_717325. 1 conserved hypothetical protein [Shewanella oneidensis MR-1] gbIAAN54769. 11AE015617_4 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = Best-BlastP =>> nrprot 67% Identities = 101/180 (56%), Positives = 127/180 (70%), Gaps = 1/180 (0% ) refINP_715765. 1 I acyltransferase family protein [Shewanella oneidensis MR-1] gbIAAN53210. 11AE015463_7 acyltransferase family protein [Shewanella oneidensis MR-1] Length = 186 Best-BlastP =>> nrprot 53% Identities = 276/732 (37%), Positives = 397/732 (54%), Gaps = 63/732 (8%) %) refINP_832882. 1 I hypothetical protein [Bacillus cereus ATCC 14579] gbJAAP10083. 1 J hypothetical protein [Bacillus cereus ATCC 14579] Length = 854 Best-BlastP =>> nrprot 35% Identities = 119/317 (37%), Positives = 181/317 (57%), Gaps = 6/317 (1% ) refINP_832883. 1 NADH-quinone oxidoreductase chain L [Bacillus cereus ATCC 14579] gbIAAP10084. 1 J NADHquinone oxidoreductase chain [Bacillus cereus ATCC 14579] Length = 510 Best-BlastP =>> nrprot 35% Identities = 37/135 (27%), Positive = 67/135 (49%), Gaps = 11/135 ( 8%) pirIII40884 cytotoxin L - Clostridium sordellii emblCAA57959. 1 I cytotoxin L [Clostridium sordellii] Length = 2364 BestBlastP =>> nrprot 63% Identities = 142/281 (50%), Positives = 195/281 (69%), Gaps = 1/281 (0%) pir1IA42928 plasminogen activator precursor Yersinia pestis Length = 312 Best-BlastP =>> nrprot 81% Identities = 41/60 (68%), Positives = 49/60 (81%), Gaps = 2/60 (3%) refINP_842168. 11 Tetraacyldisaccharide-1-P 4'-kinase [Nitrosomonas europaea ATCC 19718] emblCAD86075. 1 Tetraacyldisaccharide-1-P 4'-kinase [Nitrosomonas europaea ATCC 19718] Length = 396 Best-BlastP =>> nrprot 64% Identities = 124/250 (49%), Positives = 163/250 (65%), Gaps = 7/250 (2%) refINP_872922.  1 3-deoxy-mannooctulosonate cytidlyltransferase [Haemophilus ducreyi 35000HP] gbIAAP95311. 1! 3-deoxy-manno-octulosonate cytidlyltransferase [Haemophilus ducreyi 35000HP] Length = 253 Best-BlastP =>> nrprot 33% Identities = 96/392 (24%), Positives = 148/392 (37%), Gaps = 116/392 (29%) refZep_00067367. COG2730: Endoglucanase [Microbulbifer degradans 2-40] Length = 725 Best-BlastP =>> nrprot 25% Identities = 156/726 (21%), Positives = 334/726 (46%), Gaps = 107/726 ( 14%) pirIIA47297 myosin heavy chain form B, nonmuscle - African clawed frog gbIAAA49915. 1 I nonmuscle myosin heavy chain b Length = 1992 Best-BlastP =>> nrprot 96% Identities = 1010/1064 (94%), Positives = 1030/1064 (96%), Gaps = 4/1064 (0%) gblAAM00617. 1 putative copper efflux ATPase [Legionella pneumophila] Length = 1060 Best-BlastP =>> nrprot No Nits found Best-BlastP =>> nrprot 61% Identities = 110/213 (51%), Positives = 140/213 (65%) , Gaps = 1/213 (0%) spiQ8DDYOIRADC_VIBVU DNA repair protein radC homolog dbjIBAC93049. 1 DNA repair protein [Vibrio vulnificus YJ016] Length = 224 Best-BlastP =>> nrprot 86% Identities = 1036/1406 (73%), Positives = 1216/1406 (86%), Gaps = 14/1406 (0%) refINP_742614. 1 DNA-directed RNA polymerase, beta subunit [Pseudomonas putida KT2440] gblAAN66078. 1 IAE016237_2 DNAdirected RNA polymerase, beta 'subunit [Pseudomonas putida KT2440] Length = 1399 1647. 2 1649. 3 1650. 2 1652. 4 1653. 3 1655. 2 1657. 1 1658. 2 1659. 4 166. 2 1660. 2 1661. 3 1663. 1664. 2 Best-BlastP =>> nrprot 29% Identities = 47/193 (24%), Positives = 80/193 (41%), Gaps = 13/193 (6%) refJZP_00046942. COG3064: Membrane protein involved in colicin uptake [Lactobacillus gasseri] Length = 962 1666. 3 Best-BlastP =>> nrprot No Hits found 1669. 3 Best-BlastP =>> nrprot 68% Identities = 177/313 (56%), Positives = 220/313 (70%) refINP_617527.  11 triacylglycerol lipase [Methanosarcina acetivorans str.  C2A] gblAAM06007. 1 J triacylglycerol lipase [Methanosarcina acetivorans str.  C2A] Length = 321 1670. 3 Best-BlastP =>> nrprot 16% Identities = 43/147 (29%), Positives = 74/147 (50%), Gaps = 6/147 (4%) refIXP_323831. Predicted protein [Neurospora crassa] gblEAA27811. Predicted protein [Neurospora crassa] Length = 554 1671. 3 Best-BlastP =>> nrprot No Hits found 1673. 5 Best-BlastP =>> nrprot 31% Identities = 97/388 (25%), Positives = 174/388 (44%), Gaps = 42/388 (10%) pir1IF86291 hypothetical protein F7H2. 8 [imported] - Arabidopsis thaliana gblAAF82144. 1 JACO34256_8 Contains similarity to F-box protein FBL2 from Homo sapiens gblAF176518 and contains multiple Leucine Rich PFI00560 repeats.  ESTs gbjZ34572, gbIZ34571, gbIA1100681, gbIAI100675, gblAA395320, gbIA1100674, gblAA651378, gbIAA007067, gbIT46145, gbIT22090, gbIA1995016, gbIH36884, gbIAI995066, gbIH37061, gbIT43537 horn from this gene.  [Arabidopsis thaliana] Length = 568 1675. 3 Best-BlastP =>> nrprot 39% Identities = 20/67 (29%), Positives = 42/67 (62%) refINP_439878. Hypothyraformase protein [Haemophilus influenzae Rd] Hypiplementic protein H11736 pirlJD64041 hypothetical protein HI1736 Haemophilus influenzae (strain Rd KW20) gbjAAC23384. 11 H.  H11736 [Haemophilus influenzae Rd] Length = 77 Best-BlastP =>> nrprot 42% Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 25/160 (15% ) refINP_437473. Hypothesized membrane protein [Sinorhizobium meliloti] pirj1E95958 hypothetical membrane protein [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB. 1 I hypothetical membrane protein [Sinorhizobium meliloti] Length = 172 1681. 5 Best-BlastP =>> nrprot 65% Identities = 432/984 (43%), Positives = 629/984 (63%), Gaps = 47/984 (4%) ref] NP_927961. RNA polymerase associated protein (ATP-dependent helicase) [Photorhabdus luminescens subsp.  laumondii TTOI] emblCAE12910. RNA polymerase associated protein (ATP-dependent helicase) [Photorhabdus luminescens subsp.  laumondii TTOI] Length = 970 1682. 4 Best-BlastP =>> nrprot 35% Identities = 63/190 (33%), Positives = 105/190 (55%), Gaps = 8/190 (4%) refIZP_00065413. COG3000: Sterol desaturase [Microbulbifer degradans 2-40] Length = 273 1683. 2 Best-BlastP =>> nrprot No Hits found 1684. 3 Best-BlastP =>> nrprot No Hits found 1685. 3 Best-BlastP =>> nrprot 72% Identities = 199/372 (53%), Positives = 270/372 (72%), Gaps = 3/372 (0%) refIZP_00016064. 1 COG0842: ABC-type multidrug transport system, component permease [Rhodospirillum rubrum] Length = 376 1689. 3 Best-BlastP =>> nrprot 68% Identities = 207/377 (54%), Positives = 275/377 (72%), Gaps = 9/377 (2%) refINP_720122. 1 I cytochrome c oxidase, subunit II [Shewanella oneidensis MR-1] gbjAAN57566. 11AE0158926 cytochrome c oxidase, subunit II [Shewanella oneidensis MR-1] Length = 513 168. 1 Best-BlastP =>> nrprot 86% Identities = 55/68 (80%), Positives = 60/68 (88%) gbJAAM00618. 1 I [Legionella pneumophila] Length = 68 Best-BlastP =>> nrprot 84% Identities = 388/528 (73%), Positives = 458/528 (86%), Gaps = 8/528 (1%) refINP_720123. 11 cytochrome c oxidase, subunit I [Shewanella oneidensis MR-1] gblAAN57567. 11AE015892_7 cytochrome c oxidase, subunit I [Shewanella oneidensis MR-1] Length = 530 1692. 2 Best-BlastP =>> nrprot 86% Identities = 473/671 (70%), Positives = 577/671 (85%), Gaps = 7/671 (1%) refINP_819550. Excinuclease ABC, B subunit [Coxiella burnetii RSA 493] gbJAAO90064. 11 excinuclease ABC, B subunit [Coxiella burnetii RSA 493] Length = 672 Best-BlastP =>> nrprot 56% Identifies = 27/75 (36%), Positives = 45/75 (60%) refINP_754358. 11 Hypothetical protein [Escherichia coli CFT073] gblAAN80925. 1 1EE016762_178 Hypothetical protein [Escherichia coli CFT073] Length = 82 Best-BlastP =>> nrprot 56% Identities = 118/355 (33%), Positives = 189/355 (53%), Gaps = 47/355 (13%) refINP_884030. 1! conserved hypothetical protein [Bordetella parapertussis] embEAE37058. 1! conserved hypothetical protein [Bordetella parapertussis] Length = 1697. 2 Best-BlastP =>> nrprot 56% Identities = 66/174 (37%), Positives = 104/174 (59%), Gaps = 2/174 (1%) reflZP_00013244. COG3038: Cytochrome B561 [Rhodospirillum rubrum] Length = 188 1698. 2 Best-BlastP =>> nrprot 35% Identifies = 84/273 (30%), Positives = 130/273 (47%), Gaps = 17/273 (6%) reflZP_00085491. 1 COG0354: Predicted aminomethyltransferase related to GcvT [Pseudomonas fluorescens PfO-1] Length = 313 1699. 4 Best-BlastP =>> nrprot 58% Identities = 130/277 (46%), Positives = 176/277 (63%), Gaps = 6/277 (2%) refJZP_00090118. ## STR1 ## 5 Best-BlastP =>> nrprot 66% Identities = 192/359 (53%), Positives = 262/359 (72%) refINP_819182. 1 l cell division protein FtsW [Coxiella burnetii RSA 493] gbIAAD39750. 11AF123260_1 FtsW [Coxiella burnetii] gblAAO89696. 11 cell division protein FtsW [Coxiella burnetii RSA 493] Length = 372 1703. 1 Best-BlastP =>> nrprot 36% Identities = 57/215 (26%), Positives = 93/215 (43%), Gaps = 32/215 (14%) refINP_780971. 1 DNA helicase [Clostridium tetani E88] gblAAO34908. 1 j DNA helicase [Clostridium tetani E88] Length = 1352 1704. 4 Best-BlastP =>> nrprot 8% Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 5/108 (4%) refINP_266277. 1 l hypothetical protein [Lactococcus actis subsp.  lactis] pirnA86640 hypothetical protein ybcH [imported] - Lactococcus lactis subsp.  lactis (strain IL1403) gbIAAK04219.  11AE0062506 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp.  lactis] Length = 311 1705. 2 Best-BlastP =>> nrprot No Hits found 1706. 2 Best-BlastP =>> nrprot 56% Identities = 62/148 (41%), Positives = 86/148 (58%), Gaps = 7/148 (4%) ref1ZP_00054547. COG0350: Methylated DNA-Protein Cysteine Methyltransferase [Magnetospirillum magnetotacticum] Length = 183 1707. 2 Best-BlastP =>> nrprot 85% Identities = 96/117 (82%), Positives = 104/117 (88%), Gaps = 2/117 (1%) reflZP_00091602. 1! COG0335: Ribosomal protein L19 [Azotobacter vinelandii] Length = 116 1708. 4 Best-BlastP =>> nrprot 52% Identities = 44/123 (35%), Positives = 65/123 (52%), Gaps = 6/123 (4%) ref1ZP_00134742. 1 COG3109: Activator of osmoprotectant transporter ProP [Actinobacillus pleuropneumoniae serovar 1 str.  4074] Length = 182 169. 1691. 3 1693. 2 1695. 2 Best-BlastP =>> nrprot 65% Identities = 114/228 (50%), Positives = 152/228 (66%), Gaps = 2/228 (0%) refINP_819391. 3demethylubiquinone-9 3-methyltransferase [Coxiella burnetii RSA 493] gbIAAO89905. 1 f 3-demethylubiquinone-9 3-methyltransferase [Coxiella burnetii RSA 493] Length = 234 Best-BlastP =>> nrprot 36% Identities = 49/177 (27%), Positives = 88/177 (49%), Gaps = 15/177 (8%) gbfEAA36774. 1 g GLP_193_16037_16813 [Giardia lamblia ATCC 50803] Length = 258 Best-BlastP =>> nrprot 64% Identifies = 314/686 (45%), Positives = 445/686 (64%), Gaps = 3/686 (0%) refINP_820891. 11 glycyl-tRNA synthetase, beta subunit [Coxiella burnetii RSA 493] splP45651 ISYGB_COXBU Glycyl-tRNA synthetase beta chain (Glycine-tRNA ligase beta chain) (GIyRS) gblAAO91405. 1 glycyl-tRNA synthetase, beta subunit [Coxiella burnetii]

  RSA 493] Length = 689 Best-BlastP =>> nrprot 85% Identities = 224/291 (76%), Positives = 258/291 (88%) refINP_820890.1 glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii RSA 493 ] spjP94616jSYGA_COXBU GlycyltRNA synthetase alpha chain (Glycine - tRNA ligase alpha chain) (GIyRS) emblCAA71456.1 I unnamed protein product [Coxiella burnetii] gblAAO91404. 11 glycyl-tRNA synthetase, alpha subunit [Coxiella burnetii RSA 493] Length = 319 Best-BlastP =>> nrprot 69% Identities = 28/58 (48%), Positives = 44/58 (75%) reffZP_00053249.1 I hypothetical protein [Magnetospirillum magnetotacticum] reflZP_00101210.1 I hypothetical protein [Desulfitobacterium hafniense] Length = 60 Best-BlastP =>> nrprot 24% Identities = 37/126 (29%), Positive = 64/126 (50%), Gaps = 3 / 126 (2%) refINP_371995.1 menaquinone biosynthesis methyltransferase [Staphylococcus aureus subsp. aureus Mu50] refINP_374585.1 1 menaquinone biosynthesis methyltransferase [Staphylococcus aureus subsp. aureus N315] refINP_646177.11 menaquinone biosynthesis methyltransferase [Staphylococcus aureus subsp. aureus MW2] pirlIG89925 menaquinone biosynthesis methyltransferase [imported] - Staphylococcus aureus (strain N315) dbjIBAB42564.1 I menaquinone biosynthesis methyltransferase [Staphylococcus aureus subsp.

  aureus N315] dbjlBAB57633.1 menaquinone biosynthesis methyltransferase [Staphylococcus aureus subsp. aureus Mu50] dbjIBAB95225.1 menaquinone biosynthesis methyltransferase [Staphylococcus aureus subsp. aureus MW2] Length = 241 Best-BlastP =>> nrprot 55% Identities = 123/307 (40%), Positives = 173/307 (56%), Gaps = 9/307 (2%) refINP_781246.1 Glutaminase [ Clostridium tetani E88] gbfAAO35183.1 I glutaminase [Clostridium tetani E88] Length = 306 1723.5 Best-BlastP =>> nrprot 59% Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 9 / 181 (4%) refINP_346734.1 f D-3 phosphoglycerate dehydrogenase [Clostridium acetobutylicum] pin! G96910 D3 phosphoglycerate dehydrogenase [imported] - Clostridium acetobutylicum gbJAAK78074.11AE007521_8 D-3 phosphoglycerate dehydrogenase [Clostridium acetobutylicum] Length = 318 1724.3 Best-BlastP =>> nrprot 35% Identities = 62/241 (25%), Positives = 104/241 (43%), Gaps = 20/241 (8%) refINP_102317.1 I probable hydrolase [Mesorhizobium loti] dbjIBAB48103.1 I probable hydrolase [Mesorhizobium loti] Length = 248 1725.3 Best-BlastP =>> nrprot 74% Identities = 172/279 (61%), Positives = 212/279 (75%) refINP_747209.1 I RNA polymerase sigma-32 factor [Pseudomonas sbcp] gblAAF80334.1 IAF157048_1 heat shock sigma factor RpoH [Pseudomonas putida] gblAAN70673.11AE016711_1 RNA polymerase sigma-32 factor [Pseudomonas putida KT2440] Length = 284 1709.1 1711.2 1713.2 1714.4 172.1 1720.3 1722.2 1726.4 Best-BlastP =>> nrprot 14 % Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 18/174 (10%) refINP 473239.1 l hypothetical protein [Plasmodium falciparum 3D7] pir1IT18459 hypothetical protein CO515c - malaria parasite (Plasmodium falciparum ) embICAA15601.1 l hypothetical protein [Plasmodium falciparum 3D7] Length = 1236 1730.3 Best-BlastP =>> nrprot 72% Identities = 498/899 (55%), Positives = 632/899 (70%), Gaps = 39/899 (4%) refINP 668025.1 l protein chain initiation factor IF-2 [Yersinia pestis KIM] spIQ8ZBC2JIF2_YERPE Translation initiation factor IF-2 gblAAM84276.1 1AE013671_3 protein chain initiation factor IF-2 [KIM Yersinia pestis] Length = 892 1733.3 Best-BlastP = >> nrprot 70% Identities = 225/399 (56%), Positives = 293/399 (73%), G aps = 1/399 (0%) REFINP_653663.1 J SDF, Sodium: dicarboxylate symporter family [Bacillus anthracis A2012] refINP_847618.1 J proton / glutamate symporter family protein, putative [Bacillus anthracis str. Ames] gblAAP29104.11 proton / glutamate symporter family protein, putative [Bacillus anthracis str. Ames] Length = 405 1734.2 Best-BlastP =>> nrprot No Hits found 1735.1 Best-BlastP =>> nrprot No Hits found 1737.2 Best-BlastP =>> nrprot 34% Identities = 88/258 (34%), Positives = 129 / 258 (50%), Gaps = 30/258 (11%) refINP_052868.1 l hypothetical protein [Coxiella burnetii] gbJAAD33500.1 JAF131076_26 hypothetical protein [Coxiella burnetii] Length = 361 1738.3 Best-BlastP =>> nrprot 84% Identities = 284/394 (72%), Positives = 339/394 (86%) refGZP_00065178.1 l COG0133: Tryptophan synthase beta chain [Microbulbifer degradans 2-40] Length = 403 1739.2 Best-BlastP =>> nrprot 65% Identities = 95/197 (48%), Positives = 136/197 (69%) refINP_902433.1 I phosphoribosylanthranilate isomerase [Chromobacterium violaceum ATCC 12472] gbIAAQ60431.1 I phosphoribosylanthranilate isomerase [Chromobacterium violaceum ATCC 12472] Length = 206 174.1 Best-BlastP => > nrprot 71% Identities = 165/284 (58%), Positives = 206/284 (72%) reflNP_820298.1 I methionine sulfoxide reductase peptide [Coxiella burnetii RSA 493] g bIAAO90812.11 methionine sulfoxide reductase peptide [Coxiella burnetii RSA 493] Length = 284 Best-BlastP =>> nrprot 73% Identities = 148/259 (57%), Positives = 193/259 (74%), Gaps = 1/259 (0%) RefGZP_00087161.1 I COGO101: Pseudouridylate synthase [Pseudomonas fluorescens PfO-1] Length = 313 Best-BlastP =>> nrprot 79% Identities = 163/239 (68%), Positives = 198/239 (82%) , Gaps = 1/239 (0%) refiZP_00091549.1 I COG0528: Uridylate kinase [Azotobacter vinelandii] Length = 249 Best-BlastP =>> nrprot 84% Identities = 118/184 (64%), Positives = 158/184 ( 85%) refINP_928020.1 I ribosome releasing factor [Photorhabdus luminescens subsp. laumondii TTOI] embICAE12970.1I ribosome releasing factor [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 185 1746.2 Best-BlastP =>> nrprot 47% Identities = 71/209 (33%), Positives = 100/209 (47%), Gaps = 8/209 (3%) refINP_233145.1 I arginine ABC transporter, periplasmic arginine-binding protein [Vibrio cholerae 01 biovar eltor str. N16961] pirIlH82420 arginine ABC transporter, periplasmic arginine-binding protein VCA0759 [imported] Vibrio cholerae (strain N16961 serogroup 01) gblAAF96657.1 arginine ABC transporter, periplasmic arginine-binding protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 243 1747.2 Best-BlastP =>> nrprot No Hits found 1740.3 1742.3 1743.4 1748. 3 Best-BlastP =>> nrprot 57% Identities = 160/430 (37%), Positives = 244/430 (56%) , Gaps = 14/430 (3%) refINP_662910.1 threonine synthase [Chlorobium tepidum TLS] gbIAAM73252.11 threonine synthase [Chlorobium tepidum TLS] Length = 441 1749.2 Best-BlastP =>> nrprot 29% Identities = 48/192 (25 %), Positives = 77/192 (40%), Gaps = 21/192 (10%) refINP_698612. Outer membrane protein, 31 kDa [Brucella suis 1330] gbIAAN30527. 11AE014455_11 outer membrane protein, 31 kDa [Brucella suis 1330] Length = 261 1750.3 Best-BlastP =>> nrprot 69% Identities = 162/295 (54%), Positives = 201/295 (68%), Gaps = 6/295 (2%) refINP_742276: 1 J cytochrome c oxidase, subunit III [Pseudomonas putida KT2440] gbIAAN65740.1 jAE016200 4 cytochrome c oxidase, subunit III [Pseudomonas putida KT2440] Length = 295 1752.2 Best-BlastP =>> nrprot 66% Identities = 83/173 (47%), Positives = 120/173 (69%), Gaps = 2/173 (1%) refINP_720124.11 cytochrome c oxidase assembly protein coxG [Shewanella oneidensis MR-1] gbIAAN57568. 11AE015892_8 cytochrome c oxidase assembly protein coxG [Shewanella oneidensis MR-1] Length = 193 1754.3 Best-BlastP =>> nrprot 49% Identities = 174/422 (41%), Positive = 252/422 (59%), Gaps = 9 / 422 (2%) refINP_820704.1 I thiol: disulfide interchange protein DsbD [Coxiella burnetii RSA 493] gbIAAO91218.1 I thiol: disulfide interchange protein DsbD [Coxiella burnetii RSA 493] Length = 584 1755.3 Best-BlastP =>> nrprot No Hits found 1756.4 Best-BlastP =>> nrprot 63% Identities = 133/271 (49%), Positives = 181/271 (66%) refINP_902359.1! probable oxidoreductase, short-chain dehydrogenase / reductase family [Chromobacterium violaceum ATCC 12472] gbIAAQ60359.11 probable oxidoreductase, short-chain dehydrogenase / reductase'family [Chromobacterium violaceum ATCC 12472] Length = 278 1759.4 Best-BlastP =>> nrprot 43% Identities = 55/224 (24%), Positives = 102/224 (45%), Gaps = 3/224 (1%) refINP_746234.1 I conserved hypothetical protein [Pseudomonas putida KT2440] gb1AAN69698.1 IAE016606_1 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 267 176.1 Best-BlastP =>> nrprot No Hits found 1760.4 Best-BlastP =>> nrprot 75% Identities = 116/223 (52%), Positives = 170/223 (76%) refIXP_306643.1 ENSANGP00000000843 [ Anopheles gambiae] gbIEAA02110.11 ENSANGP00000000843 [Anopheles gambiae str. PEST] Length = 228 1761.4 Best-BlastP =>> nrprot 9% Identities = 54/209 (25%), Positives = 100/209 (47%), Gaps = 38/209 (18%) refZG_00010059.1 J COG1680: Betalactamase class C and other penicillin binding proteins [Rhodopseudomonas palustris] Length = 395 1762.2 Best-BlastP =>> nrprot 39% Identities = 66/245 (26%), Positives = 125/245 (51%), Gaps = 9/245 (3%) refINP_834835.1 Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] gbIAAP12036.1 l Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] Length = 254 1764.3 1765.4 1767.2 diester esterase Length = 247 Best-BlastP =>> nrprot 99% Identities = 377/377 (100%), Positives = 377/377 (100%)

* n-acylglucosamine 2-epimerase [Legionella pneumophila] [N-acylglucosamine 2-epimerase] Length = 377 Best-BlastP =>> Nrprot 99% Identities = 201/201 (100%), Positives = 201/201 (100%) EmbICAB65210. 1 putative acetyl transferase [Legionella pneumophila] Length = 419 Best-BlastP =>> nrprot 56% Identities = 103/234 (44%), Positives = 135/234 (57%), Gaps = 1/234 (0%) prf111712315B glycerophosphoryl 1768.3 Best-BlastP =>> nrprot 52% Identifies = 150/405 (37%), Positives = 216/405 (53%), Gaps = 12/405 (2%) refINP_519385.1 PROBABLE GLYCEROL-3- PHOSPHATE -BINDING PERIPLASMIC LIPOPROTEIN SIGNAL PEPTIDE [Ralstonia solanacearum] emblCAD14966.11 PROBABLE GLYCEROL-3-PHOSPHATE-BINDING PERIPLASMIC LIPOPROTEIN SIGNAL PEPTIDE [Ralstonia solanacearum] Length = 438 1770.2 Best-BlastP =>> nrprot 99% Identities = 1034/1035 (99% ), Positives = 1034/1035 (99%) gbJAAF32510.1 jAF095231_1 defect in organelle trafficking protein [Legionella pneumophila] Length = 1035 1772.1 Best-BlastP =>> nrprot 94% Identities = 135/151 (89%), Positive = 144 / 151 (95%) gblAAC35591.1 1 IcmV [Legionella pneumophila] Length = 151 1773.1 Best-BlastP =>> nrprot 99% Identities = 150/151 (99%), Positives = 151/151 (100%) pirl1S61384 [Legionella pneumophila] Length = 151 1774.2 Best-BlastP =>> nrprot 90% Identities = 411/472 (87%) 472 (1%) gblAAC35590.1 I IcmX [Legionella pneumophila] Length = 466 1775.3 Best-BlastP =>> nrprot No Hits found 1778.5 Best-BlastP =>> nrprot 52% Identities = 63/115 (54%), Positives = 82/115 (71%), Gaps = 4/115 (3%) refINP_215343.1 hypothetical protein Rv0828c [Mycobacterium tuberculosis H37Rv] refINP_854509.1 POSSIBLE DEAMINASE [Mycobacterium bovis subsp. bovis AF2122 / 97] pirIID70811 hypothetical protein Rv0828c - Mycobacterium tuberculosis (strain H37RV) embjCAA17634.1 j hypothetical protein Rv0828c [Mycobacterium tuberculosis H37Rv] embICAD93713.1 POSSIBLE DEAMINASE [Mycobacterium bovis subsp. bovis AF2122 / 97] Length = 140 1779.3 Best-BlastP =>> nrprot No Hits found 178.1 Best-BlastP =>> nrprot No Hits found 1780.3 Best-BlastP =>> nrprot 80% Identities = 51/69 (73%), Positives = 56/69 (81%) refJZP_00067276.1 I COG1278: Cold shock proteins [Microbulbifer degradans 2-40] Length = 71 1781.4 Best-BlastP =>> nrprot 72% Identities = 245/436 (56%), Positives = 318/436 (72%), Gaps = 1/436 (0%) reflZPO0031144.11 COGO513: Superfamily II DNA and RNA helicases [Burkholderia fungorum] Length = 534 1782.3 Best-BlastP =>> nrprot 51% Identities = 134/404 (33%), Positives = 216/404 (53%), Gaps = 3/404 (0%) refINP_819935.1 Major facilitator family transporter [Coxiella burnetii RSA 493] gbIAA090449.1 Major facilitator family transporter [Coxiella burnetii RSA 493] Length = 437 1784.2 Best-BlastP =>> nrprot No Hits found 1786.2 Best-BlastP =>> nrprot 99% Identities = 123/123 (100%), Positives = 123/123 (100%) gbIAAN08839.1 J Transmission trait enhancer protein LetE [Legionella pneumophila] Length = 123 1787.4 Best-BlastP =>> nrprot 26% Identities = 131/667 (19%), Positives = 275/667 (41%), Gaps = 111/667 (16%) refINP_082559.1 I nuclear membrane binding protein NUCLING [Mus musculus] gbIAAH42415.1 1 Nuclear membrane binding protein NUCLING [Mus musculus] Length = 1413 1788.3 Best-BlastP =>> nrprot 62% Identities = 208/445 (46%), Positives = 285/445 (64%), Gaps = 6/445 (1%) ReflZP_00118630.11 Hypothetical protein [Cytophaga hutchinsonii] Length = 452 179.1 Best-BlastP =>> Nrprot 97% Identities = 85/89 (95%), Positives = 88/89 (98%) putative TatB protein [Legionella pneumophila] Length = 89 1792.2 Best-BlastP =>> nrprot 46% Identities = 70/254 (27%), Positives = 121/254 (47%), Gaps = 13/254 ( 5%) refINP_421699.1! hypothetical protein [Caulobacter crescentus CB15] pirfIG87608 hypothetical protein CC2905 [imported] - Caulobacter crescentus gbJAAK24867.1 J hypothetical protein [Caulobacter crescentus CB15] Length = 261 1793.3 Best-BlastP =>> nrprot 65% Identities = 133/262 (50%) , Positives = 182/262 (69%), Gaps = 1/262 (0%) refINP_819072.1 xanthosine phosphorylase [Coxiella burnetii RSA 493] gblAAO89586.1 Xanthosine phosphorylase [Coxiella burnetii RSA 493] Length = 273 Best-BlastP =>> nrprot 51% Identities = 88/257 (34%), Positives = 132/257 (51%), Gaps = 21/257 (8%) refINP_671037.1 l 2- deoxyribose-5-phosphate aldolase [Yersinia pestis KIM] gbjAAM87288. 11AE013977_7 2-deoxyribose-5-phosphate aldolase [Yersinia pestis KIM] Length = 270 Best-BlastP =>> nrprot 19% Identities = 101/385 (26%), Positives = 172/385 (44%), Gaps = 54 / 385 (14%) refINP_220907.1 I unknown [Rickettsia prowazekii] pirlIE71657 hypothetical protein RP534 - Rickettsia prowazekii embyCAA14983.11 unknown [Rickettsia prowazekii] Length = 598 1797.4 Best-BlastP =>> nrprot 66% dentities = 123/252 (48% ), Positives = 174/252 (69%), Gaps = 8/252 (3%) dbjIBAA20497.1 127kDa outer membrane protein [Coxiella burnetii] Length = 252 18.1 Best-BlastP =>> nrprot No Hits found 180.1 Best-BlastP =>> nrprot 98% Identities = 60/61 (98%), Positive = 61/61 (100%) I putative tatA protein [Legionella pneumophila] Length = 61 1800.4 Best-BlastP =>> nrprot 74% Identities = 417/723 (57%), Positives = 543/723 (75%), Gaps = 7/723 (0%) refINP_407289.1 I DNA helicase II [Yersinia pestis] pirIJAI0467 DNA helicase II (EC 3.6.1.- ) [imported] - Yersinia pestis (strain 0092) embajCAC93309.11 D NA helicase II [Yersinia pestis CO92] Length = 720 1803.2 Best-BlastP =>> nrprot 45% Identities = 30/59 (50%), Positives = 40/59 (67%) refZN_00021376.11 COG0477: Permeases of the major facilitator superfamily [Ralstonia metallidurans] Length = 120 1804.2 Best-BlastP =>> nrprot 88% dentities = 320/414 (77%), Positives = 367/414 (88%) gbIAAA92282.1 Hel Length = 414 1805.3 Best-BlastP => > nrprot 27% Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 5/113 (4%) refINP_811310.11 conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] gblAAO77504.11 conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] Length = 207 1806.2 Best-BlastP =>> nrprot 80% dentities = 90/151 (59%), Positives = 121/151 (80%), Gaps = 3/151 (1% RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii RSA 493] gbIAAO91014.1 j RNA methyltransferase, TrmH family, group 2 [Coxiella burnetii RSA 493] Length = 152 1807.3 Best-BlastP =>> nrprot 65% Identities = 221 / 460 (48%), Positive = 309/460 (67%), Gaps = 2/460 (0%) refINP_841539.1 I putative homospermidine synthase protein [Nitrosomonas europaea ATCC 19718] putative emblCAD85409.1 homospermidine synthase protein [Nitrosomonas europaea ATCC 19718] Length = 472 1794.3 1795.3 1809.4 Best-BlastP =>> nrprot 42% Identities = 190/572 (33%), Positives = 326/572 (56%), Gaps = 4/572 (0%) refJNP_902623.1 J conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ60621.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 1390 1812.4 Best-BlastP =>> nrprot 42% Identities = 88/335 (26%), Positive = 168/335 ( 50%), Gaps = 2/335 (0%) refiZP_00092491.11 COG0477: Permeases of the major facilitator superfamily [Azotobacter vinelandii] Length = 432 1815.2 Best-BlastP =>> nrprot 45% Identities = 49/148 (33%) , Positives = 80/148 (54%) reflZ_00087676.1 l COG0454: Histone acetyltransferase HPA2 and related acetyltransferases [Pseudomonas fluorescens PfO-1] Length = 167 1817.2 Best-BlastP =>> nrprot No Hits found 1818.4 Best-BlastP =>> nrprot 55% Identities = 280/280 (100%), Positive = 280/280 (100%) embjCAB65209.1 j hypothetical protein [Legionella pneumophila] Length = 280 1819.6 Best-BlastP =>> nrprot 58% Identities = 819/859 (95%), Positives = 836/859 (97%), Gaps = 1/859 (0%) gbIAAD47371.1 LigA [Legionella pneumophila] Length = 869 182.3 Best-BlastP =>> nrprot 66% Identities = 272/471 (57%), Positives = 367/471 (77%), Gaps = 2/471 (0%) refINP_820993.1 J ubiquinone biosynthesis protein AarF , putative [Coxiella burnetii RSA 493] gblAAO91507.11 ubiquinone biosynthesis protein AarF, putative [Coxiella burnetii RSA 493] Length = 541 1823.5 Best-BlastP =>> nrprot 66% Identities = 206/419 (49%), Positives = 287 / 419 (68%) refINP_252387.11 hypothetical protein [Pseudomonas aeruginosa PA01] pirflA83183 hypothetical protein PA3697 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG07085.11AE004789 5 hypothetical protein PA3697 [Pseudomonas aeruginosa PAO1] Length = 431 1826.2 Best-BlastP =>> nrprot No Hits found 1827.3 Best-BlastP =>> nrprot No Hits found 1831.3 Best-BlastP =>> nrprot 73% Identities = 235/399 (58%), Positives = 297/399 (74%) refINP_819677.1 I riboflavin biosynthesis protein RibA [Coxiella burnetii RSA 493] gbjAAO90191.1 1 riboflavin biosynthesis protein RibA [Coxiella burnetii RSA 493] Length = 406 1832.4 Best-BlastP =>> nrprot 58% Identities = 82/191 (42%), Positives = 120/191 (62%) ref1NP_819676.1! riboflavin synthase, alpha subunit [Coxiella burnetii RSA 493] gbJAAO90190.1 1 riboflavin synthase, alpha subunit [Coxiella burnetii RSA 493] Length = 202 1834.4 Best-BlastP =>> nrprot 49% Identities = 144/439 (32%), Positive = 228/439 (51%), Gaps = 14/439 (3%) refINP_484368.1 I hypothetical protein [Nostoc sp. PCC 7120] pir! IAC1847 hypothetical protein a110324 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB72282.1 ORF_ID: a110324 hypothetical protein [Nostoc sp. PCC 7120] Length = 447 1838.2 Best-BlastP =>> nrprot 52% Identities = 170/486 (34%), Positives = 256/486 (52%), Gaps = 27/486 (5%) ref] ZP_00110911.1 COG1816: Adenosine deaminase [Nostoc punctiform] Length = 523 1839.2 Best-BlastP =>> nrprot 57% Identities = 157/414 (37%), Positives = 230/414 (55%), Gaps = 33/414 (7%) sterol desaturaserelated protein [Leptospira interrogans serovar lai str. 56601] gblAAN48605.1jAE011320_5 sterol desaturase-related protein [Leptospira interrogans serovar lai str. 56601] Length = 442 184.2 Best-BlastP =>> nrprot No Hits found 1840.3 Best-BlastP =>> nrprot 53% Identities = 138/380 (36%), Positives = 220/380 (57%), Gaps = 7 / 380 (1%) refINP_820736.1! drug resistance transporter, Bcr / CflA family [Coxiella burnetii RSA 493] gblAAO91250.11 drug resistance transporter, Bcr / CflA family [Coxiella burnetii RSA 493] Length = 393 1841.2 Best-BlastP =>> nrprot 58% Identities = 215/536 ( 40%), Positive = 327/536 (61%), Gaps = 9/536 (1%) refINP 715995.1 AMP-binding protein [Shewanella oneidensis MR-1] gbIAAN53440.11AE015483_6 AMP-binding protein [Shewanella oneidensis MR-1 ] Length = 554 1844.3 Best-BlastP =>> nrprot 54% Identities = 120/330 (36%), Positives = 193/330 (58%), Gaps = 3/330 (0%) refINP_925659.1 UDP-3- O- [3-hydroxymyristoyl] glucosamine N-acyltransferase [Gloeobacter violaceus] dbjIBAC90654.1 1 UDP-3-O- [3-hydroxymyristoyl] glucosamine Nacyltransferase [Gloeobacter violaceus] Length = 345 1845.3 Best-BlastP =>> nrprot No Hits found 1846.3 Best-BlastP =>> nrprot 62% Identities = 181/411 (44%), Positives = 255/411 (62%), Gaps = 4/411 (0%) gb! AAN87389.11 3-oxoacyl- [acylcarrier - protein] synthase [Heliobacillus mobilis] Length = 415 184 7.3 Best-BlastP =>> nrprot 19% Identities = 77/190 (40%), Positives = 110/190 (57%), Gaps = 5/190 (2%) refINP_253486.1 I hypothetical protein [Pseudomonas aeruginosa PA01] Hypothetical protein PA4798 pir1IC83045 hypothetical protein PA4798 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG08184.11AE004893_2 hypothetical protein PA4798 [Pseudomonas aeruginosa PAO1] Length = 242 1848.4 Best-BlastP =>> nrprot 31% Identities = 77/258 (29% ), Positives = 129/258 (50%), Gaps = 21/258 (8%) refINP_832609.1! Methyltransferase [Bacillus cereus ATCC 14579] gbJAAP09810.1 I Methyltransferase [Bacillus cereus ATCC 14579] Length = 253 1849.3 Best-BlastP =>> nrprot 40% Identities = 45/134 (33%), Positive = 73/134 (54%) , Gaps = 4/134 (2%) refINP_636084.1 I acetyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] gblAAM40008.1 I acetyltransferase [Xanthomonas campestris pv.

  campestris str. ATCC 33913] Length = 157 185.1 Best-BlastP =>> nrprot 69% Identities = 141/253 (55%), Positives = 182/253 (71%), Gaps = 1/253 (0%) refIN 484519.1 f likely short chain dehydrogenase [Nostoc sp. PCC 7120] pirlIAB1866 hypothetical protein aII0475 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB72433.1 I ORF_ID: aI10475 probable short chain dehydrogenase [Nostoc sp. PCC 7120] Length = 257 1852.2 Best-BlastP =>> nrprot 54% Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 6/110 (5%) refINP 900345.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ58351.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 128 1853.2 Best-BlastP =>> nrprot 58% Identities = 65/127 (51%), Positives = 79/127 (62%) , Gaps = 9/127 (7%) refINP 459344.1 putative outer membrane lipoprotein [Salmonella typhimurium LT2] gblAAL19303.11 putative outer lipoprotein membrane [Salmonella typhimurium LT2] Length = 119 1856.3 Best-BlastP =>> nrprot No Hits found 1858.1 Best- BlastP =>> nrprot No Hits found 1859.2 Best-BlastP =>> nrprot 51% Identities = 85/271 (31%), Positives = 139/271 (51%), Gaps = 21/271 (7%) refINP_219985.1 J hypothetical protein [Chlamydia trachomatis] pirl E71509 hypothetical protein CT472 - Chlamydia trachomatis (serotype D, strain UW3 / Cx) gbIAAC68072.1 I hypothetical protein [Chlamydia trachomatis] Len gth = 264 1860.2 Best-BlastP =>> nrprot 47% Identities = 104/344 (30%), Positive = 174/344 (50%), Gaps = 38/344 (11%) gblAAF86695.11AF180956_1 cAMP cephalosporinase precursor protein ACC -3a [Hafnia alvei] Length = 377 1861.2 Best-BlastP =>> nrprot No Hits found 1862.2 Best-BlastP =>> nrprot 63% Identities = 206/470 (43%), Positives = 279/470 (59%), Gaps = 41/470 (8%) refINP_249771.1! flagellar hook protein FIgE [Pseudomonas aeruginosa PA0I] pir! 1F83510 flagellar hook protein FIgE PA1080 [imported] Pseudomonas aeruginosa (strain PAOI) gbIAAG04469.11AE004539_11 flagellar hook protein FIgE [Pseudomonas aeruginosa PAOI] Length = 462 Best-BlastP =>> nrprot 64% Identities = 97/223 (43%), Positives = 145/223 (65%), Gaps = 2/223 (0%) refJZP_00138665.1 J COG1843: Flagellar hook capping protein [Pseudomonas aeruginosa UCBPP-PA14] Length = 237 Best -BlastP =>> nrprot 73% Identities = 273/454 (60%), Positives = 346/454 (76%), Gaps = 5/454 (1%) refINP_638130.1! succinyldiaminopimelate desuccinylase [Xanthomonas campestris pv. campestris str. ATCC 33913] gblAAM42054.11 succinyldiaminopimelate desuccinylase [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 497 1865.3 Best-BlastP =>> nrprot 72% Identities = 175/353 (49%), Positives = 263/353 (74%), Gaps = 1/353 (0%) refINP_562979.1! UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl N-acetylglucosamine transferase [Clostridium perfringens] sp. (Q8XIQ1 IMURG_CLOPE UDP-N-acetylglucosamine - N-acetylmuramyl (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (Undecaprenyl- PP-MurNAc-pentapeptide-UDPGIcNAc GIcNAc transferase) UDP-N-acetylglucosamine-Nacetylmuramyl- (pentapeptide) pyrophosphoryl N-acetylglucosamine transferase [Clostridium perfringens str. 13] Length = 357 187.1 Best-BlastP =>> nrprot No Hits found 1870.3 Best-BlastP =>> nrprot 60% Identities = 152/349 (43%), Positives = 223/349 (63%), Gaps = 19/349 (5%) refINP_767636.1 I HIyD family secretion protein [Bradyrhizobium japonicum] dbjlBAC46261.1 j HIyD family secretion protein [Bradyrhizobium japonicum USDA 110] Length = 410 1871.2 Best-BlastP =>> nrprot 99% Identities = 348/348 (100%), Positive = 348/348 (100%) ) emblCAC33484.1 I RecA protein [Legionella pneumophila] Length = 348 1873.2 Best-BlastP =>> nrprot 99% Identities = 150/150 (100%), Positives = 150/150 (100%) spIP37864IRECX_LEGPN Regulatory protein recX. 1! RecX protein [Legionella pneumophila] Length = 150 1875.2 Best-BlastP =>> nrprot 75% Identities = 234/379 (61%), Positive = 294/379 (77%) ReflNP_842481.1 I General substrate transporters [Nitrosomonas europaea ATCC 19718 ] Embaladio@gmail.com Length = 391 1878.3 Best-BlastP =>> nrprot 63% Identities = 130/311 (41%), Positives = 199/311 (63%), Gaps = 7 / 311 (2%) refINP_520407.1 HYPOTHETICAL PROTEIN [Ralstonia solanacearum] embtCAD15993.1 HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 317 188.1 Best-BlastP =>> nrprot No Hits found 1880.3 Best-BlastP =>> nrprot 79% Identities = 208/324 (64%), Positive = 262/324 (80%) reflNP_820236.1 I malate dehydrogenase [Coxiella burnetii RSA 493] gbIAAO90750.1 1 malate dehydrogenase [Coxiella burnetii RSA 493] Length = 328 1863.2 1864.3 1882.2 Best-BlastP =>> nrprot 52% Identities = 116/255 (45%), Positives = 165/255 (64%), Gaps = 12/255 (4%) refINP819457.1 J polysaccharide deacetylas e-related protein [Coxiella burnetii RSA 493] gblMO89971.1 J polysaccharide deacetylase-related protein [Coxiella burnetii RSA 493] Length = 276 1883.4 Best-BlastP =>> nrprot No Hits found 1885.3 Best-BlastP =>> nrprot 67% Identities = 221/446 (49%), Positives = 307/446 (68%), Gaps = 5/446 (1%) refINP_252709.1 I UDP-N-acetylmuramate: Lalanyl-gamma-D-glutamyl mesodiaminopimelate ligase [Pseudomonas aeruginosa PA0I] pirlIA83145 UDP-Nacetyimuramate-L-alanyl-gamma-D-glutamyl-meso-diaminopimelope ligase (EC 6.3.2.-) PA4020 [imported] - Pseudomonas aeruginosa (strain PAOI) gblAAG07407.11AE004818_13 UDP-N -acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [Pseudomonas aeruginosa PAO1] Length = 451 1886.2 Best-BlastP =>> nrprot No Hits found 1887.2 Best-BlastP =>> nrprot 37% Identities = 126 / 504 (25%), Positive = 205/504 (40%), Gaps = 128/504 (25%) refINP_905954.1 leucine-rich protein [Porphyromonas gingivalis W83] gblAAQ66853.11 leucine-rich protein [Porphyromonas gingivalis W83] Length = 1266 1889.2 Best-BlastP =>> nrprot 30% Identities = 64/297 (21%), Positives = 122/297 (41%), Gaps = 33/297 (11%) refINP_764683.1 I ebhA protein [Staphylococcus epidermidis ATCC 12228] gb! AAO04725.11AE016747_222 ebhA protein [Staphylococcus epidermidis ATCC 12228] Length = 9439 189.3 Best-BlastP =>> nrprot 81% Identities = 272/394 (69%), Positive = 330/394 (83% dbjIBAB55449.1 NAD ± dependent formate dehydrogenase [Hyphomicrobium sp. JC17] Length = 399 1891.2 Best-BlastP =>> nrprot 47% Identities = 72/239 (30%), Positive = 123/239 (51%) refINP_812276.11 hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] gbIAAO78470. Hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] Length = 247 1893.2 Best-BlastP =>> nrprot 64% Identities = 98/218 (44%), Positives = 142/218 (65%), Gaps = 2/218 ( 0%) refINP_82081.9.1 I ribosomal 5S rRNA EIoop binding protein Ctc / L25 / TL5 [Coxiella burnetii RSA 493] gbjAAO91333. 1 ribosomal 5S rRNA E-Ioop binding protein Ctc / L25 / TL5 [Coxiella burnetii RSA 493] Length = 244 1894.2 Best-BlastP =>> nrprot 73% Identities = 63/101 (62%), Positive = 76/101 ( 75%) COG0261: Ribosomal protein L21 [Pseudomonas fluorescens PfO-1] Length = 103 1895.6 Best-BlastP =>> nrprot 47% Identities = 59/173 (34%), Positives = 100/173 (57%) , Gaps = 14/173 (8%) refINP_842310.1 I putative type 4 fimbrial biogenesis protein PiIP [Nitrosomonas europaea ATCC 19718] putative embicad86225.1 type 4 fimbrial biogenesis protein PiIP [Nitrosomonas europaea ATCC 19718] Length = 176 1896.5 Best-BlastP =>> nrprot 61% Identities = 282/695 (40%), Positives = 430/695 (61%), Gaps = 40/695 (5%) refINP_715925.1 I type IV pilus biogenesis protein PiIQ [Shewanella oneidensis MR- 1] gbIAAN53370.1 IAE015476_11 type IV pilus biogenesis protein PiIQ [Shewanella oneidensis MR-1] Length = 684 19.1 Best-BlastP =>> nrprot 37% Identities = 48/174 (27%), Positive = 80/174 (45% ), Gaps = 14/174 (8%) refINP_820400.1 peptidase, family S24 [Coxiella burnetii RSA 493] gbIAAO90914.11 peptidase, family S24 [Coxiella burnetii RSA 493] Length = 216 190.3 Best-BlastP =>> nrprot No Hits found 1902.5 Best-BlastP =>> nrprot 79% Identities = 205/338 (60%), Positives = 264/338 (78%), Gaps = 5/338 (1%) ref1ZP_00086819.1 COG0533: Metaldependent proteases with possible chaperone activity [Pseudomonas fluorescens PfO-1] Length = 341 1903.4 Best-BlastP =>> nrprot 58% Identities = 119/287 (41%), Positives = 161/287 (56%), Gaps = 14/287 (4%) refINP_821016.1 Chitinase domain protein [Coxiella burnetii RSA 493] gblAAO91530.11 chitinase domain protein [Coxiella burnetii RSA 493] Length = 593 1905.2 Best-BlastP =>> nrprot 77% Identities = 248/422 (58%), Positives = 328/422 (77%), Gaps = 1/422 (0%) refINP_718455.1 l conserved hypothetical protein [Shewanella oneidensis MR-1] sp1P59352IYS83_SHEON Hypothetical UPF0229 protein SO2883 gblAAN55899.11AE015726_7 conserved hypothetical protein [Shewanella oneidens is MR-1] Length = 422 1906.2 Best-BlastP =>> nrprot 83% Identities = 347/504 (68%), Positives = 425/504 (84%), Gaps = 1/504 (0%) refINP_790392.1 SpoVR like family protein [Pseudomonas syringae pv. tomato str. DC3000] gbiAAO54087.1 I SpoVR like family protein [Pseudomonas syringae pv.

  tomato str. DC3000] Length = 520 1908.4 Best-BlastP =>> nrprot 60% Identities = 348/811 (42%), Positives = 495/811 (61%), Gaps = 14/811 (1%) EmbjCAD58321.11 Long chain acyl -CoA dehydrogenase [Azoarcus sp. EbN1] Length = 829 191.1 Best-BlastP =>> nrprot 50% Identities = 76/297 (25%), Positives = 144/297 (48%), Gaps = 33/297 (11%) refINP_832129.1 I Transcriptional regulators , LysR family [Bacillus cereus ATCC 14579] gbIAAP09330.11 Transcriptional regulators, LysR family [Bacillus cereus ATCC 14579] Length = 300 1910.6 Best-BlastP =>> nrprot 12% Identities = 92/441 (20%), Positives = 185 / 441 (41%), Gaps = 64/441 (14%) gblAAB70839.11 ZipA [Dictyostelium discoideum] Length = 924 1911.4 Best-BlastP =>> nrprot 41% Identities = 37/110 (33%), Positives = 64 / 110 (58%), Gaps = 6/110 (5%) refIZP_00054083.11 COG0664: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Magnetospirillum magnetotacticum] Length = 282 1913.2 Best-BlastP => > nrprot 61% Identities = 41/91 (45%), Positives = 61/91 (67%) refINP_819252.1 J hypothetical protein [Coxiella burnetii RSA 493] gbfAAO89766.1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 130 1915.3 B is-BlastP =>> nrprot 56% Identities = 237/625 (37%), Positives = 364/625 (58%), Gaps = 18/625 (2%) refINP_518200.1 PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] emblCAD13607. 11 PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 795 1918.3 Best-BlastP =>> nrprot 74% Identities = 142/226 (62%), Positives = 176/226 (77%), Gaps = 1/226 (0%) refINP_384333.1 I PUTATIVE TRANSCRIPTION REGULATOR PROTEIN [Sinorhizobium meliloti] [ref] [RECEPTOR TRANSCRIPTION REGULATOR PROTEIN] [Sinorhizobium meliloti] Length = 230 1920.3 Best-BlastP =>> nrprot 66% Identities = 198/345 (57%), Positive = 239 / 345 (69%), Gaps = 9/345 (2%) EmbICAB82454.1 I CnrT Protein [Ralstonia metallidurans] Length = 351 1923.2 Best-BlastP =>> nrprot No Nits found 1924.4 Best-BlastP =>> nrprot 62% Identities = 75/165 (45%), Positive = 106/165 (64%), Gaps = 6/165 (3%) refINP_840350.1 I putative Antirestriction Protein [Nitrosomonas europaea ATCC 19718] EmbJCAD84171. 11 putative antirestriction protein [Nitrosomonas europaea ATCC 19718] Length = 171 1926.2 Best-BlastP =>> nrprot 71% Identities = 121/188 (64%), Positives = 150/188 (79%), Gaps = 1/188 (0 %) refJNP 405720.1 I thymidine kinase [Yersinia pestis] refJNP_669456.1 J thymidine kinase [Yersinia pestis KIM] spJQ8ZEJ1 JKITH_YERPE Thymidine kinase pirJjAD0265 thymidine kinase (EC 2.7.1.21) [similarity] - Yersinia pestis (strain C092) embICAC90984.1 I thymidine kinase [Yersinia pestis C092] gbJAAM85707.1 IAE013818_1 thymidine kinase [Yersinia pestis KIM] Length = 196 1928.2 Best-BlastP =>> nrprot 60% Identities = 181/408 (44%), Positives = 254/408 (62%), Gaps = 8/408 (1%) refINP_821038.1 Major facilitator family transporter [Coxiella burnetii RSA 493] AA091552.1 Major facilitator family transporter [Coxiella burnetii RSA 493] Length = 193.3 Best-BlastP =>> nrprot 56 % Identities = 132/320 (41%), Positives = 199/320 (62%), Gaps 17/320 (5%) gbIAAC21671.1 l PvcA [Pseudomonas aeruginosa] Length = 327 1930.3 Best-BlastP =>> nrprot No Hits found 1933.4 Best-BlastP =>> nrprot 14% Identities = 109/524 (20%), Positives = 228/524 (43%), Gaps = 74/524 (14% ) intracellular protein transport, coiled-coil protein necessary for protein transport from ER to Golgi; Usol p [Saccharomyces cerevisiae] pir11S67593 transport protein USOI-yeast (Saccharomyces cerevisiae) embyCAA98621.1I USOI [Saccharomyces cerevisiae] Length 1790 1934.4 Best-BlastP =>> nrprot 97% Identities = 310/333 (93%), Positive = 324 / 333 (97%) emblCAB65198.1 I hypothetical protein [Legionella pneumophila] Length = 333 1935.4 Best-BlastP =>> nrprot 96% Identities = 348/372 (93%), Positive = 360/372 (96%), Gaps = 3/372 (0%) embJCAB65199.1 hypothetical protein [Legionella pneumophila] Length = 369 1937.4 Best-BlastP =>> nrprot No Hits found 1939.5 Best-BlastP =>> nrprot No Hits found 1940.2 Best-BlastP =>> nrprot 53 % Identities = 153/524 (29%), Positives = 286/524 (54%), Gaps = 30/524 (5%) refJNP_922967.1 I HIyB / MsbA family ABC carry [Gloeobacter violaceus] dbjIBAC87962.11 HIyB / MsbA family ABC transporter [Gloeobacter violaceus] Length = 605 1943.3 Best-BlastP =>> nrprot 55% Identities = 136/303 (44%), Positives = 183/303 (60%), Gaps = 3/303 (0%) ref1ZP_00095364 .1 I COG0845: Memb rane-fusion protein [Novosphingobium aromaticivorans] Length = 371 1945.4 Best-BlastP =>> nrprot 80% Identities = 408/591 (69%), Positives = 473/591 (80%), Gaps = 5/591 (0%) refjNP_706511.11 succinate dehydrogenase flavoprotein subunit [Shigella flexneri 2a str. 301] gbIAAN42218. 11AE015088_5 succinate dehydrogenase flavoprotein subunit [Shigella flexneri 2a str. 301] Length = 592 1946.2 Best-BlastP =>> nrprot 78% Identities = 156/227 (68%), Positives = 188/227 (82%), Gaps = 1/227 (0%) emblCAA74088.1 I succinate dehydrogenase putative iron suiphur subunit [Shewanella frigidimarina] Length = 235 1947.3 Best-BlastP =>> nrprot 45% Identities = 76/274 (27%), Positives = 133/274 (48%), Gaps = 12/274 (4%) COG1577: Mevalonate kinase [Oenococcus oeni MCW] Length = 306 1949.4 Best-BlastP =>> nrprot 67% Identities = 38/83 (45%), Positives = 61/83 (73%) refINP_252324.1 I conserved hypothetical protein [Pseudomonas aeruginosa PA01] pir11G83191 conserved hypothetical protein PA3634 [imported] - Pseudomonas aeruginosa (strain PAOI) gbIAAGO7022. 11AE004783_7 conserved hypothetical protein [Pseudomonas aeruginosa PA01] Length = 94 195.3 Best-BlastP =>> nrprot 79% Identities = 181/278 (65%), Positives = 223/278 (80%) ref! NP_231578.1l PvcB protein [Vibrio cholerae 01 biovar eltor str. ## EQU1 ## N16961] Length = 287 1950.2 Best-BlastP =>> nrprot 55% Identities = 159/405 (39%), Positives = 239/405 (59%), Gaps = 13/405 (3%) reflNP_820347.1 J conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90861.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 1951.4 Best-BlastP =>> nrprot 81% Identities = 170/245 (69%), Positive = 205/245 (83%) refINP_924317.1 I probable ABC transporter ATP-binding protein [Gloeobacter violaceus] dbjlBAC89312.11 girl 371 [Gloeobacter violaceus] Length = 252 1955.3 Best-BlastP =>> nrprot 46% Identities = 141/475 (29%), Positive = 221 / 475 (46%), Gaps = 64/475 (13%) refJZP_00015335.1 COG2067: Long-chain fatty acid transport protein [Rhodospirillum rubrum] Length = 436 1960.2 Best-BlastP =>> nrprot No Hits found 1961.3 Best-BlastP =>> nrprot 96% Identities = 283/293 (96%), Positives = 284/293 (96%) gbIAAM00623.1 I unknown [Legionella pneumophila] Length = 293 1966.2 Best-BlastP =>> nrprot 84% Identities = 131 / 188 (69%), Positives = 160/188 (85%) reflNP 820795.1 translation elongation factor P [Coxiella burnetii RSA 493] gblAAO91309.11 translation elongation factor P [Coxiella burnetii RSA 493] Length = 188 1968.1 Best-BlastP =>> nrprot 41% Identities = 25/64 (39%), Positive = 32/64 (50%), Gaps = 13/64 (20%) refIZP_00011706.11 hypothetical protein [Rhodopseudomonas palustris] Length = 150 197.3 Best-BlastP =>> nrprot 80% Identities = 324 / 474 (68%), Positive = 389/474 (82%) reflNP_231579.1 ADF monooxygenase, PheA / TfdB family [Vibrio cholerae 01 biovar eltor str. N16961] pirIIC82137 FAD monooxygenase, PheA / TfdB family VC1945 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF95093.1 J FAD monooxygenase, PheA / TfdB family [Vibrio cholerae 01 biovar eltor str.

  N16961] Length = 487 1972.3 Best-BlastP =>> nrprot 62% Identities = 158/342 (46%), Positives = 216/342 (63%), Gaps = 3/342 (0%) gbJAAP58486.1 J putative phosphoribosylformyiglycinamidine cyclo ligase [uncultured Acidobacteria bacterium] Length = 343 1976.2 Best-BlastP =>> nrprot 79% Identities = 427/626 (68%), Positives = 497/626 (79%), Gaps = 6/626 (0%) REFINP 720274.1 I glucose-inhibited division protein A [Shewanella oneidensis MR-1] gblAAN57717.11AE015908_2 glucose-inhibited A [Shewanella oneidensis MR 1] Length = 629 1978.1 Best-BlastP =>> nrprot 63% Identities = 94/201 (46 %), Positive = 133/201 (66%), Gaps = 6/201 (2%) ReflNP_246425.1 I GidB [Pasteurella multocida] spIP57946IGIDB_PASMU Methyltransferase gidB (Glucose Inhibited Division B Protein) gbIAAK03570.1 1 GidB [Pasteurella multocida] Length = 210 1979.1 Best-BlastP =>> nrprot 79% Identities = 163/254 (64%), Positives = 204/254 (80%) refINP_820903.1 l sporulation initiation inhibitor protein soj [Coxiella burn andii RSA 493] gbIAAO91417.1 J sporulation initiation inhibitor protein soy [Coxiella burnetii RSA 493] Length = 256 1983.1 Best-BlastP =>> nrprot 63% Identities = 138/265 (52%), Positives = 175/265 (66% ), Gaps = 1/265 (0%) refINP 820962.1 1 bis (5'-nucleosyl) tetraphosphatase, symmetrical [Coxiella burnetii RSA 493] spIQ83AB7JAPAH_COXBU Bis (5'-nucleosyl) -tetraphosphatase, symmetrical (Diadenosine tetraphosphatase) (Ap4A hydrolase) (Diadenosine 51.5 "- P1, P4tetraphosphate pyrophosphohydrolase) gbIAAO91476.11 bis (5'-nucleosyl) tetraphosphatase, symmetrical [Coxiella burnetii RSA 493] Length = 291 1986.2 Best-BlastP =>> nrprot 24% Identities = 56/235 (23%), Positives = 111/235 (47%), Gaps = 11/235 (4%) gbIAAP84130.11 putative pathogenesisrelated protein [Pseudomonas aeruginosa] Length = 639 1989.2 Best-BlastP =>> nrprot 70% Identities = 263 / 481 (54%), Positives = 348/481 (72%), Gaps = 1/481 (0%) sp1P37986IG6PD_ERWCH Glucose-6-phosphate 1-dehydrogenase (G6PD) pir1IS37053 glucose-6-phosphate 1-deh ydrogenase (EC 1.1.1.49) - Erwinia chrysanthemi embjCAA52858.1 J glucose-6-phosphate 1-dehydrogenase [Erwinia chrysanthemi] Length = 491 199.1 Best-BlastP =>> nrprot 45% Identities = 105/371 (28%), Positive = 173/371 (46%), Gaps = 13/371 (3%) COG2814: Arabinose efflux permease [Rhodospirillum rubrum] Length = 411 1990.1 Best-BlastP =>> nrprot 55% Identities = 102/228 ( 44%), Positive = 136/228 (59%), Gaps = 2/228 (0%) gbJAAL76390.1 1 6phosphogluconolactonase [uncultured proteobacterium] Length = 226 1992.2 Best-BlastP =>> nrprot No Hits found 1998.3 Best-BlastP =>> nrprot 51% Identities = 119/265 (44%), Positives = 170/265 (64%), Gaps = 9/265 (3%) reflZP_00089281.1 I COG1295: Predicted Membrane Protein [Azotobacter vinelandii] Length = 408 2.1 Best-BlastP =>> nrprot 59% Identities = 70/170 (41%), Positives = 102/170 (60%), Gaps = 2/170 (1%) refINP_907750.1 j HYPOTHETICAL PROTEIN- RecB family exonuclease [Wolinella succinogenes] embJCAE10650.1 J HYPOTHETICAL PROTEIN-RecB family exonuclease [Wolinella succinogenes] Length = 193 20.1 Best-BlastP =>> nrprot No Hits found 2000.1 Best-BlastP =>> nrprot 99% Identities = 149/149 (100%), Positives = 149/149 (100%) gbIAAC38305 .1 I type IV pilin; competence and adherence associated pilin; CAP [Legionella pneumophila] Length = 149 2006.2 Best-BlastP =>> nrprot 46% Identities = 64/229 (27%), Positives = 102/229 (44%), Gaps = 27/229 (11%) refINP_762597.1 [Best value = 72] = 72% Identity = 173/298 (58%), Positive = 220/298 (%) ====================================================================================================================================================== 73%) refINP_792548.1 I hydroxymethylglutaryl-CoA lyase [Pseudomonas syringae pv. tomato str. DC3000] gblAAO56243.11 hydroxymethylglutaryl-CoA lyase [Pseudomonas syringae pv.

  tomato str. DC3000] Length = 299 201.2 Best-BlastP =>> nrprot 50% Identities = 139/407 (34%), Positives = 209/407 (51%), Gaps = 9/407 (2%) dbjlBAB69410.1 I hypothetical protein [Streptomyces avermitilis] Length = 468 2016.2 Best-BlastP =>> nrprot 64% Identities = 54/141 (38%), Positives = 90/141 (63%), Gaps = 4/141 (2%) refINP_820504.1 I rhodanese domain protein [Coxiella burnetii RSA 493] gbIAAO91018.1 rhodanese domain protein [Coxiella burnetii RSA 493] Length = 144 2017.1 Best-BlastP =>> nrprot 52% Identities = 70/179 (39%), Positives = 99/179 ( 55%), Gaps = 7/179 (3%) COG2840: Uncharacterized Protein Preserved in Bacteria [Pseudomonas syringae pv. syringae B728a] Length = 185 Best-BlastP =>> nrprot 61% Identities = 112/266 (42%), Positives = 153/266 (57%), Gaps = 28/266 (10%) refINP_253119.1 Probable cytochrome cl precursor [Pseudomonas aeruginosa PA0I] pirIIE83092 probable cytochrome cl precursor PA4429 [imported] - Pseudomonas aeruginosa (strain PAO1) gbjAAG07817.11AE0048578 probable cytochrome c1 precursor [Pseudomonas aeruginosa PAO1] Length = 260 Best-BlastP =>> nrprot 57% Identities = 299 / 765 (39%), Positives = 444/765 (58%), Gaps = 17/765 (2%) refINP_519533.11 PUTATIVE OUTER SIGNAL MEMBRANE PROTEIN PEPTIDE [Ralstonia solanacearum] emb! CAD15114.1 PUTATIVE OUTER SIGNAL MEMBRANE PROTEIN PEPTIDE [Ralstonia solanacearum] Length = 765 Best-BlastP =>> nrprot 78% Identities = 128/206 (62%), Positives = 163/206 (79%), Gaps = 2/206 (0%) refINP_716244.1 j stringent starvation protein [Shewanella oneidensis MR-1] gbIAAN53689.1 1AE015508_5 stringent starvation protein [Shewanella oneidensis MR-1] Length = 209 2021.1 Best-BlastP => > nrprot 67% Identities = 68/134 (50%), Positives = 89/134 (66%), Gaps = 5/134 (3%) refINP_820726.1 j stringent starvation protein B [Coxiella burnetii RSA 493] gb! AAO91240 .1 l stringent starvation protein B [Coxiella burnetii RSA 493] Length = 138 2022.1 Best-BlastP =>> nrprot No Hits found 2024.2 Best-BlastP =>> nrprot 58% Identities = 66/177 (37%), Positives = 105 / 177 (59%) refIZP_00065967.1 I hypothetical protein [Microbulbifer degradans 2-40] Length = 183 2026.1 Best-BlastP =>> nrprot No Hits found 2027.2 Best-BlastP =>> nrprot 50% Identities = 140/413 (33%) %), Positive = 215/413 (52%), Gaps = 13/413 (3%) refINP_215111.1 I hypothetical protein [Mycobacterium tuberculosis H37Rv] [Mycobacterium bovis subsp. bovis AF2122 / 97] pirIIH70908 hypothetical protein Rv0597c - Mycobacterium tuberculosis (strain H37RV) emblCAB09957.1 I hypothetical protein Rv0597c [Mycobacterium tuberculosis H37Rv] gblAAK44851.11 hypothetical protein [Mycobacterium tuberculosis CDC1551] embICAD93475.1l CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp. bovis AF2122 / 97] Length = 411 2029.2 Best-BlastP =>> nrprot No Hits found 2030.2 Best-BlastP =>> nrprot No Hits found 2031.2 Best-BlastP =>> nrprot 31% Identities = 24/63 (38%), Positive = 36/63 (57%) refINP_051664.1 transposase, putative [Deinococcus radiodurans] pir1lA75633 probable transposase - Deinococcus radiodurans (strain R1) gblAAF12606.11AE001826 75 transposase, putative [Deinococcus radiodurans] Length = 327 2034.2 Best-BlastP =>> nrprot 40% Identities = 65/223 (29%), Positives = 110/223 (49%), Gaps = 13/223 (5%) refIZP_00009418.11 COG1647: Esterase / lipase [Rhodopseudomonas palustris] Length = 263 2037.3 Best- BlastP =>> nrprot 97% Identities = 453/469 (96%), Positives = 459/469 (97%) gbIAAM00645.1 I Zn Metalloprotein [Legionella pneumophila] Length = 469 2039.1 Best-BlastP =>> nrprot No Hits found 2019.2 202.3 2020.1 Best-BlastP =>> nrprot 63% Identifies = 199/448 (44%), Positives = 288/448 (64%), Gaps = 1/448 (0%) refINP_459228.1 I putative membrane. Zn-dependent protease [Salmonella typhimurium LT2] spIQ8ZRP1IECFE_SALTY EcfE protease gblAAL19187.11 putative membraneassociated Zn-dependent protease [Salmonella typhimurium LT2] Length = 450 Best-BlastP =>> nrprot 36% Identifies = 74/238 (31%), Positive = 119/238 (50%), Gaps = 4/238 (1%) gblΔAK19894.11 0-methyltransferase [Polyangium cellulosum] Length = 346 Best-BlastP =>> nrprot 59% Identifies = 274/627 (43%), Positives = 384/627 (61%), Gaps = 9/627 (1%) spIQ59118JAMOH ARTGO Histamine oxidase (Copper amine oxidase) pirIIA56102 amine oxidase (copper-containing) (EC 1.4.3.6) - Arthrobacter globiformis dbjIBAA07517.1 I Copper Amine oxidase, Monoamine oxidase, Histamine oxidase [Arthrobacter globiformis] Length = 684 2049.2 Best-BlastP =>> nrprot 26% Identities = 57/288 (19%), Positives = 112/288 (38%), Gaps = 32/288 (11%) pirilT13030 microtubule binding protein D-CLIP-190 - fruit fly (Drosophila melanogaster) gblAAB96783.11 microtubule binding protein D-CLIP-190 [Drosophila m elanogaster] Length = 1690 205.1 Best-BlastP =>> nrprot 59% Identifies = 103/267 (38%), Positives = 158/267 (59%), Gaps = 15/267 (5%) refINP820370.1 I phosphatidate cytidylyltransferase [Coxiella burnetii RSA 493] gblAAO90884.1 I phosphatidate cytidylyltransferase [Coxiella burnetii RSA 493] Length = 2051.2 Best-BlastP =>> nrprot 37% Identifies = 34/108 (31%), Positives = 63/108 (58%), Gaps = 2/108 (1%) refINP_932218.11 putative conjugative transfer protein TrbB [Vibrio vulnificus YJ016] dbjIBAC97741.11 putative conjugative transfer protein TrbB [Vibrio vulnificus YJ016] Length = 137 2053.2 Best-BlastP =>> nrprot 55% Identities = 146/331 (44%), Positives = 180/331 (54%), Gaps = 57/331 (17%) gbjAAC83331.11 major outer membrane protein precursor [Legionella pneumophila] Length = 288 2054.2 Best-BlastP =>> nrprot 54% Identifies = 128/296 (43%), Positives = 184/296 (62%), Gaps = 17/296 (5%) refINP_442548.1 I unknown protein [Synechocystis sp. PCC 6803] pirlISIS76674 hypothetical protein - Synechocystis sp. (strain PCC 6803) dbjlBAA10618.1 I s1r0619 [Synechocystis sp. PCC 6803] Length = 348 2056.1 Best-BlastP =>> nrprot 55% Identifies = 109/292 (37%), Positives = 165/292 (56%), Gaps = 8/292 (2%) refZNP_00134420.1 I COG0500 : SAM-dependent methyltransferases [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 290 2057.3 Best-BlastP =>> nrprot 59% Identities = 145/350 (41%), Positives = 208/350 (59%), Gaps = 17/350 (4%) reflZP_00097544.1 l COG0722: 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Desulfitobacterium hafniense] Length = 342 206.3 Best-BlastP =>> nrprot 66% Identifies = 120/227 (52%), Positive = 150/227 (66%) %) refNP_252342.1 I undecaprenyl pyrophosphate synthetase [Pseudomonas aeruginosa PA01] pirIIG83188 undecaprenyl pyrophosphate synthetase PA3652 [imported] Pseudomonas aeruginosa (strain PAO1) gbIAAG07040.11AE004785_4 undecaprenyl pyrophosphate synthetase [Pseudomonas aeruginosa PAO1] Length = 251 2060.3 Best-BlastP =>> nrprot 32% Identities = 71/221 (32%), Positives = 123/221 (55%), Gaps = 24/221 (10%) refZG_00082359.1 COG2199: FOG: GGDEF domain [Geobacter metallireducens] Length = 353 2062.2 Best -BlastP =>> nrprot No Hits found 2064.3 Best-BlastP =>> nrprot No Hits found 204.1 2041.2 2044.2 2065.2 Best-BlastP =>> nrprot No Hits found 2066.5 Best-Bl astP =>> nrprot No Hits found 2067.5 Best-BlastP =>> nrprot 61% Identities = 151/349 (43%), Positives = 215/349 (61%), Gaps = 19/349 (5%) refINP660996.11 glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] gbJAAM71338.1 J glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] Length = 372 2068.3 Best-BlastP =>> nrprot 27% Identities = 71/336 (21%), Positive = 133 / 336 (39%), Gaps = 67/336 (19%) emblCAE02882.11 OSJNBb0022F23.19 [Oryza sativa (japonica cultivar-group)] Length = 2391 207.3 2070.4 protein [Pseudomonas aeruginosa PA0I] refIZP_00136432.1I hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] pir1ID83262 hypothetical protein PA3075 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG06463.11AE004731_11 hypothetical protein PA3075 [Pseudomonas aeruginosa PAO1] Length = 543 2073.4 Best-BlastP =>> nrprot 37% Identities = 49/192 (25 %), Positives = 85/192 (44%), Gaps = 23/192 (11%) refINP_929249.11 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTOI] embyCA14276.1J unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 231 2075.1 Best-BlastP =>> nrprot No Hits found 2078.2 Best-BlastP =>> nrprot No Hits found 2079.2 Best-BlastP =>> nrprot No Hits found 2080.3 Best-BlastP =>> nrprot 57% Identities = 88/221 (39%), Positives = 128/221 (57%), Gaps = 1/221 (0%) refINP_925444.1 I hypothetical protein gII2498 [Gloeobacter violaceus] dbjlBAC90439.11 g112498 [Gloeobacter violaceus] Length = 222 2082.2 Best-BlastP =>> nrprot 75% Identities = 34/66 (51%), Positives = 51/66 (77%) refINP_768003.1 I bsI1363 [Bradyrhizobium japonicum] dbjIBAC46628.1 l bsI1363 [Bradyrhizobium japonicum USDA 110] Length = 73 2083.2 Best-BlastP =>> nrprot 98% Identities = 224/227 (98%), Positives = 226/227 (99%) gbIAAM00399.11AF386079_9 CcmH [Legionella pneumophila] Length = 360 2085.2 Best-BlastP =>> nrprot 99% Identities = 132/133 (99%), Positives = 133/133 (100%) gbIAAM00399.1 1AF386079_9 CcmH [Legionella pneumophila] Length = 360 2087.2 Best-BlastP =>> nrprot 36% Identities = 88/166 (53 %), Positives = 116/166 (69% ) Length = 176 209.2 Best-BlastP =>> Nrprot 24% Identities = 41/135 (30%), Positive = 61/135 (45%), Gaps = 36/135 (26%) gblAAO49307.1 outer surface protein precursor [Wolbachia pipientis] Length = 186 2091.1 Best-BlastP =>> nrprot 39% Identities = 60/226 (26% ), Positives = 99/226 (43%), Gaps = 8/226 (3%) gbJAAK31375.1 lAC084329_1 ppg3 [Leishmania major] Length = 1325 Best-BlastP =>> nrprot 98% Identities = 418/423 (98% Positive = 419/423 (99%) gblAAM73854.11AF454865_I putative phospholipase C [Legionella pneumophila] Length = 423 Best-BlastP =>> nrprot 49% Identities = 166/568 (29%), Positives = 274/568 (48%) %), Gaps = 46/568 (8%) refINP_251765.11 hypothetical 2092.2 Best-BlastP =>> nrprot 86% Identities = 634/850 (74%), Positive = 741/850 (87%) refINP_457131.11 CIpB protein (heat shock protein f84.1) [Salmonella enterica subsp. enterica serovar Typhi] reflNP_461591.11 ATP-dependent protease, Hsp 100, part of nove) multi-chaperone system with DnaK, DnaJ, and GrpE [Salmonella typhimurium LT2] ref1NP_806327.1 [ICPB protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] pirlIAI0831 CIpB protein (heat shock protein f84.1) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gblAAL21550.1 1 ATP-dependent protease [Salmonella typhimurium LT2] emblCAD05840.1 I Protein (heat shock protein f84.1) [Salmonella enterica subsp. enterica serovar Typhi] gbIAAO70187.11 CIpB protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 857 2095.2 Best-BlastP =>> nrprot 72% Identities = 218/393 (55%), Positives = 285/393 (72%), Gaps = 1/393 (0%) refIZP_00125180.1 I COG2081: Predicted flavoproteins [Pseudomonas syringae pv. syringae B728a] Length = 392 2098.2 Best-BlastP =>> nrprot No Hits found 2103.2 Best-BlastP =>> nrprot 69% Identities = 424/791 (53%), Positives = 552/791 (69%), Gaps = 3 / 791 (0%) 3-hydroxyacyl-CoA dehydrogenase refINP_637344.1 [Xanthomonas campestris pv. campestris str. ATCC 33913] 13-hydroxyacyl-CoA dehydrogenase [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 790 Best-BlastP =>> nrprot 85% Identities = 91/127 (71%), Positives = 108/127 (85%), Gaps = 1/127 (0%) ref1NP_878931.1J 50S ribosomal protein L7 / L12 [Bordetella pertussis] ref1NP_882379.1 150S ribosomal protein L7 / L12 [Bordetella parapertussis] reflNP_886566.1 50S ribosomal protein L7 / L12 [Bordetella bronchiseptica] embICAE39754.1 150S ribosomal protein L7 / L12 [Bordetella parapertussis] emblCAE40393.1 50S ribosomal protein L7 / L12 [Bordetella pertussis] embicE30515.1 J 50S ribosomal protein L7 / L12 [Bordetella bronchiseptica] Length = 127 Best-BlastP =>> nrprot 73% Identities = 89/173 (51%), Positives = 131/173 (75%) ref19NP_819272.1 ribosomal protein L10 [Coxiella burnetii RSA 493] gblAAO89786.11 ribosomal protein L10 [Coxiella burnetii RSA 493] Length = 174 Best-BlastP =>> nrprot 45% Identities = 81/300 (27%) , Positives = 142/300 (47%), Gaps = 14/300 (4%) ReflNP 561674.1 I conserved hypothetical protein [Clostridium perfringens] dbjIBAB80464.1 1 conserved hypothet ical protein [Clostridium perfringens str. 13] Length = 308 211.1 Best-BlastP =>> nrprot 58% Identities = 118/341 (34%), Positives = 204/341 (59%), Gaps = 13/341 (3%) ref] NP_882114.11 putative membrane protein [Bordetella pertussis] refINP_882789.1 I putative membrane protein [Bordetella parapertussis] refINP_886988.1 I putative membrane protein [Bordetella bronchiseptica] embICAE43862.1 I putative membrane protein [Bordetella pertussis] embjCAE36021.1 putative membrane protein [Bordetella parapertussis] emb CAE30937.1 I putative membrane protein [Bordetella bronchiseptica] Length = 367 2112.2 Best-BlastP =>> nrprot 28% Identities = 83/302 (27%), Positives = 137/302 (45%), Gaps = 15/302 (4%) refINP_772278.1 I bII5638 [Bradyrhizobium japonicum] dbjIBAC50903.1 I b115638 [Bradyrhizobium japonicum USDA 110] Length = 500 2116.2 Best-BlastP =>> nrprot 26% Identities = 23/73 (31%), Positive = 42 / 73 (57%), Gaps = 1/73 (1%) refINP_391095.1 I transcriptional regulator [Bacillus subtilis] spIP21340IPAIA_BACSU Protease synthase and sporulat ion negative regulatory protein PAI 1 embjCAB15205.1 transcriptional regulator [Bacillus subtilis subsp. subtilis str. 168] Length = 172 2119.2 Best-BlastP =>> nrprot 47% Identities = 175/527 (33%), Positives = 263/527 (49%), Gaps = 77/527 (14%) dbjJBAB86344.1 metalloprotease [ Vibrio fluvialis] Length = 610 2104.1 2106.2 2108.2 212.1 Best-BlastP =>> nrprot 68% Identities = 83/152 (54%), Positives = 110/152 (72%), Gaps = 2/152 (1%) reflNP_742683. Phosphatidylglycerophosphatase A [Pseudomonas putida KT2440] gbIAAN66147. 1 IAE016242_15 Phosphatidylglycerophosphatase A [Pseudomonas putida KT2440] Length = 167 2120.2 Best-BlastP =>> nrprot No Hits found 2121.2 Best-BlastP =>> nrprot 60% Identities = 108/221 (48%), Positives = 148/221 (66 %), Gaps = 1/221 (0%) refINP_251544.1 Preserved hypothetical protein [Pseudomonas aeruginosa PA01] pir11B83288 conserved hypothetical protein PA2854 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG06242.1 IAE004712_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1 Length = 323 Best-BlastP =>> nrprot 43% Identities = 100/377 (26%), Positives = 171/377 (45%), Gaps = 29/377 (7%) refiNP_820237.1 J membrane protein, putative [Coxiella burnetii RSA 493] gbjAAO90751.11 protein membrane, putative [Coxiella burnetii RSA 493] Length = 408 Best-BlastP =>> nrprot 62% Identities = 56/112 (50%), Positives = 74/112 (66%) , Gaps = 3/112 (2%) refINP_840790.1 I Uncharacterized protein family UPF0102 [Nitrosomonas europaea ATCC 19718] EmbICAD84622.1 I Uncharacterised prot ein family UPF0102 [Nitrosomonas europaea ATCC 19718] Length = 118 Best-BlastP =>> nrprot 70% Identities = 98/192 (51%), Positives = 141/192 (73%) ref1NP_743483.1 I phosphoheptose isomerase [Pseudomonas putida KT2440 ] gbiAAN66947. 11AE016322_14 phosphoheptose isomerase [Pseudomonas putida KT2440] Length = 195 Best-BlastP =>> nrprot 56% Identities = 141/268 (52%), Positives = 180/268 (67%), Gaps = 4/268 (1%) refI NP 406655.1 I thiaminemonophosphate kinase [Yersinia pestis] refINP_668333.1 I thiaminemonophosphate kinase [Yersinia pestis KIM] pirIIAD0386 thiamine-phosphate kinase (EC 2.7.4.16) [imported] - Yersinia pestis (CO92 strain) emblCAC92415.1 thiamine-monophosphate kinase [Yersinia pestis CO92] gbIAAM84584.11AE013704_1 thiamin-monophosphate kinase [Yersinia pestis KIM] Length = 329 Best-BlastP =>> nrprot 62% Identities = 88/188 (46%), Positives = 120/188 (63%), Gaps = 7/188 (3%) refINP_820724.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] gbiAAO91238.1 i conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 191 2132.2 Best-BlastP =>> nrprot 47% Identities = 53 / 181 (29%), Positive = 96/181 (53%), Gaps = 7/181 (3%) ref Ipoprotein, putative [Shewanella oneidensis MR-1 ] gbiAAN53382. 1IAE015477_12 lipoprotein, putative [Shewanella oneidensis MR-1] Length = 188 2133.1 Best-BlastP =>> nrprot No Hits found 2135.1 Best-BlastP =>> nrprot 53% Identities = 55/118 (46%), Positives = 70/118 (59%), Gaps = 1/118 (0%) refINP_254248.1I ATP synthase protein I [Pseudomonas aeruginosa PA01] pir11B82953 ATP synthase protein I PA5561 [imported] - Pseudomonas aeruginosa (strain PAO1) gbiAAG08946.11AE004967_17 ATP synthase protein I [ Pseudomonas aeruginosa PAO1] Length = 126 2136.1 Best-BlastP =>> nrprot 75% Identities = 176/277 (63%), Positives = 210/277 (75%), Gaps = 19/277 (6%) refINP_720269.1 I ATP synthase F0, A subunit [Shewanella oneidensis MR-1] gb! AAN57712.11AE015907_10 ATP synthase F0, A subunit [Shewanella oneidensis MR-1] Length = 264 2122.2 2127.2 2129.1 213.1 2130.1 2137.1 Best-BlastP =>> nrprot 81% Identities = 72/80 (90%), Positives = 75/80 (93%) COG0636: FOF1-type ATP synthase, subunit c / Archaeal / vacuolar-type H ± ATPase, subunit K [Pseudomonas syringae] pv. syringae B728a] refInP_795322.1 ATP synthase F0, C subunit [Pseudomonas syringae pv. tomato str. DC3000] gblAAO59017.1 ATP synthase F0, C subunit [Pseudomonas syringae pv. tomato str. DC3000] Length = 85 2138.2 Best-BlastP =>> nrprot 72% Identities = 85/156 (54%), Positives = 114/156 (73%) refINP_820917.1 ATP synthase F0, B subunit [Coxiella burnetii RSA 493] gbJAAO91431 .11 ATP synthase F0, B subunit [Coxiella burnetii RSA 493] Length = 156 214.1 Best-BlastP =>> nrprot 66% Identities = 61/140 (43%), Positives = 99/140 (70%) refINP_252741.11 NusB Protein [Pseudomonas aeruginosa PA01] SpIQ9HWX6JNUSB_PSEAE N use protein protein B homolog (NusB protein) pirIIG83140 NusB protein PA4052 [imported] Pseudomonas aeruginosa (strain PAOI) gblAAG07439.11AE004821_12 NusB protein [Pseudomonas aeruginosa PAO1] Length = 159 2140.2 Best-BlastP =>> nrprot 64% Identities = 86/178 (48%), Positives = 116/178 (65%), Gaps = 2/178 (1%) REFINP 254244.1 J ATP synthase delta chain [Pseudomonas aeruginosa PA01] pirjIF82952 ATP synthase delta chain PA5557 [imported] Pseudomonas aeruginosa (strain PAOI) gblAAG08942.1! AE004967_13 ATP synthase delta chain [Pseudomonas aeruginosa PAO1] Lengt h = 178 2141.2 Best-BlastP =>> nrprot No Nits found 2143.5 Best-BlastP =>> nrprot 21% Identities = 66/242 (27%), Positives = 110/242 (45%), Gaps = 32/242 ( 13%) refINP_819452.11 hypothetical protein [Coxiella burnetii RSA 493] gblAAO89966.1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 262 Best-BlastP =>> nrprot 59% Identities = 133/308 (43%), Positive = 196/308 (63%), Gaps = 1/308 (0%) refINP_716251.1 arginine N-succinyltransferase [Shewanella oneidensis MR-1] gblAAN53696.1JAE015509_I arginine N-succinyltransferase [Shewanella oneidensis MR-1] Length = 339 Best -BlastP =>> nrprot 60% Identities = 151/363 (41%), Positives = 224/363 (61%), Gaps = 5/363 (1%) refINP_251855.1 J histidinolphosphate aminotransferase [Pseudomonas aeruginosa PA0I] spIQ9HZ68IHI82_PSEAE Histidinol aminotransferase 2 (Imidazole acetol-phosphate transaminase 2) pir1IF83250 histidinol phosphate aminotransferase PA3165 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG06553.11AE004740_6 h istidinol-phosphate aminotransferase [Pseudomonas aeruginosa PAO1] Length = 369 Best-BlastP =>> nrprot 70% Identities = 58/107 (54%), Positives = 80/107 (74%), Gaps = 2/107 (1%) refINP_840178.1 I Pterin 4 alpha carbinolamine dehydratase [Nitrosomonas europaea ATCC 19718] embICAD83988.11 Pterin 4 alpha carbinolamine dehydratase [Nitrosomonas europaea ATCC 19718] Length = 113 Best-BlastP =>> nrprot 75% Identities = 172/305 (56%) , Positives = 230/305 (75%), Gaps = 1/305 (0%) refINP_820140.1 I protein-export membrane protein SecF [Coxiella burnetii RSA 493] gblAAO90654.11 protein-export protein membrane SecF [Coxiella burnetii RSA 493 Length = 304 Best-BlastP =>> nrprot 99% Identities = 427/431 (99%), Positive = 430/431 (99%) spIQ8RNM2IPURA_LEGPN Adenylosuccinate synthetase (IMP-aspartate ligase) (AdSS) (AMPSase) gblAAM00648. 1 I adenylosuccinate synthetase [Legionella pneumophila] Length = 2144.3 2146.2 2147.1 2148.1 2149.4 215.1 Best-BlastP =>> nrprot 79% Identities = 97/150 (64%), Positiv es = 124/150 (82%) COG1327: Predicted transcriptional regulator, consisting of Zn-ribbon and ATP-cone domains [Pseudomonas syringae pv. syringae B728a] Length = 165 2150.1 Best- BlastP =>> nrprot 39% Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 19/148 (12%) refINP_799791.11 hypothetical protein VPA0281 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61624.1 I hypothetical protein [Vibrio parahaemolyticus] Length = 133 2151.2 Best-BlastP =>> nrprot 14% Identities = 39/144 (27%), Positive = 67/144 (46%), Gaps = 24/144 (16%) spIQ9U7EOIATRX_CAEEL Transcriptional regulator ATRX homolog (X-linked nuclear protein-1) gbIAAD55361. 11AF134186_1 XNP-1 [Caenorhabditis elegans] Length = 1359 2152.2 Best-BlastP =>> nrprot 83% Identities = 127/176 (72%), Positives = 150/176 (85%) refINP_820460.1 I antioxidant, AhpC / TSA family [Coxiella burnetii RSA 493] gbIAAO90974.1 I antioxidant, AhpC / TSA family [Coxiella burnetii RSA 493] Length = 179 2153.3 Best-BlastP =>> nrprot No Hits found 2156.3 Best-BlastP =>> nrprot 45% Identities = 126 / 444 (28%), Positives = 197/444 (44%), Gaps = 30/444 (6%) refINP_436941.1 J putative oxidoreductase protein [Sinorhizobium meliloti] pirIIA95892 Probable oxidoreductase protein SMb20415 [imported] Sinorhizobium meliloti (strain 1021) magaplasmid pSymB jEICIC48801.1 J putative oxidoreductase protein [Sinorhizobium meliloti] Length = 429 2159.2 Best-BlastP =>> nrprot 76% Identities = 163/238 (68%), Positives = 191/238 (80%) refINP_249464.1 J pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas aeruginosa PA01] spIQ9I5G5JPDXJ_PSEAE Pyridoxal phosphate biosynthetic protein pdxJ (PNP synthase) pyridoxal phosphate biosynthetic protein PdxJ PA0773 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAGO4162.1 JAE004512_5 pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas aeruginosa PAO1] Length = 248 216.2 Best-BlastP =>> nrprot 83% Identities = 296/416 ( 71%), Positive = 351/416 (84%), Gaps = 1/416 (0%) refIZP_00138159.1 J COG0112: Glycine / serine hydroxymethyltransferase [Pseudomonas aeruginosa UCBPP-PA14] Length = 421 2160.2 Best-BlastP =>> nrprot 70% Identities = 166/329 (50%), Positives = 227/329 (68%), Gaps = 15/329 (4%) REFINP_867540.1 J 2-oxoglutarate ferredoxin oxidoreductase beta subunit [Pirellula sp.] embICAD75087. 2oxoglutarate ferredoxin oxidoreductase beta subunit [Pirellula sp.] Length = 353 2162.2 Best-BlastP =>> nrprot 52% Identities = 153/496 (30%), Positives = 247/496 (49%), Gaps = 41/496 ( 8%) refINP_478172.1 J amidase [Nostoc 2164. 2 putative [Coxiella burnetii RSA 493] spIQ83C89IYC39_COXBU Hypothetical UPF0078 protein CBU1239 gbIAAO90 748.1 J protein membrane, putative [Coxiella burnetii RSA 493] Length = 193 2166.2 Best-BlastP =>> nrprot No Hits found 2167.2 Best-BlastP =>> nrprot 65% Identities = 230/469 (49%), Positives = 315 / 469 (67%), Gaps = 5/469 (1%) refINP_819701.1 J mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [Coxiella burnetii RSA 493] gbIAAO90215.1 J mannose-1-phosphate guanylyltransferase / mannose -6 isomerase phosphate [Coxiella burnetii RSA 493] Length = 477 sp. PCC 7120] pirIIAB2530 amidase [imported] - Nostoc sp. (strain PCC 7120) plasmid pCC7120beta dbjIBAB77168.1 J amidase [Nostoc sp. PCC 7120] Length = 507 Best-BlastP =>> nrprot 48% Identities = 91/191 (47%), Positives = 135/191 (70%), Gaps = 1/191 (0%) refINP_820234. 1 j protein membrane, 2169.2 Best-BlastP =>> nrprot 69% Identities = 77/136 (56%), Positives = 95/136 (69%), Gaps = 4/136 (2%) refJZP_00067440.1 j COG4969: Tfp pilus assembly protein, major pilin PiIA [Microbulbifer degradans 2-40] Length = 164 2170.1 Best-BlastP =>> nrprot 60% Identities = 67/136 (49%), Positives = 84/136 (61%), Gaps = 5/136 (3%) ref! ZP_00067440.1 I COG4969: Tfp pilus assembly protein, major pilin PiIA [Microbulbifer degradans 2-40] Length = 164 2172.2 Best-BlastP =>> nrprot 52% Identities = 47/147 (31) %), Positives = 81/147 (55%), Gaps = 1/147 (0%) refINP_717367.1 conserved hypothetical protein [Shewanella oneidensis MR-1] gbjAAN54811.11AE015620_3 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 159 2173.2 Best-BlastP =>> nrprot 52% Identities = 59/125 (47%), Positives = 75/125 (60%), Gaps = 1/125 (0%) spIQ45292IYOUG_BACLI Hypothetical 17.3 kDa protein in GNTR 5 ' region pirlIJC2302 oug protein - Bacillus licheniformis dbjIBAA06500.1 j hypothetical pro tein [Bacillus licheniformis] Length = 147 2174.1 Best-BlastP =>> nrprot 50% Identities = 37/71 (52%), Positive = 50/71 (70%) refINP_840482.11 DUF167 [Nitrosomonas europaea ATCC 19718] emblCAD84306.1 I DUF167 [Nitrosomonas europaea ATCC 19718] Length = 100 2175.3 Best-BlastP =>> nrprot No Hits found 2176.3 Best-BlastP =>> nrprot 52% Identities = 35/119 (29%), Positive = 64/119 (53% ), Gaps = 6/119 (5%) refINP_784901.1 1.unknown [Lactobacillus plantarum WCFS1] embICAD63748.1 I unknown [Lactobacillus plantarum WCFS1] Length = 269 2177.2 Best-BlastP =>> nrprot 53% Identities = 71/181 (39%), Positives = 104/181 (57%), Gaps = 1/181 (0%) refJZP_00052983.1 I COG0582: Integrase [Magnetospirillum magnetotacticum] Length = 193 2180.2 Best-BlastP =>> nrprot 19% Identities = 68/171 (39%), Positives = 95/171 (55%), Gaps = 5/171 (2%) refINP_814807.1 d acetyltransferase, GNAT family [Enterococcus faecalis V583] gbIAAO80877.1 I acetyltransferase, GNAT family [Enterococcus faecalis V583] Length = 168 2188 .2 Best-BlastP =>> nrprot 45% Identities = 64/241 (26%), Positives = 113/241 (46%), Gaps = 17/241 (7%) refINP_719332.11 conserved hypothetical protein [Shewanella oneidensis MR -1] gbIAAN56776.1IAE015813 4 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 250 2191.4 Best-BlastP =>> nrprot 74% Identities = 88/168 (52%), Positives = 127/168 (75%) refINP_709074 The peptide deformylase [Shigella flexneri 2a str. 301] refINP_838779.1 I deformylase peptide [Shigella flexneri 2a str. 2457T] gblAAN44781.1 IAE015342_8 deformylase peptide [Shigella flexneri 2a str. 301] gblAAP18590.1 peptide deformylase [Shigella flexneri 2a str. 2457T] Length = 169 2193.4 Best-BlastP =>> nrprot 90% Identities = 331/419 (78%), Positive = 379/419 (90%) dbjIBAC95945.1 I transcription termination factor [Vibrio vulnificus YJ016] Length = 427 2195.1 Best-BlastP =>> nrprot 84% Identities = 356/487 (73%), Positives = 415/487 (85%) refINP_667799.1 I putative oxidoreductase [Yersinia pestis KIM] gbIAAM84050.11AE013646_10 putative oxidoreductase [Yersinia pestis KIM] Length = 506 2196.1 Best-BlastP =>> nrprot 51% Identities = 77/233 (33%), Positives = 122/233 (52%), Gaps = 11/233 (4%) refINP_903454.1 I NAD (P) H ## STR1 ## % Identities = 35/104 (33%), Positive = 58/104 (55%), Gaps = 4/104 (3%) COG3785: Uncharacterized preserved protein [Rhodopseudomonas palustris] Length = 110 Best-BlastP = >> nrprot 97% Identiti es = 235/238 (98%), Positives = 236/238 (99%) putative TatC protein [Legionella pneumophila] Length = 238 Best-BlastP =>> nrprot 65% Identities = 123/228 ( 53%), Positive = 152/228 (66%) refINP_819791.11 glutamine amidotransferase, class I [Coxiella burnetii RSA 493] gb! AAO90305.11 glutamine amidotransferase, class I [Coxiella burnetii RSA 493] Length = 228 2204.2 Best-BlastP =>> nrprot 72% Identities = 279/498 (56%), Positives = 369/498 (74%), Gaps = 3/498 (0%) refINP_841949.1 1 Sulfate transporter [Nitrosomonas europaea ATCC 19718] embJCAD85838.1 Sulfate transporter [Nitrosomonas europaea ATCC 19718] Length = 539 2207.2 Best-BlastP =>> nrprot 79% Identities = 126/208 (60%), Positives = 167/208 (80%) refINP_841948.1 I Prokaryotic-type carbonic anhydrase [Nitrosomonas europaea ATCC 19718] EmbICAD85837.1 Prokaryotic-type carbonic anhydrase [Nitrosomonas europaea ATCC 19718] Length = 208 2208.1 Best-BlastP =>> nrprot No 1-beds found 2209.4 Best-BlastP =>> nrprot 58% Identity s = 111/321 (34%), Positives = 189/321 (58%), Gaps = 7/321 (2%) refINP814373.1 Ornithine cyclodeaminase, putative [Enterococcus faecalis V583] gbiAAM75325.1 JAF454824_124 EF0124 [Enterococcus faecalis ] gblAAO80444.1 ornithine cyclodeaminase, putative [Enterococcus faecalis V583] Length = 326 221.1 Best-BlastP =>> nrprot 70% Identities = 158/285 (55%), Positives = 212/285 (74%) ref1ZP_00033588.1 I COG0329: Dihydrodipicolinate synthase / N-acetylneuraminate lyase [Burkholderia fungorum] Length = 297 2212.4 Best-BlastP =>> nrprot 51% Identities = 232/616 (37%), Positives = 344/616 (55%), Gaps = 48 / 616 (7%) refINP_762611.11 Type IV secretory pathway, VirD4 component [Vibrio vulnificus CMCP6] gblAAO07601. 11AE016810_104 Type IV secretory pathway, VirD4 component [Vibrio vulnificus CMCP6] Length = 697 2213.2 Best-BlastP =>> nrprot Nol-beds found 2217.3 Best-BlastP =>> nrprot 66% Identities = 302/609 (49%), Positives = 411/609 (67%), Gaps = 13/609 (2%) SplP32966IUVRC_PSEFL Excinuclease ABC subunit C gbIAAA98758.1 UVR excinuclease subunit C Length = 607 2219.2 Best-BlastP =>> nrprot 34% Identities = 41/91 (45 %), Positive = 48/91 (52%) gblAAA73346.11 [Mycobacterium tuberculosis DNA sequence, complete cds.], Gene products Length = 152,222.1 Best-BlastP =>> nrprot 63% Identities = 73/149 (48%) , Positives = 102/149 (68%), Gaps = 5/149 (3%) refINP_928633.1 J hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] embICAE13616.1 I unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTOI] Length = 149 2220. 2 Best-BlastP =>> nrprot 71% Identities = 110/213 (51%), Positives = 156/213 (73%) refINP_486035. 1 hypothetical protein [Nostoc sp.  PCC 7120] pirIIAE2055 hypothetical protein aII1995 [imported] - Nostoc sp.  (strain PCC 7120) dbjIBAB73694. 11 ORF_ID: a111995 - hypothetical protein [Nostoc sp.  PCC 7120] Length = 221 2221. 3 Best-BlastP =>> nrprot 57% Identities = 58/132 (43%), Positives = 84/132 (63%), Gaps = 4/132 (3%) gblEAA20351. Cytosol aminopeptidase [Plasmodium yoelii yoelii] Length = 612 2225. 2 Best-BlastP =>> nrprot 55% Identities = 116/284 (40%), Positives = 167/284 (58%), Gaps = 6/284 (2%) refINP_902361. 1 l geranyltranstransferase [Chromobacterium violaceum ATCC 12472] gbIAAQ60361. 11 geranyltranstransferase [Chromobacterium violaceum ATCC 12472] Length = 298 2199. 2,220. 1 Best-BlastP =>> nrprot 51% Identities = 97/266 (36%), Positives = 151/266 (56%), Gaps = 9/266 (3%) refIDP_00020713. 11 hypothetical protein [Chioroflexus aurantiacus] Length = 278 Best-BlastP =>> nrprot 58% Identities = 68/196 (34%), Positives = 117/196 (59%), Gaps = 2/196 (1%) refINP_767278. 1 Maf-like protein [Bradyrhizobium japonicum] dbjIBAC45903. 11 Maf-like protein [Bradyrhizobium japonicum USDA 110] Length = 202 Best-BlastP =>> nrprot 75% Identities = 254/407 (62%), Positives = 318/407 (78%), Gaps = 1/407 (0 %) reflZP_00079853. 1 l COG0148: Enolase [Geobacter metallireducens] Length = 429 Best-BlastP =>> nrprot 32% Identities = 41/123 (33%), Positives = 61/123 (49%), Gaps = 5/123 (4%) refINP_899813. 1 12-dehydro-3-deoxyphosphogluconate aldolase [Chromobacterium violaceum ATCC 12472] gbIAAQ57822. 1 l 2-dehydro-3-deoxyphosphogluconate aldolase [Chromobacterium violaceum ATCC 12472] Length = 208 Best-BlastP =>> nrprot 63% Identities = 64/119 (53%), Positives = 83/119 (69%) refINP_819436 . 1 lipoprotein signal peptidase [Coxiella burnetii RSA 493] gblAAO89950. 1 J lipoprotein signal peptidase [Coxiella burnetii RSA 493] Length = 163 2235. 2 Best-BlastP =>> nrprot 57% Identities = 220/636 (34%), Positives = 371/636 (58%), Gaps = 29/636 (4%) refINP_819137. Sulfatase domain protein [Coxiella burnetii RSA 493] gblAA089651. Sulfatase domain protein [Coxiella burnetii RSA 493] Length = 638 2239. 3,240. 2 conserved protein [Microbulbifer degradans 2- 40] Length = 155 2241. 2 Best-BlastP =>> nrprot 67% Identities = 51/105 (48%), Positives = 76/105 (72%) refJZP_00090593. COG0799: Uncharacterized homolog of plant lojap protein [Azotobacter vinelandii] Length = 117 2242. 1 Best-BlastP =>> nrprot 47% Identities = 46/187 (24%), Positives = 89/187 (47%), Gaps = 16/187 (8%) refINP_820065. 1 conserved hypothetical protein [Coxiella burnetii RSA 493] gbJAAO90579. 1 I conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 184 2244. 2 Best-BlastP =>> nrprot 77% Identities = 129/202 (63%), Positives = 156/202 (77%) gbJAAC33273. 1 J TnpR [Pseudomonas alkaligenes] Length = 309 2245. 2 Best-BlastP =>> nrprot 65% Identities = 178/331 (53%), Positives = 236/331 (71%), Gaps = 6/331 (1%) refINP_842305. 1 conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] embJCAD86220. 1 J conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] Length = 346 2247. 5 Best-BlastP =>> nrprot 61% Identities = 233/551 (42%), Positives = 342/551 (62%), Gaps = 4/551 (0%) refINP_359923. 1 J multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] pirIIF97735 hypothetical protein abcT3 [imported] Rickettsia conorii (strain Malish 7) gbJAAL02824. 1 J multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] Length = 589 2250. 2 Best-BlastP =>> nrprot No Hits found 2251. 3 Best-BlastP =>> nrprot No Hits found 223. 1 2230. 2231. 3 2232. 1 2233. 3 Best-BlastP =>> nrprot 45% Identities = 96/277 (34%), Positives = 149/277 (53%), Gaps = 40/277 (14%) EmbJCAA75849. 1 j hypothetical protein [Coxiella burnetii] Length = 309 Best-BlastP =>> nrprot 66% Identities = 75/155 (48%), Positives = 105/155 (67%) refJZP_00067293. 1 J COG1576: Uncharacterized 2252. 1 Best-BlastP =>> nrprot 83% Identities = 254/363 (69%), Positives = 303/363 (83%) refINP_231816. GTP-binding protein [Vibrio cholerae 01 biovar eltor str.  N16961] pirlID82107 GTP-binding protein VC2185 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF95330. 1 GTP-binding protein [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 383 2253. 2 Best-BlastP =>> nrprot 66% Identities = 96/181 (53%), Positives = 127/181 (70%) refINP_283782. 1 putative peptidyl-tRNA hydrolase [Neisseria meningitidis Z2491] spIQ9JV42IPTH_NEIMA Peptidyl-tRNA hydrolase (PTH) pir1IB81948 probable aminoacyl-tRNA hydrolase (EC 3. 1. 1.  29) NMA1004 [imported] - Neisseria meningitidis (strain Z2491 serogroup A) pack CAB84273. 1 putative peptidyl-tRNA hydrolase [Neisseria meningitidis Z2491] Length = 192 2255. 2 Best-BlastP =>> nrprot 67% Identities = 158/294 (53%), Positives = 199/294 (67%), Gaps = 4/294 (1%) refINP_461016. 11 ATP phosphoribosyltransferase [Salmonella typhimurium LT2] spIP00499IHIS1_SALTY ATP phosphoribosyltransferase pirIIXREBT ATP phosphoribosyltransferase (EC 2. 4. 2. 17) [validated] - Salmonella typhimurium embICAA31822. 1 j unnamed protein product [Salmonella typhimurium] gblAAA27142. 11 hisG gbIAAA88614. ATP phosphoribosyltransferase gblAAA80244. ATP phosphoribosyltransferase gblAAA80247. ATP phosphoribosyltransferase gbJAAA80249. 1 1 ATP phosphoribosyltransferase gbjAAA80252. ATP phosphoribosyltransferase gbIAAA80254. 11 ATP phosphoribosyltransferase gblAAA80257. ATP phosphoribosyltransferase gblAAA80259. ATP phosphoribosyltransferase gbIAAA80262. 11 ATP phosphoribosyltransferase gb! AAL20975. 11 ATP phosphoribosyltransferase [Salmonella typhimurium LT2] Length = 299 2258. 2 Best-BlastP =>> nrprot No Hits found 226. 4 Best-BlastP =>> nrprot No Hits found 2260. 2 Best-BlastP =>> nrprot 65% Identities = 115/209 (55%), Positives = 147/209 (70%), Gaps = 1/209 (0%) refJZP_00013996. 1 J COG2872: Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [Rhodospirillum rubrum] Length = 2261. 3 Best-BlastP =>> nrprot No Hits found 2264. 2 Best-BlastP =>> nrprot 59% Identities = 172/411 (41%), Positives = 247/411 (60%), Gaps = 6/411 (1%) refINP_773878. Blr7238 [Bradyrhizobium japonicum] dbjIBAC52503. 1 b1r7238 [Bradyrhizobium japonicum USDA 110] Length = 412 2266. 2 Best-BlastP =>> nrprot 76% Identities = 282/410 (68%), Positives = 322/410 (78%), Gaps = 1/410 (0%) refgP_00021755. 1 j hypothetical protein [Ralstonia metallidurans] Length = 412 2268. 2 Best-BlastP =>> nrprot 48% Identities = 131/405 (32%), Positives = 197/405 (48%), Gaps = 29/405 (7%) refINP_616925. I I conserved hypothetical protein [Methanosarcina acetivorans str.  C2A] gbIAAM05405. 1 J conserved hypothetical protein [Methanosarcina acetivorans str.  C2A] Length = 417 227. 2 Best-BlastP =>> nrprot 95% Identities = 281/303 (92%), Positives = 291/303 (96%) gbIAAM00625. 1 I unknown [Legionella pneumophila] Length = 303 2270. 2 Best-BlastP =>> nrprot 45% Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 22/120 (18%) gbIAAA89101. 1 J protein kinase Length = 379 2271. 1 Best-BlastP =>> nrprot 41% Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 4/57 (7%) refINP_012348. 1 Delays the onset of mitosis by phosphorylation and inactivation of the cyclin-dependent Cdc28 kinase, thus providing a better signal to the cell cycle.  S.  pombe weel + homolog; Swelp [Saccharomyces cerevisiae] spIP32944ISWE1_YEAST Mitosis inhibitor protein kinase SWE1 pirlIS40400 protein kinase SWE1 (EC 2. 7. 1. -) - yeast (Saccharomyces cerevisiae) embICAA52150. 1d SWE1 [Saccharomyces cerevisiae] embyCAA89482. SWE1 [Saccharomyces cerevisiae] Length = 8192272. 3 Best-BlastP =>> nrprot 61% Identities = 228/487 (46%), Positives = 308/487 (63%), Gaps = 8/487 (1%) refINP_744150. Amidophosphoribosyltransferase [Pseudomonas putida KT2440] gbIAAN67614. 1 IAE016391_5 amidophosphoribosyltransferase [Pseudomonas putida KT2440] Length = 501 2274. 2 Best-BlastP =>> nrprot 74% Identities = 194/313 (61%), Positives = 233/313 (74%), Gaps = 5/313 (1%) gblAAL85973. 1 putative phosphoribosyamidoimidazole-succinocarboxamide synthase [Arabidopsis thaliana] Length = 374 2275. 3 Best-BlastP =>> nrprot 34% Identities = 75/185 (40%), Positives = 107/185 (57%), Gaps = 19/185 (10%) refJNP_437235. [Sinorhizobium meliloti] pirj1G95928 hypothetical protein SMb21116 [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB emblCAC49095 1b putative protein, similar to the biosynthesis of peptide antibiotic trifolitoxin [Sinorhizobium meliloti]. 1 l putative protein, similar to gene related to biosynthesis of peptide antibiotic trifolitoxin [Sinorhizobium meliloti] Length = 243 2277. 2 Best-BlastP =>> nrprot 47% Identities = 27/55 (49%), Positives = 41/55 (74%), Gaps = 1/55 (1%) refINP_820051. 1 carbon storage regulator [Coxiella burnetii RSA 493] gblAAO90565. 1 carbon storage regulator [Coxiella burnetii RSA 493] Length = 70 2279. 2 Best-BlastP =>> nrprot No Hits found 228. 1 Best-BlastP =>> nrprot No Hits found 2282. 4 Best-BlastP =>> nrprot 98% Identities = 569/577 (98%), Positives = 571/577 (98%), Gaps = 1/577 (0%) spIP71481 IPRIM_LEGPN DNA primase gblAAB09542. 1 LpdnaG Length = 576 2289. 2 Best-BlastP =>> nrprot 50% Identities = 50/159 (31%), Positives = 81/159 (50%), Gaps = 13/159 (8%) refINP_718655. 1 j hypothetical protein [Shewanella oneidensis MR-1] gblAAN56099. 1AE015746_3 hypothetical protein [Shewanella oneidensis MR-1] Length = 197 2290. 1 Best-BlastP =>> nrprot 53% Identities = 106/293 (36%), Positives = 164/293 (55%), Gaps = 2/293 (0%) refINP_744181. 1 conserved hypothetical protein [Pseudomonas putida KT2440] gbjAAN67645. 1 jAE016394_6 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 318 2291. 2 Best-BlastP =>> nrprot 81% Identities = 208/316 (65%), Positives = 262/316 (82%), Gaps = 1/316 (0%) refIZP_00067583. 1 I COG0714: MoxR-like ATPases [Microbulbifer degradans 2-40] Length = 321 2292. 2 Best-BlastP =>> nrprot 28% Identities = 81/371 (21%), Positives = 158/371 (42%), Gaps = 34/371 (9%) prefer! 12210342A myosin: SUBUNIT = heavy chain Length = 2241 2293. 5 Best-BlastP =>> nrprot 14% Identities = 74/228 (32%), Positives = 119/228 (52%), Gaps = 19/228 (8%) refINP_844638. Preserved hypothetical protein [Bacillus anthracis str.  Ames] gblAAP26124. 11 conserved hypothetical protein [Bacillus anthracis str.  Ames] Length = 324 2295. 3 Best-BlastP =>> nrprot 72% Identities = 93/152 (61%), Positives = 113/152 (74%) refINP_249699. Bacterioferritin comigratory protein [Pseudomonas aeruginosa PA01] pirjIA83520 bacterioferritin comigratory protein PA1008 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG04397. 11AE004533_8 bacterioferritin comigratory protein [Pseudomonas aeruginosa PAOI] Length = 157 Best-BlastP =>> nrprot 79% Identifies = 98/156 (62%), Positives = 125/156 (80%), Gaps = 3/156 (1%) refINP_311509. 1 I small protein B [Escherichia coli O157: H7] refINP 417110. 11 small protein B [Escherichia coli K12] refINP_708467. 1 small protein B [Shigella flexneri 2a str.  301] refINP_755024. 1 l SsrA-binding protein [Escherichia coli CFT073] refINP_838189. 1 ssrA (tmRNA) binding protein [Shigella flexneri 2a str.  2457T] splP32052ISSRP_ECOLI SsrA- binding protein (Small Protein B) pirllJS0701 small protein B, smpB - Escherichia coli (strain K-12) pirlIB91064 small protein B [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) dbjjBAA02062. 1J small protein [Escherichia coli] gblAAA79790. 11 smpB gene product gblAAC75669. 11 small protein B [Escherichia coli K12] dbjIBAB36905. 1I small protein B [Escherichia coli O157: H7] gbjAAN44174. 1 JAE015283_5 small protein B [Shigella flexneri 2a str.  301] gblAAN81592.  11AE016764_274 SsrA-binding protein [Escherichia coli CFT073] gbjAAP17999.  11 ssrA (tmRNA) binding protein [Shigella flexneri 2a str.  2457T] Length = Best-BlastP =>> nrprot 16% Identities = 40/142 (28%), Positives = 73/142 (51%), Gaps = 8/142 (5%) refINP_038716. 11 t-complex-associated testis expressed 1 [Mus musculus] pir1IA45841 T-complex-associated-test-expressed-1 protein-mouse gbIAAA40406. 1 Tcte-1 Peptide Length = 506 2299. 3 Best-BlastP =>> nrprot 37% Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 5/88 (5%) refINP_819930. 1 l conserved domain protein [Coxiella burnetii RSA 493] gblAAO90444. Preserved domain protein [Coxiella burnetii RSA 493] Length = 169,2301. 2 Best-BlastP =>> nrprot 70% Identities = 397/715 (55%), Positives = 512/715 (71%), Gaps = 4/715 (0%) refINP_820090. 1 R ribonuclease R [Coxiella burnetii RSA 493] gblAAO90604. R ribonuclease [Coxiella burnetii RSA 493] Length = 736 2302. 2 Best-BlastP =>> nrprot 72% Identifies = 64/108 (59%), Positives = 81/108 (75%) refINP_355166. 1 l AGR_C_4014p [Agrobacterium tumefaciens] refINP_532881. 11 chaperone secretion [Agrobacterium tumefaciens str.  C58 (U.  Washington)] pirlIF97624 csaa protein [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pirIlAG2847 chaperone secretion [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gblAAK87951. 1 I AGR_C_4014p [Agrobacterium tumefaciens str.  C58 (Cereon)] gbJAAL43197. 1 l chaperone secretion [Agrobacterium tumefaciens str.  C58 (U.  Washington)] Length = 113 2308. 2 Best-BlastP =>> nrprot No Hits found 2309. 2 Best-BlastP =>> nrprot 45% Identities = 104/406 (25%), Positives = 173/406 (42%), Gaps = 63/406 (15%) spIQ9MYU4IENPI_PIG Ectonucleoside triphosphate diphosphohydrolase 1 (NTPDase1) (Ecotoxic ATP diphosphohydrolase) (ATPDase) (Lymphoid cell activation antigen) (Eco-apyrase) (CD39 antigen) embICAB95871. ATP-diphosphohydrolase [Sus scrofa] Length = 510 2311. 4 Best-BlastP =>> nrprot 75% Identities = 490/868 (56%), Positives = 648/868 (74%), Gaps = 13/868 (1%) refINP_928561. Alanyl-tRNA synthetase (alanine-tRNA ligase) [Photorhabdus luminescens subsp.  laumondii TTOI] embicE13544. Alanyl-tRNA synthetase (alanine-tRNA ligase) [Photorhabdus luminescens subsp.  laumondii TTO1] Length = 876 2312. 1 Best-BlastP =>> nrprot No Hits found 2297. 2298. 2313. 2 Best-BlastP =>> nrprot 19% Identities = 40/156 (25%), Positives = 78/156 (50%), Gaps = 13/156 (8%) refINP_614055. 1 j Uncharacterized protein [Methanopyrus kandleri AV19] gbIAAM01985. Uncharacterized protein [Methanopyrus kandleri AV19] Length = 609 2315. 3 Best-BlastP =>> nrprot 56% Identities = 93/262 (35%), Positives = 149/262 (56%), Gaps = 2/262 (0%) refIZP_00108734. 1 I COG0596: Predicted hydrolases or.  acyltransferases (alpha / beta hydrolase superfamily) [Nostoc punctiform] Length = 270 2317. 2 Best-BlastP =>> nrprot 71% Identities = 266/484 (54%), Positives = 351/484 (72%), Gaps = 1/484 (0%) refINP_390984. Glycine betaine aldehyde dehydrogenase [Bacillus subtilis] spIP71016IDHAB_BACSU Betaine aldehyde dehydrogenase (BADH) pirIIA69629 glycine betaine aldehyde dehydrogenase gbsA - Bacillus subtilis gblAAC44364. 11 GbsA embJCAB15084. Glycine betaine aldehyde dehydrogenase [Bacillus subtilis subsp.  subtilis str.  168] Length = 490 2319. 3 Best-BlastP =>> nrprot 72% Identities = 263/462 (56%), Positives = 331/462 (71%), Gaps = 6/462 (1%) refINP_638201. 1 L-serine dehydratase [Xanthomonas campestris pv.  campestris str.  ATCC 33913] gbIAAM42125. Lysine dehydratase [Xanthomonas campestris pv.  campestris str.  ATCC 33913] Length = 460 2320. 3 Best-BlastP =>> nrprot 50% Identities = 163/400 (40%), Positives = 243/400 (60%), Gaps = 17/400 (4%) refINP865739. Alginate oacetyltransferase algl [Pirellula sp. ] embICAD73424. Alginate o-acetyltransferase algl [Pirellula sp. ] Length = 470 2321. 3 Best-BlastP =>> nrprot 65% Identities = 90/172 (52%), Positives = 120/172 (69%) refINP884513. I putative chromate reductase [Bordetella parapertussis] refINP_888264. 1 putative chromate reductase [Bordetella bronchiseptica] embICAE32216. 1 putative chromate reductase [Bordetella bronchiseptica] embICAE37565. 1 putative chromate reductase [Bordetella parapertussis] Length = 184 2322. 2 Best-BlastP =>> nrprot 65% Identities 113/231 (48%), Positives = 152/231 (65%), Gaps = 3/231 (1%) refINP820714. I conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91228. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 2323. 2 Best-BlastP =>> nrprot 34% Identities = 47/220 (21%), Positives = 91/220 (41%), Gaps = 16/220 (7%) refINP_902123. 11 hypothetical protein CV2453 [Chromobacterium violaceum ATCC 12472] gbIAAQ60124. 11 hypothetical protein CV2453 [Chromobacterium violaceum ATCC 12472] Length = 258 2324. 4 Best-BlastP =>> nrprot No Hits found 2328. 2 Best-BlastP =>> nrprot 61% Identities = 376/865 (43%), Positives = 527/865 (60%), Gaps = 23/865 (2%) refINP278639. Diaminopimelate decarboxylase; aspartate kinase [Xylella fastidiosa Temeculal] gbJAAO28288. Diaminopimelate decarboxylase; Aspartate kinase [Xylella fastidiosa Temeculal] Length = 868 2330. 2 Best-BlastP =>> nrprot 72% Identities = 380/665 (57%), Positives = 488/665 (73%), Gaps = 1/665 (0%) refINP_246655. 1 1 Lig [Pasteurella multocida] gblAAK03800. 1 I Lig [Pasteurella multocida] Length = 673 2333. 3 Best-BlastP =>> nrprot 70% Identities = 381/700 (54%), Positives = 501/700 (71%), Gaps = 10/700 (1%) refINP_841209. Bacterial extracellular solute-binding protein, family [Nitrosomonas europaea ATCC 19718] embjCAD85063. Bacterial extracellular solute-binding protein, family [Nitrosomonas europaea ATCC 19718] Length = 746 2335. 2 Best-BlastP =>> nrprot No Hits found 2336. 2 Best-BlastP =>> nrprot 70% Identifies = 353/672 (52%), Positives = 479/672 (71%), Gaps = 4/672 (0%) refINP_796449. 11 oligopeptidase A [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC58333. 11 oligopeptidase A [Vibrio parahaemolyticus] Length = 680 Best-BlastP =>> nrprot 76% Identities = 135/215 (62%), Positives = 170/215 (79%) gblΔAK20881. 11AF334761 2 cell division ATP-binding protein [Aeromonas hydrophila] Length = 222 Best-BlastP =>> nrprot 74% Identities = 210/345 (60%), Positives = 264/345 (76%), Gaps = 6/345 ( 1%) refIZP_00126801. COG0552: Signal recognition particle GTPase [Pseudomonas syringae pv.  syringae B728a] Length = 505 Best-BlastP =>> nrprot 99% Identities = 731/736 (99%), Positives = 734/736 (99%) gbIAAM00624. 1 putative copper efflux ATPase [Legionella pneumophila] Length = 736 Best-BlastP =>> nrprot 33% Identities = 67/259 (25%), Positives = 108/259 (41%), Gaps = 34/259 (13% ) refINP_359656. 1 cell surface antigen [Rickettsia conorii] pir1IC97702 cell antigen surface [imported] - Rickettsia conorii (strain Malish 7) gbJAAL02557. 11 cell antigen surface [Rickettsia conorii] Length 1902 2344. 4 Best-BlastP =>> nrprot 56% Identities = 270/726 (37%), Positives = 405/726 (55%), Gaps = 16/726 (2%) refIZP_00043557. COG2114: Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Magnetococcus sp.  MC-1] Length = 734 2345. 2 Best-BlastP =>> nrprot No Hits found 2346. 1 Best-BlastP =>> nrprot No Hits found 2347. 2 Best-BlastP =>> nrprot No Hits found 235. 2 Best-BlastP =>> nrprot 50% Identities = 145/450 (32%), Positives = 218/450 (48%), Gaps = 60/450 (13%) spIP42042IAMYG_ARXAD Glucoamylase precursor (Glucan 1,4-alpha- glucosidase) (1,4-alpha-D-gucan glucohydrolase) emblCAA86997. Precursor glucoamylase [Arxula adeninivorans] Length = 624 2350. 2 Best-BlastP =>> nrprot No Hits found 2351. 2 Best-BlastP =>> nrprot 59% Identities = 114/258 (44%), Positives = 164/258 (63%) refgP_00122702. COG1043: Acyl- [acyl carrier protein] - UDP-N-acetylglucosamine O-acyltransferase [Haemophilus somnus 129PT] Length = 262 2352. 2 Best-BlastP =>> nrprot 66% Identities = 160/338 (47%), Positives = 229/338 (67%) refIZP_00052962. COG1044: UDP-3-O- [3-hydroxymyristoyl] glucosamine N-acyltransferase [Magnetospirillum magnetotacticum] Length = 339 2353. 3 Best-BlastP =>> nrprot 65% Identities = 174/375 (46%), Positives = 251/375 (66%), Gaps = 3/375 (0%) REFINP 252333. Lipid A-disaccharide synthase [Pseudomonas aeruginosa PA01] spIQ9HXY8ILPXB_PSEAE Lipid-Adisaccharide synthase pirIIC83190 lipid A-disaccharide synthase PA3643 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG07031. 11AE004784 4 Iipid A-disaccharide synthase [Pseudomonas aeruginosa PAOI] Length = 378 2354. 2 Best-BlastP =>> nrprot 23% Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 2/92 (2%) dbjIBAC97056. 1 I RTX (repeat in toxin) cytotoxin [Vibrio vulnificus YJ016] Length = 5206 2355. 2 Best-BlastP =>> nrprot 45% Identities = 83/256 (32%), Positives = 134/256 (52%), Gaps = 18/256 (7%) refINP_832533. Probable shortchain type dehydrogenase / reductase vd! C [Bacillus cereus ATCC 14579] gbIAAP09734. 1 Probable short chain dehydrogenase / reductase type vdlC [Bacillus cereus ATCC 14579] Length = 281 2337. 2339. 4,234. 2343. 2356. 2 Best-BlastP =>> nrprot 65% Identities = 106/213 (49%), Positives = 141/213 (66%), Gaps = 2/213 (0%) refJZP_00138632. COG0259: Pyridoxamine phosphate oxidase [Pseudomonas aeruginosa UCBPP-PA14] Length = 215 2357. 4 Best-BlastP =>> nrprot 6% Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%) refINP_752812. 1 Putative conserved protein [Escherichia coli CFT073] gblAAN79355. 1AE016757_259 Putative conserved protein [Escherichia coli CFT073] Length = 101 2358. 3 Best-BlastP =>> nrprot 73% Identities = 272/470 (57%), Positives = 346/470 (73%), Gaps = 3/470 (0%) refJZP_00082833. COG0773: UDPN-acetylmuramate-alanine ligase [Pseudomonas fluorescens PfO-1] Length = 486,236. 1 Best-BlastP =>> nrprot No Hits found 2360. 2 Best-BlastP =>> nrprot 52% Identities = 115/337 (34%), Positives = 189/337 (56%), Gaps = 40/337 (11%) refINP_486436. 1 J unknown protein [Nostoc sp.  PCC 7120] pirlIAE2105 hypothetical protein a112396 [imported] - Nostoc sp.  (strain PCC 7120) dbjIBAB74095. ORF_ID: aII2396 - unknown protein [Nostoc sp.  PCC 7120] Length = 454 2361. 4 Best-BlastP =>> nrprot 21% Identities = 193/1010 (19%), Positives = 405/1010 (40%), Gaps = 174/1010 (17%) pir11T14867 interaptin-siime mold (Dictyostelium discoideum) gbIAAC34582. 11 interaptin [Dictyostelium discoideum] Length = 1738 2362. 3 Best-BlastP =>> nrprot 99% Identities = 302/303 (99%), Positives = 303/303 (100%) gblAAC38180. 1 J DotC [Legionella pneumophila] Length = 303 2364. 1 Best-BlastP =>> nrprot 99% Identities = 376/377 (99%), Positives = 377/377 (100%) gblAAC38181. 1 DotB [Legionella pneumophila] Length = 377 2365. 2 Best-BlastP =>> nrprot 52% Identities = 197/528 (37%), Positives = 302/528 (57%), Gaps = 37/528 (7%) refINP_658139. Nucleotidase, 5'E nucleotidase, catalytic domain [Bacillus anthracis A2012] refINP 846555. 1f 5'-nucleotidase family protein [Bacillus anthracis str.  Ames] gbIAAP28041. 11 5'-nucleotidase family protein [Bacillus anthracis str.  Souls] Length = 529 2367. 2 Best-BlastP =>> nrprot No Hits found 2368. 5 Best-BlastP =>> nrprot 46% Identities = 147/450 (32%), Positives = 228/450 (50%), Gaps = 15/450 (3%) refINP_821551. 1 putative acyl-CoA synthetase, long-chain fatty acid: CoA ligase [Streptomyces avermitilis MA-4680] dbjlBAC68086. 1 putative acyl-CoA synthetase, long-chain fatty acid: CoA ligase [Streptomyces avermitilis MA-4680] Length = 495 2369. 3 Best-BlastP =>> nrprot 54% Identities = 71/194 (36%), Positives = 111/194 (57%), Gaps = 1/194 (0%) refINP_743077. 1 I carry, LysE family [Pseudomonas putida KT2440] gblAAN66541. 1 jAE016282_9 carry, LysE family [Pseudomonas putida KT2440] Length = 204 2371. 1 Best-BlastP =>> nrprot 51% Identities = 118/343 (34%), Positives = 175/343 (51%), Gaps = 17/343 (4%) refINP_360212. 1 capM protein [Rickettsia conorii] pirlIG97771 capM protein [imported] Rickettsia conorii (strain Malish 7) gbIAAL03113. 1 capM protein [Rickettsia conorii] Length = 338 2372. 3 Best-BlastP =>> nrprot 66% Identities = 53/118 (44%), Positives = 79/118 (66%) ref! ZP_00111665. COG2146: Ferredoxin subunits of nitrite reductase and ring hydroxylating dioxygenases [Nostoc punctiform] Length = 119 2373. 2 Best-BlastP =>> nrprot 73% Identities = 185/309 (59%), Positives = 235/309 (76%), Gaps = 2/309 (0%) refINP_819938. 1 I lytic murein transglycosylase, putative [Coxiella burnetii RSA 493] gblAAO90452. 1 l lytic murein transglycosylase, putative [Coxiella burnetii RSA 493] Length = 333 2374. 2 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 75% Identities = 115/187 (61%), Positives = 144/187 (77%), Gaps = 2/187 (1%) refIZP_00091537 . 1 J COG0164: Ribonuclease HII [Azotobacter vinelandii] Length = 236 Best-BlastP =>> nrprot 73% Identities = 181/309 (58%), Positives = 236/309 (76%) refINP_819651. 11 oxidoreductase family protein [Coxiella burnetii RSA 493] gbJAAO90165. 11 oxidoreductase family protein [Coxiella burnetii RSA 493] Length = 327 Best-BlastP =>> nrprot 57% Identities = 185/432 (42%), Positives = 272/432 (62%), Gaps = 10/432 (2%) ) refINP_391464. 1 to metabolite transport protein [Bacillus subtilis] pir11E70070 metabolite transport protein homolog ywtG - Bacillus subtilis embICAB07473. 1 ywtG [Bacillus subtilis] embICAB15600. 1 J ywtG [Bacillus subtilis subsp.  subtilis str.  168] Length = 457 Best-BlastP =>> nrprot 58% Identities = 148/381 (38%), Positives = 225/381 (59%), Gaps = 2/381 (0%) ref (ZP_00079875. 1! COG0763: Lipid A disaccharide synthetase [Geobacter metallireducens] Length = 400 2382. 2 Best-BlastP =>> nrprot 54% Identities = 39/79 (49%), Positives = 54/79 (68%) reflNP_716031. DNA-binding protein Fis [Shewanella oneidensis MR-1] gb1AAN53476. 1jAE015487_10 Fis-DNA-binding protein [Shewanella oneidensis MR-1] Length = 101 2383. 4 Best-BlastP =>> nrprot 37% Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 2/45 (4%) gblAAQ17065. 1! nucleolin 3 [Cyprinus carpio] gbjAAQ55855. 11 nucleolin [Cyprinus carpio] Length = 637 2387. 3 Best-BlastP =>> nrprot 55% Identities = 130/320 (40%), Positives = 187/320 (58%), Gaps = 4/320 (1%) reflNP_768143. Quinone oxidoreductase [Bradyrhizobium japonicum] dbjIBAC46768. Quinone oxidoreductase [Bradyrhizobium japonicum USDA 110] Length = 332 2388. 3 Best-BlastP =>> nrprot 72% Identities = 147/280 (52%), Positives = 212/280 (75%) reflZP_00021514. COG1175: ABC-type sugar transport systems, permease components [Ralstonia metallidurans] Length = 293 239. 1 Best-BlastP =>> nrprot 65% Identities = 106/203 (52%), Positives = 145/203 (71%) refINP_718073. 1 12-dehydro-3-deoxyphosphogluconate aldolase / 4hydroxy-2-oxoglutarate aldolase [Shewanella oneidensis MR-1] gblAAN55517.  1 1EE015690_5 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [Shewanella oneidensis MR-1] Length = 213 2391. 2 Best-BlastP =>> nrprot No Hits found 2392. 2 Best-BlastP =>> nrprot No Hits found 2395. 3 Best-BlastP =>> nrprot 63% Identities = 174/360 (48%), Positives = 236/360 (65%), Gaps = 1/360 (0%) refJNP_819557. Phosphoserine aminotransferase [Coxiella burnetii RSA 493] gblAA090071. Phosphoserine aminotransferase [Coxiella burnetii RSA 493] Length = 360 24. 1 Best-BlastP =>> nrprot 23% Identities = 65/242 (26%), Positives = 117/242 (48%), Gaps = 20/242 (8%) reflZP_00096911. COG1738: Uncharacterized preserved protein [Novosphingobium aromaticivorans] Length = 243,240. 1 Best-BlastP =>> nrprot 57% Identities = 144/316 (45%), Positives = 194/316 (61%), Gaps = 1/316 (0%) refINP_928703. Glucokinase (Glucose kinase) [Photorhabdus luminescens subsp.  laumondii TTO1] embicE13698. Glucokinase (Glucose kinase) [Photorhabdus luminescens subsp.  laumondii TTO1] Length = 321 2375. 2377. 2,238. 1 2381. 2,400. 2 Best-BlastP =>> nrprot 76% Identities = 181/285 (63%), Positives = 226/285 (79%), Gaps = 4/285 (1%) refINP248803.  1 I probable cytochrome c oxidase assembly factor [Pseudomonas aeruginosa PA01] refzZP_00140528. COG0109: Polyprenyltransferase (cytochrome oxidase assembly factor) [Pseudomonas aeruginosa UCBPP-PA14] pirlIF83632 probable cytochrome c oxidase assembly factor PA0113 [imported] Pseudomonas aeruginosa (strain PAO1) gbjAAG03503. 1 1EE004449_12 probable cytochrome c oxidase assembly factor [Pseudomonas aeruginosa PAOI] Length = 304 2401. 2 Best-BlastP =>> nrprot 44% Identities = 57/167 (34%), Positives = 96/167 (57%), Gaps = 5/167 (2%) refiZP_00065551. COG1999: Uncharacterized protein SCOI / SenC / PrrC, involved in biogenesis of respiratory and photosynthetic systems [Microbulbifer degradans 2-40] Length = 219 2402. 3 Best-BlastP =>> nrprot 81% Identities = 316/450 (70%), Positives = 370/450 (82%), Gaps = 5/450 (1%) refINP_819057. 11 chromosomal replication initiator DnaA protein [Coxiella burnetii RSA 493] gblAAO89571. 11 chromosomal replication DnaA initiator protein [Coxiella burnetii RSA 493] Length = 451 2404. 2 Best-BlastP =>> nrprot 67% Identities = 145/366 (39%), Positives = 247/366 (67%), Gaps = 2/366 (0%) refJNP_796391. 11 DNA polymerase III, beta chain [Vibrio parahaemolyticus RIMD 2210633] dbj1BAC58275. 1 DNA polymerase III, beta chain [Vibrio parahaemolyticus] Length = 366 2406. 3 Best-BlastP =>> nrprot 57% Identities = 133/360 (36%), Positives = 205/360 (56%), Gaps = 12/360 (3%) refINP_759959. 1 Recombinational DNA repair ATPase [Vibrio vulnificus CMCP6] spIQ8DDJI IRECF VIBVU DNA replication and repair protein recF gbJAAO09486. 1 Recombinational DNA repair ATPase [Vibrio vulnificus CMCP6] Length = 359 2407. 3 Best-BlastP =>> nrprot 67% Identities = 370/794 (46%), Positives = 536/794 (67%), Gaps = 5/794 (0%) refINP_820311. 11 phenylalanyl-tRNA synthetase, beta subunit [Coxiella burnetii RSA 493] gb1AAO90825. Phenylalanyl-tRNA synthetase, beta subunit [Coxiella burnetii RSA 493] Length = 792,2409. 3 Best-BlastP =>> nrprot 100% Identities = 233/234 (99%), Positives = 234/234 (100%) embICAD42890. 1 l macrophage infectivity potentiator [Legionella pneumophila serogroup 8] Length = 236 241. 2 Best-BlastP =>> nrprot 76% Identities = 386/608 (63%), Positives = 470/608 (77%) refINP_718074. 1 6-phosphogluconate dehydratase [Shewanella oneidensis MR-1] gblAAN55518. 11AE0156906 6-phosphogluconate dehydratase [Shewanella oneidensis MR-1] Length = 6082410. 2 Best-BlastP =>> nrprot 56% Identities = 157/390 (40%), Positives = 240/390 (61%), Gaps = 7/390 (1%) refINP668353. 1 J ampG protein [Yersinia pestis KIM] gbIAAM84604. 11AE013705_7 ampG protein [Yersinia pestis KIM] Length = 5102412. 2 Best-BlastP =>> nrprot 62% Identities = 245/553 (44%), Positives = 350/553 (63%), Gaps = 5/553 (0%) refINP_719011. DNA repair protein RecN [Shewanella oneidensis MR-1] gblAAN56455. 11AE015782_7 RecN DNA repair protein [Shewanella oneidensis MR-1] Length = 2413. 1 Best-BlastP =>> nrprot 73% Identities = 46/67 (68%), Positives = 51/67 (76%), Gaps = 1/67 (1%) refJZP_00065318. COG1278: Cold shock proteins [Microbulbifer degradans 2-40] Length = 69 2414. 2 Best-BlastP =>> nrprot 46% Identities = 86/333 (25%), Positives = 166/333 (49%), Gaps = 15/333 (4%) refINP_819780. 1 efflux transport, RND family, subunit MFP [Coxiella burnetii RSA 493] gbIAAO90294. 1 efflux transport, RND family, subunit MFP [Coxiella burnetii RSA 493] Length = 348 Best-BlastP =>> nrprot 37% Identities = 69/273 (25%), Positives = 121/273 (44%), Gaps = 25/273 (9%) refJZP_00087134. COG2162: Arylamine N-acetyltransferase [Pseudomonas fluorescens PfO-1] Length = 292 Best-BlastP =>> nrprot 63% Identities = 106/234 (45%), Positives = 154/234 (65%) refINP_821026. 1 protein membrane, putative [Coxiella burnetii RSA 493] gbjAAO91540. 11 protein membrane, putative [Coxiella burnetii RSA 493] Length = 237 Best-BlastP =>> nrprot 48% Identities = 74/222 (33%), Positives = 110/222 (49%), Gaps = 10/222 (4 %) refINP626575. 1 putative dipeptidase [Streptomyces coelicolor A3 (2)] embICAB93448. 1 putative dipeptidase [Streptomyces coelicolor A3 (2)] Length = 218 2421. 2 Best-BlastP =>> nrprot 68% Identities = 266/502 (52%), Positives = 345/502 (68%), Gaps = 12/502 (2%) refINP_639214. 1 competence related protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] gblAAM43105. 11 competence related protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] Length = 506 2422. 3 Best-BlastP =>> nrprot 49% Identities = 31/123 (25%), Positives = 64/123 (52%), Gaps = 3/123 (2%) refINP_703938. 1 16-pyruvoyl tetrahydropterin synthase, putative [Plasmodium falciparum 3D7] embICAD50550. 1 1 6-pyruvoyl tetrahydropterin synthase, putative [Plasmodium falciparum 3D7] Length = 173 2423. 2 Best-BlastP =>> nrprot 63% Identities = 163/360 (45%), Positives = 237/360 (65%), Gaps = 3/360 (0%) refINP_820807. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91321. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 388 2424. 3 Best-BlastP =>> nrprot 63% Identities = 92/176 (52%), Positives = 120/176 (68%), Gaps = 1/176 (0%) refINP_407270. 1 J putative membrane protein [Yersinia pestis] pirIIAF0465 probable membrane protein YPO3822 [imported] - Yersinia pestis (strain CO92) emblCAC93290. Putative membrane protein [Yersinia pestis 0092] Length = 222 2425. 2 Best-BlastP =>> nrprot 51% Identities = 72/187 (38%), Positives = 110/187 (58%), Gaps = 1/187 (0%) refINP_419508. [Caulobacter crescentus gbIAAK22676] [Caulobacter crescentus CB15] pirlIH87334 conserved hypothetical protein [Caulobacter crescentus gbIAAK22676]. I conserved hypothetical protein [Caulobacter crescentus CB15] Length = 208 2426. 2 Best-BlastP =>> nrprot No Nits found 2427. 4 Best-BlastP =>> nrprot 61% Identities = 37/65 (56%), Positives = 44/65 (67%) refIZP_00091135. COG2852: Uncharacterized protein stored in bacteria [Azotobacter vinelandii] Length = 150 2428. 2 Best-BlastP =>> nrprot 58% Identities = 36/85 (42%), Positives = 55/85 (64%), Gaps = 7/85 (8%) refINP_681031. ORF_ID: tIIO240-putative transposase [Thermosynechococcus elongatus BP-1] refINP681232. 11 0RF_ID: t110442 - putative transposase [Thermosynechococcus elongatus BP-1] refINP_681335. 1I ORF_ID: t110545 putative transposase [Thermosynechococcus elongatus BP-1] refINP_681541. 1 1 ORF_ID: tlr0752-- putative transposase [Thermosynechococcus elongatus BP-1] refINP_681563.  11 ORF_ID: tlr0774 putative transposase [Thermosynechococcus elongatus BP-1] refINP_681789. 11 0RF_ID: tlr0999 putative transposase [Thermosynechococcus elongatus BP-1] refINP_682035. 1I ORF_ID: tl11245-- putative transposase [Thermosynechococcus elongatus BP-1] refINP682721. 11 ORF_ID: tlr1931 putative transposase [Thermosynechococcus elongatus BP-1] dbjIBAC07793. 1I ORF_ID: t110240 - putative transposase [Thermosynechococcus elongatus BP-1] dbjIBAC07994. 11 ORF_ID: t110442 putative transposase [Thermosynechococcus elongatus BP-1] dbj! BAC08097. 11 ORF_ID: tII0545 - putative transposase [Thermosynechococcus elongatus BP-1] dbjIBAC08303. II ORI 2415. 2418. 2 2419. 3 2429. 2 Best-BlastP =>> nrprot 69% Identities = 159/294 (54%), Positives = 211/294 (71%), Gaps = 1/294 (0%) refINP292069. MoxR protein, putative [Pseudomonas syringae pv.  tomato str.  DC3000] gbiAA055764. 1 moxR protein, putative [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 305 243. 2 Best-BlastP =>> nrprot 67% Identities = 163/295 (55%), Positives = 210/295 (71%), Gaps = 1/295 (0%) dbjlBAC95199. 11 putative adenine-specific methylase [Vibrio vulnificus YJ016] Length = 310 2430. 2 Best-BlastP =>> nrprot 63% Identities = 172/365 (47%), Positives = 229/365 (62%), Gaps = 12/365 (3%) refINP840708. Domain DUF59 [Nitrosomonas europaea ATCC 19718] emblCAD84535. 1 Domain of unknown function DUF59 [Nitrosomonas europaea ATCC 19718] Length = 361 2432. 2 Best-BlastP =>> nrprot 70% Identities = 233/378 (61%), Positives = 292/378 (77%) reflNP_719320. 1 I ATP-dependent RNA helicase, DEAD family box [Shewanella oneidensis MR-1] gbjAAN56764. 11AE015812_3 ATP- dependent RNA helicase, DEAD family box [Shewanella oneidensis MR-1] Length = 535 2434. 2 Best-BlastP =>> nrprot 70% Identities = 184/388 (47%), Positives = 270/388 (69%), Gaps = 8/388 (2%) refINP_903067. 1 probable stearoyl-CoA 9-desaturase [Chromobacterium violaceum ATCC 12472] gbIAAQ61061. Probably stearoyl-CoA 9-desaturase [Chromobacterium violaceum ATCC 12472] Length = 405 2436. 2 Best-BlastP =>> nrprot No Hits found 2438. 2 Best-BlastP =>> nrprot 79% Identities = 59/92 (64%), Positives = 75/92 (81%) gblAAL59720. 1 I unknown [Vibrio cholerae] Length = 92 Best-BlastP =>> nrprot 86% Identities = 81/107 (75%), Positives = 93/107 (86%), Gaps = 1/107 (0%) gbIAAL59719. 1 day unknown [Vibrio cholerae] Length = 107 Best-BlastP =>> nrprot 80% Identities = 230/350 (65%), Positive = 285/350 (81%) dbjIBAC95198. 11 chorismate synthase [Vibrio vulnificus YJ016] Length = 377 Best-BlastP =>> nrprot 51% Identities = 134/398 (33%), Positives = 209/398 (52%), Gaps = 16/398 (4%) refINP_779202 . I phage-related integrase [Xylella fastidiosa Temeculal] gbIAA028851. 11 phage-related integrase [Xylella fastidiosa Temeculal] Length = 410 2442. 2 Best-BlastP =>> nrprot 36% Identities = 93/315 (29%), Positives = 158/315 (50%), Gaps = 21/315 (6%) refINP_435846. 1 Probable adenylate cyclase [Sinorhizobium meliloti] pir1IH95336 probable adenylate cyclase (EC 4. 6. 1. 1) [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymA gblAAK65258. Likely adenylate cyclase [Sinorhizobium meliloti] Length = 584 2443. 2 Best-BlastP =>> nrprot 36% Identities = 55/232 (23%), Positives = 100/232 (43%), Gaps = 10/232 (4%) refIZP_00068000. 1 I hypothetical protein [Microbulbifer degradans 2-40] Length = 260 2445. 4 Best-BlastP =>> nrprot 79% Identities = 635/925 (68%), Positives = 746/925 (80%), Gaps = 6/925 (0%) refINP_820536. 1 ribonucleosidediphosphate reductase, alpha subunit [Coxiella burnetii RSA 493] gbIAAO91050. 11 ribonucleoside diphosphate reductase, alpha subunit [Coxiella burnetii RSA 493] Length = 941 2447. 3 Best-BlastP =>> nrprot 19% Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 6/121 (4%) refINP_599246. 1! PASS1 [Rattus norvegicus] gblAAD48846. PASS1 [Rattus norvegicus] Length = 428 2439 1 IAF168362_1 protein binding with small stress protein. 2,244. 1 2441. 2 Best-BlastP =>> nrprot 54% Identities = 94/226 (41%), Positives = 142/226 (62%), Gaps = 8/226 (3%) reflNP_821052. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAA091566. 11 = conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 268 Best-BlastP =>> nrprot 97% Identities = 331/340 (97%), Positive = 332/340 (97%) splO31219IDHAS_LEGPN Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) gblAAC46292. Aspartate-B-semialdehyde dehydrogenase [Legionella pneumophila] Length = 347 Best-BlastP =>> nrprot 67% Identities = 299/616 (48%), Positives = 409/616 (66%), Gaps = 24/616 (3%) %) ref1NP_842471. 1 l ATPase component ABC-type dipeptide / oligopeptide / nickel transport system [Nitrosomonas europaea ATCC 19718] emblCAD86392. 1 l ATPase component ABC-type dipeptide / oligopeptide / nickel transport system [Nitrosomonas europaea ATCC 19718] Length = Best-BlastP =>> nrprot 75% Identities = 554/897 (61%), Positives = 689/897 (76%) , Gaps = 3/897 (0%) refJZP_00096570. COG0474: ATPase transport cation [Novosphingobium aromaticivorans] Length = 911 Best-BlastP =>> nrprot 78% Identities = 201/314 (64%), Positives = 251/314 (79%) refINP_820493. 1 I acetyl-CoA carboxylase, carboxyl transferase, alpha subunit [Coxiella burnetii RSA 493] gbIAAO91007. 1 J acetyl-CoA carboxylase, carboxyl transferase, alpha subunit [Coxiella burnetii RSA 493] Length = 316 Best-BlastP =>> nrprot 46% Identities = 75/215 (34%), Positives = 114/215 (53%), Gaps = 16/215 (7%) ReflZP_00107102. COG2091: Phosphopantetheinyl transferase [Nostoc punctiform] Length = 239 Best-BlastP =>> nrprot 68% Identities = 190/371 (51%), Positives = 259/371 (69%) reflNP_819627. 1-oxygen-independent coproporphyrinogen III oxidase, putative [Coxiella burnetii RSA 493] gblAAO90141. 11 oxygen-independent coproporphyrinogen III oxidase, putative [Coxiella burnetii RSA 493] Length = 375 Best-BlastP =>> nrprot 69% Identities = 94/176 (53%), Positives = 131/176 (74%), Gaps = 1 / 176 (0%) refINP_715832. MutT / nudix family protein [Shewanella oneidensis MR-1] gblAAN53277. 11AE015469_1 MutT / nudixfamily protein [Shewanella oneidensis MR-1] Length = 1832460. 3 Best-BlastP =>> nrprot 62% Identities = 230/569 (40%), Positives = 358/569 (62%), Gaps = 12/569 (2%) reflNP_820129. 1 I oligopeptide

  transport, OPT family [Coxiella burnetii RSA 493] gbjAAO90643.1 I oligopeptide transporter, OPT family [Coxiella burnetii RSA 493] Length = 669 2461.2 Best-BlastP =>> nrprot 57% Identities = 33/49 (67%), Positives = 41/49 (83%) reffNP_051689.1 I integrase / recombinase XerD, putative [Deinococcus radiodurans] pirl G75636 probable integrase / recombinase XerD - Deinococcus radiodurans (strain R1) gblAAF12667.1 IAE001827_5 integrase / recombinase XerD, putative [Deinococcus radiodurans] Length = 236 2462.2 Best-BlastP =>> nrprot 33% Identities = 20/38 (52%), Positives = 25/38 (65%) reflZP_00111545.11 COG4644: Transposase and inactivated derivatives, TnpA family [Nostoc punctiform] Length = 1014 2464.2 BestBlastP =>> nrprot 67% Identities = 61/108 (56%), Positives = 80/108 (74%) ReflNP_841625.1 I transposase [Nitrosomonas europaea ATCC 19718] refINP_842205.1 I transposase [Nitrosomonas europaea ATCC 19718] refINP_842439 .1 I transposase [Nitrosomonas europaea ATCC 19718] embICAD85497.1 I transposed ase [Nitrosomonas europaea ATCC 19718] emblCAD86112.1 I transposase [Nitrosomonas europaea ATCC 19718]. ## EQU1 ## ### , Gaps = 49/879 (5%) refINP_819380.1 aminopeptidase N [Coxiella burnetii RSA 493] gblAAO89894.1 I aminopeptidase N [Coxiella burnetii RSA 493] Length = 878 Best-BlastP =>> nrprot 39% dentities = 76 / 253 (30%), Positives = 122/253 (48%), Gaps = 18/253 (7%) refINP634577.1 putative hydrolase [Methanosarcina mazei Goel] gblAAM32249.11 putative hydrolase [Methanosarcina mazei Goel] Length = 279 Best -BlastP =>> nrprot 44% Identities = 138/423 (32%), Positives = 216/423 (51%), Gaps = 7/423 (1%) refINP298657.1 I conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC60541. 11 = conserved hypothetical protein [Vibrio parahaemolyticus] Length = 483 Best-BlastP =>> nrprot 29% Identities = 49/120 (40%), Positive = 76/120 (63%) COG2840: Uncharacterized protein conserved in bacteria [Microbulbifer degradans 2-40] Length = 190 Best-BlastP =>> nrprot 55% Identities = 129/344 (37%), Positives = 199/344 (57%), Gaps = 6/344 (1%) refINP_819673. Riboflavin biosynthesis protein RibD [Coxiella burnetii RSA 493] gbIAAO90187.1 riboflavin biosynthesis protein RibD [Coxiella burnetii RSA 493] Length = 354 Best-BlastP =>> nrprot 610/0 Identities = 87/219 (39%), Positive = 131/219 (59%), Gaps = 12/219 (5%) refINP_820010.1 dethiobiotin synthetase [Coxiella burnetii RSA 493] gbIAAO90524.1 I dethiobiotin synthetase [Coxiella burnetii RSA 493] Length = 242 Best-BlastP =>> nrprot 54% Identities = 35/70 (50%), Positives = 48/70 (68%), Gaps = 3/70 (4%) refINP_820541.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbiAAO91055.1 I conserved hypotheti cal protein [Coxiella burnetii RSA 493] Length = 91 Best-BlastP =>> nrprot 72% dentities = 105/192 (54%), Positives = 152/192 (79%), Gaps = 2/192 (1%) refINP_820542 .1 j conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91056.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 209 2477.1 Best-BlastP =>> nrprot 52% Identities = 68/115 (59%), Positives = 85 / 115 (73%), Gaps = 2/115 (1%) refINP_819994.11 rare lipoprotein A family protein [Coxiella burnetii RSA 493] gblAAO90508.1 I rare lipoprotein A family protein [Coxiella burnetii RSA 493] Length = 261 2479.2 Best -BlastP =>> nrprot No Hits found 248.2 Best-BlastP =>> nrprot 59% dentities = 191/456 (41%), Positives = 278/456 (60%), Gaps = 7/456 (1%) refINP_820284. 1 ankyrin repeat domain protein [Coxiella burnetii RSA 493] gblAAO90798.1 I ankyrin repeat domain protein [Coxiella burnetii RSA 493] Length = 465 Best-BlastP =>> nrprot 77% Identities = 185/291 (63%), Positives = 231/291 (79%), Gaps = 1/291 (0%) ref I putative phosphonomutase 2 [Escherichia coli O157: H7 EDL933] refINP_308412.1 I putative phosphonomutase 2 [Escherichia coli O157: H7] pir11A90677 probable phosphonomutase 2 [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) pir1ID85527 probable phosphonomutase 2 [imported] Escherichia coli (strain O157: H7, substrain EDL933) gbIAAG54680.11AE005212_5 putative phosphonomutase 2 [Escherichia coli O157: H7 EDL933] dbjIBAB33808.1 I putative phosphonomutase 2 [Escherichia coli O157: H7] Length = 296 Best- BlastP =>> nrprot 59% Identities = 75/125 (60%), Positives = 101/125 (80%) refINP_820989.1 t conserved domain protein [Coxiella burnetii RSA 493] gblAAO91503.11 conserved domain protein [Coxiella burnetii RSA 493 ] Length = 127 2466.3 2468.2 2469.2 247.2 2471.3 2472.2 2473.1 2474.1 2481.4 2482.1 2483.2 Best-BlastP =>> nrprot No Hits found 2485.3 Best-BlastP =>> nrprot No Hits found 2486.3 Best-BlastP =>> nrprot 55% Identities = 188 / 514 (36%), Positives = 280/514 (5 4%), Gaps = 43/514 (8%) refIZP_00087809.1! COG2202: FOG: PAS / PAC domain [Pseudomonas fluorescens PfO-1] Length = 757 2488.2 Best-BlastP =>> nrprot No Hits found 2489.2 Best-BlastP =>> nrprot No Hits found 249.4 Best-BlastP =>> nrprot 97% Identities = 558/575 (97%), Positives = 562/575 (97%), Gaps = 1/575 (0%) gblAAC12716.11 pilus assembly protein PUB [Legionella pneumophila] Length = 575 2490.2 Best-BlastP =>> nrprot No Hits found 2492.2 Best-BlastP =>> nrprot No Hits found 2493.2 Best-BlastP =>> nrprot 67% Identities = 99/203 (48%), Positives = 135/203 (66%), Gaps = 10/203 (4%) refInP_929371.1 Holliday junction DNA helicase [Photorhabdus luminescens subsp. laumondii TTO1] emblCAE14404.1 Holliday junction DNA helicase [Photorhabdus luminescens subsp. laumondii TTO1] Length = 205 2495.2 Best-BlastP =>> nrprot 69% Identities = 93/170 (54%), Positives = 121/170 (71%), Gaps = 1/170 (0%) refINP_231481.1 I crossover RuvC endodeoxyribonuclease junction [Vibrio cholerae 01 biovar eltor str. Crossover junction RuvC endovoxyribonuclease Crossover junction RuvC endovolecycluclease ruvC Crossover junction RuvC endovenoxyribonuclease ruvC Crossover junction endodeoxyribonuclease RuvC VC1847 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF94995.1 crossover junction RuvC endodeoxyribonuclease [Vibrio cholerae 01 biovar eltor str . N16961] Length = 173 25.1 Best-BlastP =>> nrprot 46% Identities = 46/124 (37%), Positives = 72/124 (58%), Gaps = 3/124 (2%) refINP 488674.11 Probable cytosine deaminase [ Nostoc sp. PCC 7120] pirIIAB2385 hypothetical protein a1r4634 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB76333.1 j ORF_ID: alr4634 probable cytosine deaminase [Nostoc sp. PCC 7120] Length = 140 250.1 Best-BlastP =>> nrprot 98% Identities = 398/406 (98%), Positive = 400/406 (98%) gblAAC12717.11 pilus assembly protein PiIC [Legionella pneumophila] Length = 406 2501.2 Best-BlastP =>> nrprot 70% Identities = 213/412 (51%), Positives = 294/412 (71%), Gaps = 12/412 (2%) refINP_819142.1 l tolB protein [Coxiella burnetii RSA 493] spIQ83F59ITOLB_COXBU ToIB protein precursor gblAAO89656.11 tolB protein [Coxiella burnetii RSA 493] Length = 437 2504.4 Best-BlastP =>> nrprot 51% Identities = 106/301 (35%), Positives = 164/301 (54%), Gaps = 34/301 (11%) refINP_718333.1 I tolA protein [Shewanella oneidensis MR-1] gbIAAN55777.11AE015714_4 tolA protein [Shewanella oneidensis MR-1] Length = 345 2506.2 2508.3 Hydrogenase ripening factor [Ralstonia metallidurans] Length = 380 2509.3 Best- BlastP =>> nrprot No Hits found 251.2 Best-BlastP =>> nrprot 97% Identities = 277/287 (96%), Positives = 281/287 (97%) spIO68433ILEP4_LEGPN Type 4 prepilin-like proteins leader peptide proce szyme enzyme [Includes: Leader peptidase (Prepilin peptidase); N-methyltransferase] gblAAC12718.1 I type IV prepilin-like protein specific leader peptidase PiID [Legionella pneumophila] Length = 287 Best-BlastP =>> nrprot 83% Identities = 238/338 (70%), Positives = 282/338 ( 83%) gblAAN87043.1 I HypE [Thiocapsa roseopersicina] Length = 360 Identities = 234/375 (62%), Positives = 285/375 (76%), Gaps = 6/375 (1%) refJZP_00021585.1 I COG0409: Best-BlastP =>> nrprot 77% 2510.2 2514.2 2517.2 2518.4 252.2 2520.4 2521.4 2522.1 2523.1 2524.2 2526.3 2528.3 2530.3 Best-BlastP =>> nrprot 69% Identities = 310/637 (48%), Positives = 427/637 (67%) , Gaps = 19/637 (2%) COG0488: ATPase components of ABC transporters with duplicated ATPase domains [Microbulbifer degradans 2-40] Length = 637 Best-BlastP =>> nrprot 74% Identities = 52/84 ( 61%), Positives = 67/84 (79%), Gaps = 2/84 (2%) refIZP_00128272.1! COG0851: Septum formation topological specificity factor [Pseudomonas syringae pv. syringae B728a] Length = 84 Best-BlastP =>> nrprot 65% Identities = 197/336 (58%), Positives = 240/336 (71%), Gaps = 2/336 (0%) refINP634897.1 1 L- sorbosone dehydrogenase [Methanosarcina mazei Geel] gbIAAM32569.11 L-sorbosone dehydrogenase [Methanosarcina mazei Goel] Length = 381 Best-BlastP =>> nrprot 86% Identities = 123/179 (68%), Positives = 156/179 (87%) GTP cyclohydrolase I precursor [Pseudomonas aeruginosa PA01] spIQ9I351IGC12_PSEAE GTP cyclohydrolase 12 (GTP-CH-I 2) pirIIC83435 GTP cyclohydrolase I precursor PA1674 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG05063.11AE004595_2 GTP cyclohydrolase I precursor [Pseudomonas aeruginosa PAO1] Length = 181 Best-BlastP =>> nrprot 40% Identities = 86/303 (28%), Positives = 161/303 (53%), Gaps = 13/303 (4%) refINP_819235.1 l CAAX amino terminal protease family protein [Coxiella burnetii RSA 493] gbIAAO89749.11 CAAX amino terminal protease family protein [Coxiella burnetii RSA 493] Length = 297 Best-BlastP =>> n rprot 73% Identities = 64/111 (57%), Positives = 84/111 (75%), Gaps = 1/111 (0%) refINP_819816.1 I HIT family protein [Coxiella burnetii RSA 493] gbIAAO90330.11 HIT family protein [Coxiella burnetii RSA 493] Length = 113 Best-BlastP =>> nrprot 71% Identities = 205/348 (58%), Positives = 251/348 (72%), Gaps = 1/348 (0%) refIdI_00028857. COG1064: Zndependent alcohol dehydrogenases [Burkholderia fungorum] Length = 377 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 54% Identities = 46/128 (35%), Positives = 73/128 (57% ) refIZP_00011417.11 hypothetical protein [Rhodopseudomonas palustris] Length = 135 Best-BlastP =>> nrprot 51% Identities = 71/192 (36%), Positive = 105/192 (54%), Gaps = 7/192 (3%) ) spIQ92JI7! DEF2_RICCN Peptide Deformylase 2 (PDF 2) (Deformylase Polypeptide 2) Length = 202 Best-BlastP =>> nrprot 13% Identities = 40/132 (30%), Positives = 59/132 (44%), Gaps = 16/132 (12%) refINP_440029.1 acetylpolyamine aminohydolase [Synechocystis sp. PCC 6803] spIP72702IY245_SYNY3 Hypothetical protein s1r0245 pirIIS74557 acetylpolyamine aminohydrolase - Synechocystis sp. (strain PCC 6803) dbjIBAA16709.1 acetylpolyamine aminohydolase [Synechocystis sp. PCC 6803] Length = 304 Best-BlastP =>> nrprot 41% Identities = 53/236 (22%), Positives = 105/236 (44%), Gaps = 7/236 (2%) refINP 845027.11 acetyltransferase, GNAT family [Bacillus anthracis str. Ames] gbIAAP26513. 11 acetyltransferase, GNAT family [Bacillus anthracis str. Ames] Length = 266 Best-BlastP =>> nrprot 63% Identities = 266/626 (42%), Positives = 401/626 (64%), Gaps = 8/626 (1%) refINP_900243.1 Potassium uptake protein [ Chromobacterium violaceum ATCC 12472] gbIAAQ58249.1 potassium uptake protein [Chromobacterium violaceum ATCC 12472] Length = 621 2533.3 BestBlastP =>> nrprot 52% Identities = 88/286 (30%), Positives = 158/286 (55%), Gaps Back Transcriptional regulator [Vibrio visinificus CMCP6] Length = 307 Best-BlastP =>> nrprot 70% Identities = 200/351 (56%) = 4/286 (1%) refINP_763522.1 Transcriptional regulator [Vibrio vulnificus CMCP6] gblAAO08512.1 lAE016813_264 ), Positive = 253/351 (72%) refINP_519918.1 l PROBABLE PYRUVATE DEHYDROGENASE COMPONENT (ALPHA SUBUNIT) OXIDOREDUCTASE PROTEIN [Ralstonia solanacearum] EmbICAD15499.11 PROBABLE PYRUVATE DEHYDROGENASE COMPONENT (ALPHA SUBUNIT) OXIDOREDUCTASE PROTEIN [Ralstonia solanacearum] Length = 363 Best-BlastP =>> nrprot 57% Identities = 180/451 (39%), Positives = 255/451 (56%), Gaps = 36/451 (7) % I paraaminobenzoate synthase, component 1 [Vibrio parahaemolyticus RIMD 2210633] dbjJBAC60138.1 I para-aminobenzoate synthase, component I [Vibrio parahaemolyticus] Length = 454 Best-BlastP =>> nrprot 78% Identities = 245/394 (%) 62%), Positive = 309/394 (78%) refINP_901758.11 acetyl-CoA C-acetyltransferase [Chromobacterium violaceum ATCC 12472] gblAAQ59760.1 l acetyl-CoA C-acetyltransferase [Chromobacterium violaceum ATCC 12472] Length = 394 254.2 Best- BlastP =>> nrprot 49% Identities = 275/851 (32%), Positives = 428/851 (50%), Gaps = 29/851 (3%) refINP_490573.1 I ATP-binding protein [Salmonella typhimurium LT2] gblAAL23492 .1 conjugative transfer: [Salmonella typhimurium LT2] assembly Length = 882 2542.2 Best-BlastP =>> nrprot 61% Identities = 214/405 (52%), Positives = 282/405 (69%), Gaps = 8/405 (1%) COG0260: Leucyl aminopeptidase [Rhodospirillum rubrum] Length = 444 2544.3 Best-BlastP =>> nrprot 5% Identities = 36/130 (27%), Positive = 68/130 (52%) ), Gaps = 7/130 (5%) ref. Iin Membrane Efflux Protein [Leptospira interrogans serovar lai str. 56601] gblAAN48299.1 IAE011292_12 outer membrane efflux protein [Leptospira interrogans serovar lai str. 56601] Length = 533 2545.2 Best-BlastP =>> nrprot No Hits found 2546.4 Best-BlastP =>> nrprot 47% Identities = 155/432 (35%), Positives = 239/432 (55%), Gaps = 21 / 432 (4%) emblCAE02834.1 l OSJNBa0043Al2.39 [Oryza sativa (japonica cultivar-group)] Length = 487 2549.3 Best-BlastP =>> nrprot No Hits found 255.1 Best-BlastP =>> nrprot 39% Identities = 23 / 83 (27%), Positives = 44/83 (53%), Gaps = 1/83 (1%) refINP_762592.1 I Unknown [Vibrio vulnificus CMCP6] gbIAAO07582.1 IAE016810_85 Unknown [Vibrio vuinificus CMCP6] Length = 114 2550.2 Best -BlastP =>> nrprot 99% Identities = 443/449 (98%), Positives = 446/449 (99%) gblAAB52239.1 nucleotide binding protein Flil [Legionella pneumophila] Length = 449 2551.2 Best-BlastP =>> nrprot 34% Identities = 74/75 (98%), Positive = 74/75 (98%) gbjAAB52238.1 I FIH [Legionella pneumophila] Length = 75 2553.3 Best-BlastP =>> nrprot 76% Identities = 168/326 (51%) %), Positives = 251/326 (76%) refINP_791782.1 flagellar motor switch protein FIiG [Pseudomonas syrin gae pv. tomato str. DC3000] gbIAAO55477.1 I flagellar motor switch protein FIiG [Pseudomonas syringae pv.

  tomato str.  DC3000] Length = 333 2555. 5 Best-BlastP =>> nrprot No Hits found 2535. 2 2536. 2 2538. 2 Best-BlastP =>> nrprot 61% Identities = 70/135 (51%), Positives = 91/135 (67%) reflZP_00085924. 11 hypothetical protein [Pseudomonas fluorescens PfO-1] Length = 141 Best-BlastP =>> nrprot 85% Identities = 243/333 (72%), Positives = 289/333 (86%) refINP_438478. Holliday junction DNA helicase [Haemophilus influenzas Rd] sp1P44631 11 Holliday junction DNA helicase (ruvB) [Haemophilus influenzae Rd] Length 256. 1 Best-BlastP =>> nrprot 52% Identities = 79/194 (40%), Positives = 109/194 (56%), Gaps = 14/194 (7%) refINP_762593. 1 I Conserved hypothetical protein [Vibrio vuinificus CMCP6] gbjAA007583. 11AE016810_86 Conserved hypothetical protein [Vibrio vulnificus CMCP6] Length = 226 2560. 3 Best-BlastP =>> nrprot 98% Identities = 186/187 (99%), Positives = 186/187 (99%) gbJAAQ18125. 1 I RpoE [Legionella pneumophila] Length = 187 2562. 2 Best-BlastP =>> nrprot No Hits found 2565. 4 Best-BlastP =>> nrprot 55% Identities = 88/226 (38%), Positives = 129/226 (57%), Gaps = 17/226 (7%) refINP_651138. 1 I CG6763-PA [Drosophila melanogaster] gbIAAF56122. 1I CG6763-PA [Drosophila melanogaster] gblAAL68281. 11 RE28575p [Drosophila melanogaster] Length = 354 2567. 2 Best-BlastP =>> nrprot 42% Identities = 53/201 (26%), Positives = 92/201 (45%), Gaps = 3/201 (1%) refINP_683243. ORF_ID: tII2454-unknown protein [Thermosynechococcus elongatus BP-1] dbjlBAC10005. ORF_ID: tII2454 unknown protein [Thermosynechococcus elongatus BP-1] Length = 253 2568. 1 Best-BlastP =>> nrprot No Hits found 2569. 3 Best-BlastP =>> nrprot 56% Identities = 80/207 (38%), Positives = 122/207 (58%), Gaps = 18/207 (8%) refINP840655. I conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] embICAD84482. 1 l conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] Length = 253 2570. 2 Best-BlastP =>> nrprot 64% Identities = 144/374 (38%), Positives = 243/374 (64%), Gaps = 4/374 (1%) refINP_518286. 1 d PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] embiCAD13693. 1! PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 381 2571. 2 Best-BlastP =>> nrprot 64% Identities = 135/292 (46%), Positives = 199/292 (68%), Gaps = 3/292 (1%) refJZP_00056519. 11 COG1131: ABC-type multidrug transport system, ATPase component [Magnetospirillum magnetotacticum] Length = 308 2573. 3 Best-BlastP =>> nrprot 98% Identities = 188/192 (97%), Positives = 190/192 (98%) gblAAK00281. 11AF288536_3 unknown [Legionella longbeachae] Length = 192 2576. 2 Best-BlastP =>> nrprot 99% Identities = 319/319 (100%), Positives = 319/319 (100%) gbIAAM00641. 11 putative Na / Ca antiporter [Legionella pneumophila] Length = 319 2578. 2 Best-BlastP =>> nrprot 99% Identities = 234/234 (100%), Positives = 234/234 (100%) gbIAAM00640. 1 I unknown [Legionella pneumophila] Length = 234 2557. 4,2599. 3 2579. 2 Best-BlastP =>> nrprot 62% Identities = 54/135 (40%), Positives = 89/135 (65%) refINP_903458. 1 I conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbjAAQ61450. 11 = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 159 Best-BlastP =>> nrprot 56% Identities = 161/309 (52%), Positives = 213/309 (68%), Gaps = 4/309 (1% ) gbJAAM90716. 11 TraU [Salmonella typhi] Length = 331 Best-BlastP =>> nrprot 78% Identities = 155/249 (62%), Positives = 198/249 (79%) refJZP_00133889. 1 COG2226: Methylase involved in ubiquinone / menaquinone biosynthesis [Actinobacillus pleuropneumoniae serovar 1 str.  4074] Length = 258 Best-BlastP =>> nrprot 47% Identities = 242/883 (27%), Positives = 412/883 (46%), Gaps = 56/883 (6%) refINP_842182. 1 j conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] emblCAD86089. 11 conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] Length = 909 2583. 3 Best-BlastP =>> nrprot 38% Identities = 40/156 (25%), Positives = 72/156 (46%), Gaps = 23/156 (14%) refINP_764254. 1 Na + / H + antiporter-like protein [Staphylococcus epidermidis ATCC 12228] gblAAO04296. 1AE016746_86 Na + / H + antiporter-like protein [Staphylococcus epidermidis ATCC 12228] Length = 614 2585. 2 Best-BlastP =>> nrprot 13% Identifies = 45/193 (23%), Positives = 77/193 (39%), Gaps = 30/193 (15%) refINP_866179. Hypothesis protein transmembrane region and signal peptide prediction [Pirellula sp. ] emblCAD73865. I hypothetical protein-transmembrane region and signal peptide prediction [Pirellula sp. ] Length = 500 Best-BlastP =>> nrprot 59% Identities = 114/283 (40%), Positives = 169/283 (59%), Gaps = 4/283 (1%) ref1ZP_00094776. 1 day COG0583: Transcriptional regulator [Novosphingobium aromaticivorans] Length = 290 3/288 (1%) refIDP_00096382.  11 COG0121: Best-BlastP =>> nrprot 60% Identities = 125/288 (43%), Positives = 184/288 (63%), Gaps = Predicted glutamine amidotransferase [Novosphingobium aromaticivorans] Length = 444 Best-BlastP =>> nrprot 66% Identities = 182/348 (52%), Positives = 234/348 (67%), Gaps = 2/348 (0%) refINP 233382. 1 NADH-dependent flavin oxidoreductase, Oye family [Vibrio cholerae 01 biovar eltor str.  N16961] pir11H82391 NADH-dependent flavin oxidoreductase, Oye family VCA0998 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF96894. NADH-dependent flavin oxidoreductase, Oye family [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 347 2592. 4 Best-BlastP =>> nrprot No Hits found 2593. 3 Best-BlastP =>> nrprot 62% Identities = 98/248 (39%), Positives = 161/248 (64%), Gaps = 7/248 (2%) refINP_250139. FIELD [Pseudomonas aeruginosa PA0I] pir1IB83465 flagellar biosynthetic protein FIELD PA1448 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG04837. 11AE004574_8 flagellar biosynthetic protein FIiR [Pseudomonas aeruginosa PAO1] Length = 258 Best-BlastP =>> nrprot 77% Identities = 142/241 (58%), Positives = 193/241 (80%), Gaps = 1/241 (0% ) refINP_746469. 1 flagellar biosynthetic protein FliP [Pseudomonas putida KT2440] gbIAAD01927. 21 FliP [Pseudomonas putida] gblAAN69933. 1 IAE016632 4 flagellar biosynthetic protein FliP [Pseudomonas putida KT2440] Length = 251 Best-BlastP =>> nrprot 99% Identities = 225/226 (99%), Positives = 226/226 (100%) gblAAM00392. 1 JAF386079_2 CcmB [Legionella pneumophila] Length = 226258. 2 2580. 2 2582. 3 2587. 2 2590. 3 2591. 3 2595. 2597. 4 2598. 3 Best-BlastP =>> nrprot 59% Identities = 76/216 (35%), Positives = 130/216 (60%), Gaps = 6/216 (2%) refINP_799389. 1 I conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61273. 1 conserved hypothetical protein [Vibrio parahaemolyticus] Length = 219 2599. 4 Best-BlastP =>> nrprot 82% Identities = 380/556 (68%), Positives = 461/556 (82%), Gaps = 2/556 (0%) refINP_927905. ATP-binding protein YjjK [Photorhabdus luminescens subsp.  Iaumondii TTOI] embICAE12850. ATP-binding protein YjjK [Photorhabdus luminescens subsp.  Iaumondii TTO1] Length = 555 26. 1 Best-BlastP =>> nrprot 30% Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 6/132 (4%) refIiz_00031525. 1 l hypothetical protein [Burkholderia fungorum] Length = 153 2600. 4 Best-BlastP =>> nrprot 84% Identities = 239/341 (70%), Positives = 287/341 (84%) refINP_931999. 1 threonine 3-dehydrogenase [Photorhabdus luminescens subsp.  Iaumondii TTO1] embICAE17217. 11 threonine 3-dehydrogenase [Photorhabdus luminescens subsp.  Iaumondii TTOI] Length = 341 2602. 2 Best-BlastP =>> nrprot 63% Identities = 144/273 (52%), Positives = 188/273 (68%), Gaps = 2/273 (0%) refIZP_00067856. COG0061: Predicted sugar kinase [Microbulbifer degradans 2-40] Length = 294 2604. 3 Best-BlastP =>> nrprot 83% Identities = 437/603 (72%), Positives = 511/603 (84%) refIZP_00043195. COG1217: Predicted GTPase membrane involved in stress response [Magnetococcus sp.  MC-1] Length = 611,2605. 3 Best-BlastP =>> nrprot 53% Identities = 300/814 (36%), Positives = 445/814 (54%), Gaps = 23/814 (2%) refINP_111982. 11 Type III restriction-modification enzyme, helicase subunit [Thermoplasma volcano] dbjJBAB60631. 1l TVG1539639 [Thermoplasma Volcano] Length = 843,2607. 2 Best-BlastP =>> nrprot 34% Identities = 87/295 (29%), Positives = 141/295 (47%), Gaps = 10/295 (3%) refINP_827021. 1 l hypothetical protein [Streptomyces avermitilis MA-4680] dbjIBAC73556. 1 I hypothetical protein [Streptomyces avermitilis MA-4680] Length = 416 2609. 2 Best-BlastP =>> nrprot No Hits found 2611. 1 Best-BlastP =>> nrprot No Hits found 2616. 1 Best-BlastP =>> nrprot 35% Identities = 58/180 (32%), Positives = 106/180 (58%), Gaps 1/180 (0%) refINP_624053. 1 I predicted transposase [Thermoanaerobacter tengcongensis] gbIAAM25657. Predicted transposase [Thermoanaerobacter tengcongensis] Length = 267 2619. 1 Best-BlastP =>> nrprot 40% Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 39/137 (28%) embICAB46580. 1 181400 transposase B [Yersinia enterocoiitica] Length = 294,262. 3 Best-BlastP =>> nrprot 41% Identities = 123/341 (36%), Positives = 184/341 (53%), Gaps = 21/341 (6%) refINP_827217. I putative quinolinate synthetase [Streptomyces avermitilis MA-4680] dbjIBAC73752. 1 putative quinolinate synthetase [Streptomyces avermitilis MA-4680] Length = 414 2620. 1 Best-BlastP =>> nrprot 91% Identities = 65/88 (73%), Positives = 81/88 (92%) refINP_395197. 1 J putative ORFA transposase [Yersinia pestis C092] refJNP_857719. 1 J low calcium response locus protein S homolog [Yersinia pestis KIM] ref! NP 857914. 1 putative IS element protein [Yersinia pestis KIM] spIQ00931 1LCRS YERPE Low calcium response locus protein S likely pirj1T43562 IS element protein - Yersinia pestis plasmid pCD1 gblAAA27655. 1 JIcrS gbJAAC62579. 11 low calcium response locus protein S homolog [Yersinia pestis KIM] gbJAAC69827. 11 putative IS element protein [Yersinia pestis KIM] emblCAB54940. 1I putative transposase ORFA [Yersinia pestis] Length = 88 2622. 1 Best-BlastP =>> nrprot 58% Identities = 267/639 (41%), Positives = 378/639 (59%), Gaps = 54/639 (8%) refJNP_111983. 1 d Adenine specific DNA methylase (Mod-related) [Thermoplasma volcano] dbjlBAB60632. Methylase modification [Thermoplasma volumium] Length = 616 2624. 1 Best-BlastP =>> nrprot 38% Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 20/156 (12%) ref! ZP_00023112. 1 J hypothetical protein [Ralstonia metallidurans] Length = 348 2625. 2 Best-BlastP =>> nrprot 58% Identities = 129/264 (48%), Positives = 170/264 (64%), Gaps = 2/264 (0%) gbjAAM08235. 1 J LvrA [Legionella pneumophila] Length = 289 2626. 1 Best-BlastP =>> nrprot 56% Identities = 80/221 (36%), Positives = 124/221 (56%), Gaps = 16/221 (7%) gbIAAM08234. 1 putative phage repressor [Legionella pneumophila] Length = 227 2627. 1 Best-BlastP =>> nrprot 79% Identities = 300/397 (75%), Positives = 334/397 (84%), Gaps = 5/397 (1%) gbJAAB05678. 1 I HeIB Length = 400,263. 1 Best-BlastP =>> nrprot 61% Identities = 259/528 (49%), Positives = 339/528 (64%), Gaps = 12/528 (2%) refINP_903600. 1 L-Aspartate oxidase [Chromobacterium violaceum ATCC 12472] gbjAAQ61592. 11 L-aspartate oxidase [Chromobacterium violaceum ATCC 12472] Length = 529 2631. 4 Best-BlastP =>> nrprot 94% Identities = 875/974 (89%), Positives = 928/974 (95%) sp1Q488151HELA LEGPN Protein helA gbJAAB05679. 1 HeIA Length = 1052 2637. 1 Best-BlastP =>> nrprot No Hits found 2639. 1 Best-BlastP =>> nrprot 53% Identities = 52/149 (34%), Positives = 80/149 (53%), Gaps = 14/149 (9%) reflNP_747492. 1 l hypothetical protein [Pseudomonas putida KT2440] gbIAAN70956. 11AE016739_9 hypothetical protein [Pseudomonas putida KT2440] Length = 193,264. 2 Best-BlastP =>> nrprot 72% Identities = 264/457 (57%), Positives = 333/457 (72%), Gaps = 1/457 (0%) refJZP_00066450. COG0015: Adenylosuccinate lyase [Microbulbifer degradans 2-40] Length = 459 2643. 1 Best-BlastP =>> nrprot 44% Identities = 119/434 (27%), Positives = 193/434 (44%), Gaps = 26/434 (5%) reflNP 564271. 1 expressed protein [Arabidopsis thaliana] gbIAAF79860. 11A0000348_13 T7N9. 21 [Arabidopsis thaliana] Length = 468 2644. 1 Best-BlastP =>> nrprot No Hits found 2645. 1 Best-BlastP =>> nrprot 24% Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 12/135 (8%) refIZP_00014821. 1 J hypothetical protein [Rhodospirillum rubrum] Length = 149 2646. 1 Best-BlastP =>> nrprot 49% Identities = 45/117 (38%), Positives = 63/117 (53%), Gaps = 1/117 (0%) refINP_386943. 1I CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] EmbICAC47416. 1 PRESERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 253 2647. 2 Best-BlastP =>> nrprot 72% Identities = 102/185 (55%), Positives = 138/185 (74%), Gaps = 1/185 (0%) reflNP_621791. 3-Methyladenine DNA glycosylase [Thermoanaerobacter tengcongensis] gblAAM23395. 11 3Methyladenine DNA glycosylase [Thermoanaerobacter tengcongensis] Length = 188 2648. 2 Best-BlastP =>> nrprot 40% Identities = 98/337 (29%), Positives = 148/337 (43%), Gaps = 67/337 (19%) pir1jA42596 major outer membrane protein - Legionella pneumophila gbIAAA25300. 11 major outer membrane protein Length = 297 2649. 1 Best-BlastP =>> nrprot 45% Identities = 99/375 (26%), Positives = 182/375 (48%), Gaps = 2/375 (0%) ref! ZP_00026377. COG0475: Kef-type K + transport systems, membrane components [Ralstonia metallidurans] Length = 406 2650. 1 Best-BlastP =>> nrprot 64% Identities = 199/424 (46%), Positives = 284/424 (66%), Gaps = 14/424 (3%) refJZP_00031775. COG1253: Hemolysins and related proteins containing CBS domains [Burkholderia fungorum] Length = 427 2652. 2 Best-BlastP =>> nrprot 46% Identities = 119/354 (33%), Positives = 193/354 (54%), Gaps = 6/354 (1%) gbJAAM00606. 1 I unknown [Legionella pneumophila] Length = 421 2653. 1 Best-BlastP =>> nrprot No Hits found 2654. 1 Best-BlastP =>> nrprot No Hits found 2655. 1 Best-BlastP =>> nrprot 50% Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 6/105 (5%) dbjJBAC93400. 1 J conserved hypothetical protein [Vibrio vulnificus YJ016] Length = 142 2657. 3 Best-BlastP =>> nrprot 61% Identities = 324/677 (47%), Positives = 455/677 (67%), Gaps = 12/677 (1%) refIZP_00054877. 1! COG0204: 1-acyl-snglycerol-3-phosphate acyltransferase [Magnetospirillum magnetotacticum] Length = 1158 2659. 2 Best-BlastP =>> nrprot 32% Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 12/116 (10%) refJNP_052947. 1 prepropilin [Plasmid R100] spJP14494jPIL5_ECOLI FIMBRIAL PROTEIN PRECURSOR (PILIN) pirIJYQECRI fimbrial protein precursor - Escherichia coli plasmid R100-1 gbJAAA92754. 1 J pilin dbjJBAA78851. 1 j prepropilin [Plasmid R100] Length = 1192660. 1 Best-BlastP =>> nrprot 42% Identities = 24/86 (27%), Positive = 41/86 (47%) spJP12058! TRAL_SALTI TRAL PROTEIN pir11C25161 traL protein Salmonella typhimurium plasmid pED208 gbJAAA25608. 1 J TraL protein [Plasmid pED208] gbJAAM90704. 1 l TraL [Salmonella typhi] Length = 101 2661. 2 Best-BlastP =>> nrprot 45% Identities = 44/183 (24%), Positives = 85/183 (46%) refJNP_932206. 1 putative conjugative transfer protein TraE [Vibrio vulnificus YJ016] dbjJBAC97729. 1 putative conjugative transfer protein TraE [Vibrio vulnificus YJ016] Length = 200 2662. 2 Best-BlastP = >> nrprot 45% Identities = 72/242 (29%), Positives = 109/242 (45%), Gaps = 19/242 (7%) refJNP_762587. 11 Unknown [Vibrio vulnificus CMCP6] gbJAAO07577. 1 JAE016810_80 Unknown [Vibrio vulnificus CMCP6] Length = 247 2665. 1 Best-BlastP =>> nrprot No Hits found 2666. 1 Best-BlastP =>> nrprot No Hits found 2667. 1 Best-BlastP =>> nrprot No Hits found 2669. 2 Best-BlastP =>> nrprot 20% Identities = 36/154 (23%), Positives = 71/154 (46%), Gaps = 6/154 (3%) refJXP_223341. 2J similar to KIAA0635 product gene [Rattus norvegicus] Length = 1266 267. 3 Best-BlastP =>> nrprot 68% Identities = 167/307 (54%), Positives = 216/307 (70%), Gaps = 5/307 (1%) refJNP_820081. Delta (2) - isopentenylpyrophosphate transferase [Coxiella burnetii RSA 493] gbJAAO90595. 1 J tRNA delta (2) -isopentenylpyrophosphate transferase [Coxiella burnetii RSA 493] Length = 311 Best-BlastP =>> nrprot 16% Identities = 43/143 (30%), Positives = 70/143 (48%), Gaps = 6/143 (4%) refINP_842098. 1 d possible flagellar hook-length control protein [Nitrosomonas europaea ATCC 19718] emblCAD85999. 1 l possible flagellar hook-length control protein [Nitrosomonas europaea ATCC 19718] Length = 381 Best-BlastP =>> nrprot 98% Identities = 203/208 (97%), Positives = 205/208 (98%) spIP37033IYAC1_LEGPN Hypothetical 23. 7 kDa protein in ACN 5'region pirlIA48642 hypothetical protein (acn 5 'region) - Legionella pneumophila gbjAAA25294. 1 J putative Length = 208 Best-BlastP =>> nrprot 99% Identities = 885/891 (99%), Positive = 889/891 (99%) spIP37032IACON_LEGPN Aconitate hydratase (Citrate hydro-lyase) (Aconitase) (Major iron- containing protein (MICP) (IP210) pirlIB48642 aconitate hydratase (EC 4. 2. 1. 3) - Legionella pneumophila gbIAAA25295. 1 1 aconitase Length = 891 Best-BlastP =>> nrprot 70% Identities = 231/451 (51%), Positives = 328/451 (72%), Gaps = 1/451 (0%) refINP820994. 1 amino acid antiporter [Coxiella burnetii RSA 493] gbjAAO91508. 1 amino acid antiporter [Coxiella burnetii RSA 493] Length = 476 Best-BlastP =>> nrprot 63% Identities = 39/66 (59%), Positives = 45/66 (68%), Gaps = 2/66 (3) %) refINP_643775. 1 J conserved hypothetical protein [Xanthomonas axonopodis pv.  citri str.  306] gblAAM38311. 11 conserved hypothetical protein [Xanthomonas axonopodis pv.  citri str.  306] Length = 72 Best-BlastP =>> nrprot 56% Identities = 93/186 (50%), Positives = 128/186 (68%) refINP_819966. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbJAAO90480. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 414 2682. 1 Best-BlastP =>> nrprot 30% Identities = 76/390 (19%), Positives = 169/390 (43%), Gaps = 77/390 (19%) refINP_703923. 11 hypothetical protein [Plasmodium falciparum 3D7] embfCAD50535. 1 l hypothetical protein [Plasmodium falciparum 3D7] Length = 947 2683. 3 Best-BlastP =>> nrprot 64% Identities = 253/483 (52%), Positives = 321/483 (66%), Gaps = 1/483 (0%) refINP_791659. 1 J succinylgutamic semialdehyde dehydrogenase [Pseudomonas syringae pv.  tomato str.  DC3000] gbIAAO55354. Succinylglutamic semialdehyde dehydrogenase [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 488 2685. 2 Best-BlastP =>> nrprot 32% Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 4/192 (2%) refIZP_00031024. COG0421: Spermidine synthase [Burkholderia fungorum] Length = 252 2688. 2 Best-BlastP =>> nrprot No Hits found 269. 1 Best-BlastP =>> nrprot 63% Identities = 159/347 (45%), Positives = 224/347 (64%), Gaps = 2/347 (0%) refINP_820979. 1! heptosyl transferase, glycosyltransferase family 9 protein [Coxiella burnetii RSA 493] gblAAO91493. Heptosyl transferase, glycosyltransferase family 9 protein [Coxiella burnetii RSA 493] Length = 351 2690. 2 Best-BlastP =>> nrprot No Hits found 2695. 2 Best-BlastP =>> nrprot 45% Identities = 55/141 (39%), Positives = 89/141 (63%), Gaps = 6/141 (4%) gbjAAN86353. 11 unknown [Listonella pelagia] Length = 195 2696. 2 Best-BlastP =>> nrprot 70% Identities = 241/483 (49%), Positives = 342/483 (70%), Gaps = 10/483 (2%) reflZP_00117991. 1 I COG0433: Predicted ATPase [Cytophaga hutchinsonii] Length = 517 2698. 1 Best-BlastP =>> nrprot 69% Identities = 64/127 (50%), Positives = 89/127 (70%) refINP_522810. 1 l CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] embICAD18400. 1 PRESERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 2670. 1 2671. 1 2674. 1 2677. 2,268. 1 2680. 1 Best-BlastP =>> nrprot 37% Identities = 41/149 (27%), Positives = 82/149 (55%), Gaps = 2/149 (1%) refINP 644250. 11 hypothetical protein [Xanthomonas axonopodis pv.  citri str.  306] gblAAM38786. 1 j hypothetical protein [Xanthomonas axonopodis pv.  citri str.  306] Length = Best-BlastP =>> nrprot 61% Identities = 125/278 (44%), Positives = 170/278 (61%), Gaps = 14/278 (5%) gbjAAH53853. 1 j MGC16638 protein [Homo sapiens] Length = 291 Best-BlastP =>> nrprot 45% Identities = 112/367 (30%), Positives = 187/367 (50%), Gaps = 6/367 (1%) refINP_907216 . 1 f PUTATIVE EFFLUX PROTEIN [Wolinella succinogenes] embjCAE10116. 1 d PUTATIVE EFFLUX PROTEIN [Wolinella succinogenes] Length = 397 Best-BlastP =>> nrprot 56% Identifies = 103/291 (35%), Positives = 165/291 (56%), Gaps = 7/291 (2%) refINP_799583. 1d putative transcriptional regulator [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61416. 1 day putative transcriptional regulator [Vibrio parahaemolyticus] Length = 289 Best-BlastP =>> nrprot 45% Identities = 135/395 (34%), Positives = 213/395 (53%), Gaps = 17/395 (4%) refINP_865607. Probably sensor protein fixl [Pirellula sp. ] embjCAD73291. Probably sensor protein fixl [Pirellula sp. Length = 651 Best-BlastP =>> nrprot 61% Identities = 173/388 (44%), Positives = 239/388 (61%), Gaps = 16/388 (4%) refJZP_00054896. COG3287: Uncharacterized conserved protein Magnetospirillum magnetotacticum Length = 376 Best-BlastP =>> nrprot 24% Identities = 72/75 (96%), Positives = 72/75 (96%) gbjAAO61480. 11 unknown [Legionella pneumophila] Length = 77 Best-BlastP =>> nrprot 64% Identities = 158/320 (49%), Positives = 212/320 (66%), Gaps = 2/320 (0%) refINP_245036. 1 unknown [Pasteurella multocida] gbjAAK02183. 11 unknown [Pasteurella multocida] Length = 337 Best-BlastP =>> nrprot 29% Identities = 45/133 (33%), Positives = 79/133 (59%), Gaps = 3/133 (2%) refINP_149698. 1 day 235L [Invertebrate iridescent virus 6] gbjAAK82096. 1 jAF303741_235 235L [Chilo iridescent virus] Length = 265 Best-BlastP =>> nrprot 29% Identities = 57/175 (32%), Positives = 81/175 (46%), Gaps = 13/175 (7%) refINP_231966 .  1 j hypothetical protein VC2335 [Vibrio cholerae 01 biovar eltor str.  N16961] pirjIE82090 hypothetical protein VC2335 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF95479. 1 j hypothetical protein [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 195 2713. 2 Best-BlastP =>> nrprot 52% Identities = 107/319 (33%), Positives = 178/319 (55%), Gaps = 14/319 (4%) refINP 441143. 1 j unknown protein [Synechocystis sp.  PCC 6803] splP737711YB64_SYNY3 Hypothetical transport protein s1I1164 pirjIS74862 hypothetical protein sII1164 - Synechocystis sp.  (strain PCC 6803) dbjjBAA17823. 1 day ORF_ID: s111164 - unknown protein [Synechocystis sp.  PCC 6803] Length = 349 2717. 1 Best-BlastP =>> nrprot No Hits found 2718. 1 Best-BlastP =>> nrprot 71% Identities = 254/438 (57%), Positives = 324/438 (73%), Gaps = 10/438 (2%) REFINP 220059. 1 I Hexosphosphate Transport [Chlamydia trachomatis] spIO84548jUHPT_CHLTR Probable hexose phosphate transport protein pirIIA71501 probable hexosphosphate transport - Chlamydia trachomatis (serotype D, strain UW3 / Cx) gbjAAC68146. Hexosphosphate Transport [Chlamydia trachomatis] Length = 456 27. 1 270. 1 2700. 2 2702. 2 2704. 4 2705. 3 2706. 2 2709. 1,271. 1 2712. 1 2721. 3 Best-BlastP =>> nrprot 67% Identities = 383/736 (52%), Positives = 502/736 (68%), Gaps = 10/736 (1%) refIDP_00095016. 1 COG0022: Pyruvate / 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Novosphingobium aromaticivorans] Length = 738 2724. 3 Best-BlastP =>> nrprot 45% Identities = 96/404 (23%), Positives = 177/404 (43%), Gaps = 76/404 (18%) refJZP_00083983. 1 J hypothetical protein [Pseudomonas fluorescens PfO-1] Length = 524 2725. 1 Best-BlastP =>> nrprot 62% Identities = 39/75 (52%), Positives = 56/75 (74%) refINP_420714. Beta-related protein [Caulobacter crescentus CB15] pirIIF87485 flhB-related protein [imported] - Caulobacter crescentus gbIAAK23882. Beta-related protein [Caulobacter crescentus CB15] Length = 87 2726. 1 Best-BlastP =>> nrprot No Hits found 2727. 2 Best-BlastP =>> nrprot 16% Identities = 70/336 (20%), Positives = 147/336 (43%), Gaps = 50/336 (14%) gbIAAL99918. 1 JAF432211_1 CLL-associated antigen KW-11 [Homo sapiens] Length = 460 2728. 1 Best-BlastP =>> nrprot 61% Identities = 49/103 (47%), Positives = 65/103 (63%) refINP_903992. 11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbIAAQ61981. 1 J conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 117,273. 1 Best-BlastP =>> nrprot No Hits found 2730. 1 Best-BlastP =>> nrprot No Hits found 2732. 1 Best-BlastP =>> nrprot No Hits found 2733. 1 Best-BlastP =>> nrprot 58% Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 12/345 (3%) refINP 437388. 11 putative membrane-anchored protein [Sinorhizobium meliloti] pirIIH95947 Probably conserved membrane-anchored protein SMb21182 [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB. 1 J putative membrane-anchored protein [Sinorhizobium meliloti] Length = 394 2737. 2 Best-BlastP =>> nrprot No Hits found 2738. 2 Best-BlastP =>> nrprot 43% Identities = 55/255 (21%), Positives = 112/255 (43%), Gaps = 16/255 (6%) refINP_900118. 11 probable ABC transport system permease protein [Chromobacterium violaceum ATCC 12472] gbIAAQ58126. 1 J likely ABC transport system permease protein [Chromobacterium violaceum ATCC 12472] Length = 257 2739. 3 Best-BlastP =>> nrprot 50% Identities = 67/256 (26%), Positives = 115/256 (44%), Gaps = 51/256 (19%) refINP_518722. 1 I PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] embICAD14131. PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 547 2741. 2 Best-BlastP =>> nrprot 52% Identities = 20/40 (50%), Positives = 24/40 (60%) refINP_907600. 1 I hypothetical protein WS1440 [Wolinella succinogenes] embICAE10500. 1 l hypothetical protein [Wolinella succinogenes] Length = 42 Best-BlastP =>> nrprot 77% Identities = 34/42 (80%), Positives = 34/42 (80%) refINP_759472. 1 I Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759895. 1 I Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759901. 11 Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP760122. 1 I Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760328. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_763326. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO08316. 1 JAE016813_68 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO08999. 1 jAE016798_159 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gblAAO09422. 1 jAE016800 27 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO09428. 1 IAE016800_33 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO09649. 1 jAE016800_254 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO09855. 1AE016801_174 Conserved hypothetical protein [Vibrio vulnificus CMCP6] Length = 43 Best-BlastP =>> nrprot 82% Identities = 52/66 (78%), Positive = 56/66 (84%) refINP_759471. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759894 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759900. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759939.  1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760021. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760123. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760329. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760403. 1 j Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_763327. 1 j. Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO08317. 1 JAE016813_69 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO08998. 1 jAE016798_158 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO09421. 1AE016800_26 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO09427. 1 IAE016800_32 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gblAAO09466. 1 jAE016800_71 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAA 2745. 1 Best-BlastP =>> nrprot Nol-beds found 2747. 1 Best-BlastP =>> nrprot 62% Identities = 129/323 (39%), Positives = 203/323 (62%), Gaps = 4/323 (1%) refINP_384238.  1 j PUTATIVE ADENOSINE DEAMINASE PROTEIN [Sinorhizobium meliloti] spIQ92T48jADD_RHIME Adenosine deaminase (Adenosine aminohydrolase) EmbJAC41519. 1 j PUTATIVE ADENOSINE DEAMINASE PROTEIN [Sinorhizobium meliloti] Length = 324 2748. 1 Best-BlastP =>> nrprot Nol-beds found 2749. 4 Best-BlastP =>> nrprot 67% Identities = 204/415 (49%), Positives = 283/415 (68%) refINP_819070.  11 phosphate transporter family protein [Coxiella burnetii RSA 493] gbjAAO89584. 1 phosphate carrier protein family [Coxiella burnetii RSA 493] Length = 417 2751. 1 Best-BlastP =>> nrprot 48% Identities = 83/226 (36%), Positives = 125/226 (55%), Gaps = 5/226 (2%) refINP_212383. Phosphatidyltransferase [Borrelia burgdorferi] pirjIA70131 phosphatidyltransferase homolog - Lyme disease spirochete gblAAB91497. Phosphatidyltransferase [Borrelia burgdorferi B31] Length = 234 2752. 1 Best-BlastP =>> nrprot 49% Identities = 53/167 (31%), Positives = 81/167 (48%), Gaps = 14/167 (8%) refINP_819930. Preserved domain protein [Coxiella burnetii RSA 493] gbjAAO90444. Preserved domain protein [Coxiella burnetii RSA 493] Length = 169 2753. 1 Best-BlastP =>> nrprot No Hits found 2754. 2 Best-BlastP =>> nrprot 72% Identities = 109/184 (59%), Positives = 134/184 (72%) refINP_820271. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90785. 1 j conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 185 2742. 2 2743. 2 Best-BlastP =>> nrprot 29% Identities = 102/461 (22%), Positives = 198/461 (42%), Gaps = 56/461 (12%) refJNP_788908. 11 CG33206- PB [Drosophila melanogaster] gb! AAF48467. CG33206-PB [Drosophila melanogaster] Length = 1208 Best-BlastP =>> nrprot 73% Identities = 78/148 (52%), Positives = 110/148 (74%) refJZP_00125250. COG0359: Ribosomal protein L9 [Pseudomonas syringae pv.  syringae B728a] reflNP294663. Ribosomal protein L9 [Pseudomonas syringae pv.  tomato str.  DC3000] gbIAAO58358. 1! ribosomal protein L9 [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 148 to 2759. 1 Best-BlastP =>> nrprot 40% Identities = 74/283 (26%), Positives = 130/283 (45%), Gaps = 14/283 (4%) reflNP_819885. 1 protein membrane, putative [Coxiella burnetii RSA 493] gblAAO90399. 11 protein membrane, putative [Coxiella burnetii RSA 493] Length = 299 276. 1 Best-BlastP =>> nrprot 25% Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 1/25 (4%) reflNP_084281. 11 RIKEN cDNA A030005K14 Mus musculus dbjlBAB32176. 1 lnformamed protein product [Mus musculus] Length = 122 2760. 1 Best-BlastP =>> nrprot 85% Identities = 53/75 (70%), Positives = 65/75 (86%) ref1NP_240367. 11 30S ribosomal protein S18 [Buchnera aphidicola str.  APS (Acyrthosiphon pisum)] sp1P576261RS18_BUCAI 30S ribosomal protein S18 fold-11E84995 30S ribosomal protein S18 [imported] Buchnera sp.  (strain APS) dbj! BAB13253. 1 130S ribosomal protein S18 [Buchnera aphidicola str.  APS (Acyrthosiphon pisum)] Length = 75 2761. 1 Best-BlastP =>> nrprot 75% Identities = 70/107 (65%), Positives = 85/107 (79%) reflNP903310. 11 30S ribosomal protein S6 [Chromobacterium violaceum ATCC 12472] gblAAQ61302. 11 30S ribosomal protein S6 [Chromobacterium violaceum ATCC 12472] Length = 124 2763. 2 Best-BlastP =>> nrprot No Hits found 2765. 2 Best-BlastP =>> nrprot 33% Identities = 48/222 (21%), Positives = 99/222 (44%), Gaps = 21/222 (9%) refINP_106991. 11 unknown protein [Mesorhizobium loti] dbjlBAB52777. 1 l unknown protein [Mesorhizobium loti] Length = 328 2767. 1 Best-BlastP =>> nrprot No Hits found 2769. 2 Best-BlastP =>> nrprot 53% Identities = 203/594 (34%), Positives = 317/594 (53%), Gaps = 26/594 (4%) refINP_266737. 1 l hypothetical protein [Lactococcus lactis subsp.  Lactococcus lactis subsp.  lactis (strain IL1403) gbIAAK04679. Lactococcus lactis subsp.  lactis] Length = 598 277. 1 Best-BlastP =>> nrprot 41% Identities = 60/196 (30%), Positives = 99/196 (50%), Gaps = 18/196 (9%) refINP_436484. [Sinorhizobium meliloti] hypothetical protein SM11229 [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymA gbJAAK65896. 1 hypothetical protein [Sinorhizobium meliloti] Length = 308 2770. 1 Best-BlastP =>> nrprot 65% Identities = 114/240 (47%), Positives = 153/240 (63%), Gaps = 14/240 (5%) reflNP_867184. 1J short chain alcohol dehydrogenase-like [Pirellula sp. ] embICAD74729. 1 short chain alcohol dehydrogenase-like [Pirellula sp. ] Length = 247 2755. 1 2757. 1 Best-BlastP =>> nrprot 66% Identities = 205/386 (53%), Positives = 260/386 (67%), Gaps = 1/386 (0%) refINP_355900. 1 I AGR_L_236p [Agrobacterium tumefaciens] refINP_535243. 1 conserved hypothetical protein [Agrobacterium tumefaciens str.  C58 (U.  Washington)] pir1IC98145 hypothetical protein AGR_L 236 [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pirIIAI3142 conserved hypothetical protein Atu4765 [imported] Agrobacterium tumefaciens (strain C58, Dupont) gblAAK88685.  11 AGR_L_236p [Agrobacterium tumefaciens str.  C58 (Cereon)] gblAAL45559. 1 conserved hypothetical protein [Agrobacterium tumefaciens str.  C58 (U.  Washington)] Length = 507 Best-BlastP =>> nrprot 51% Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 12/131 (9%) refINP_469941.  1 11in0598 [Listeria innocua] pirIIAF1507 hypothetical protein 1in0598 [imported] Listeria innocua (strain CIip11262) embICAC95830. 1 Iin0598 [Listeria innocua] Length = 138 2774. 1 Best-BlastP =>> nrprot 69% Identities = 152/286 (53%), Positives = 204/286 (71%) refINP_697358. 1d transcriptional regulator, LysR family [Brucella suis 1330] gblAAN29273. 1 jAE014344_8 transcriptional regulator, LysR family [Brucella suis 1330] Length = 296 2775. 1 Best-BlastP =>> nrprot 50% Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 3/52 (5%) refIzP_00021959. COG3024: Uncharacterized Protein Preserved in Bacteria [Ralstonia metallidurans] Length = 63 2777. 1 Best-BlastP =>> nrprot 64% Identities = 174/343 (50%), Positives = 232/343 (67%), Gaps = 5/343 (1%) refINP_780210. 1 phosphoribosylaminoimidazole carboxylase, ATPase subunit [Xylella fastidiosa Temeculal] gbjAAO29859. Phosphoribosylaminoimidazole carboxylase, ATPase subunit [Xylella fastidiosa Temeculal] Length = 394 2778. 2 Best-BlastP =>> nrprot 82% Identities = 113/160 (70%), Positives = 138/160 (86%) ref] ZP_00066669. COG0041: Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Microbulbifer degradans 2-40] Length = 168,278. 3 Best-BlastP =>> nrprot 51% Identities = 218/623 (34%), Positives = 331/623 (53%), Gaps = 47/623 (7%) refINP_070765. Phosphoribosylformylglycinamidine synthase II (purL) [Archaeoglobus fulgidus DSM 4304] spIO28339JPURL_ARCFU Phosphoribosylformylglycinamidine synthase II (FGAM synthase II) pirlIC69492 phosphoribosylformylglycinamidine synthase (EC 6. 3. 5. 3) component II - Archaeoglobus fulgidus gblAAB89311. Phosphoribosylformylglycinamidine synthase II (purL) [Archaeoglobus fulgidus DSM 4304] Length = 765 2780. 2 Best-BlastP =>> nrprot 57% Identities = 116/273 (42%), Positives = 162/273 (59%), Gaps = 3/273 (1%) refINP_925031. 11 hypothetical protein gIr2085 [Gloeobacter violaceus] dbjJBAC90026. 1 gIr2085 [Gloeobacter violaceus] Length = 288 2781. 1 Best-BlastP =>> nrprot 70% Identities = 49/103 (47%), Positives = 75/103 (72%) refINP_213586. 1 I putative protein [Aquifex aeolicus] pir1IF70374 hypothetical protein aq_862 - Aquifex aeolicus gblAAC06993. 1 I putative protein [Aquifex aeolicus VF5] Length = 109 Best-BlastP =>> nrprot 49% Identities = 36/80 (45%), Positive = 52/80 (65%) refINP931069. 1 I hypothetical protein [Photorhabdus luminescens subsp.  laumondii TTOI] embICAE16236. 1 unnamed protein product [Photorhabdus luminescens subsp.  laumondii TTO1] Length = 124 Best-BlastP =>> nrprot 710/0 Identities = 153/265 (57%), Positives = 202/265 (76%), Gaps = 1/265 (0%) refINP_819150. I nicotinatenucleotide pyrophosphorylase [Coxiella burnetii RSA 493] gbJAAO89664. 1 nicotinate nucleotide pyrophosphorylase [Coxiella burnetii RSA 493] Length = 274 2771. 2 2772. 1 2784. 3 2785. 1 2788. 1 Best-BlastP =>> nrprot 54% Identities = 158/473 (33%), Positives = 263/473 (55%), Gaps = 39/473 (8%) refINP_485346. 1 J Na + / H + antiporter [Nostoc sp.  PCC 7120] pirIIAD1969 Na + / H + antiporter [imported] - Nostoc sp.  (strain PCC 7120) dbjIBAB73260. Na + / H + antiporter [Nostoc sp.  PCC 7120] Length = 470 2791. 1 Best-BlastP =>> nrprot 82% Identities = 537/779 (68%), Positives = 655/779 (84%), Gaps = 5/779 (0%) refJNP_310436. Phosphoenolpyruvate synthase [Escherichia coli O157: H7] pirliA90930 phosphoenolpyruvate synthase [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) dbjiBAB35832. 1! phosphoenolpyruvate synthase [Escherichia coli O157: H7] Length = 792 2792. 1 Best-BlastP =>> nrprot No Nits found 2793. 1 Best-BlastP =>> nrprot 50% Identities = 100/343 (29%), Positives = 170/343 (49%), Gaps = 28/343 (8%) refJNP_233263. 1 hydrolase, putative [Vibrio cholerae 01 biovar eltor str.  N16961] pir11E82406 probable hydrolase VCA0877 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gb1AAF96775. 1 Hydrolase, putative [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 358 2794. 2 Best-BlastP =>> nrprot 44% Identities = 152/532 (28%), Positives = 250/532 (46%), Gaps = 31/532 (5%) refIZP_00029700. COG1960: Acyl CoA dehydrogenases [Burkholderia fungorum] Length = 587 2795. 1 Best-BlastP =>> nrprot 87% Identities = 60/88 (68%), Positives = 78/88 (88%) refiNP_395197. 11 putative transposase ORFA [Yersinia pestis CO92] reflNP_857719. 1 J low calcium response locus protein S homolog [Yersinia pestis KIM] reflNP_857914. 1 l putative IS protein element [Yersinia pestis KIM] spiQ009311LCRS_YERPE Low calcium response locus protein S pirllT43562 Probable IS element protein - Yersinia pestis plasmid pCD1 gblAAA27655. 1 IICS gbJAAC62579. 1! low calcium response locus protein S homolog [Yersinia pestis KIM] gbIAAC69827. 11 putative IS element protein [Yersinia pestis KIM] emblCAB54940. Putative transposase ORFA [Yersinia pestis] Length = 88 2799. 1 Best-BlastP =>> nrprot 67% Identities = 71/126 (56%), Positives = 91/126 (72%) refINP_867058. Aspartate 1-decarboxylase [Pirellula sp. ] embiCAD74603. Aspartate 1-decarboxylase [Pirellula sp. ] Length = 156 2800. 1 Best-BlastP =>> nrprot 66% Identities = 136/258 (52%), Positives = 172/258 (66%), Gaps = 3/258 (1%) refINP_719181. 11 dimethyladenosine transferase [Shewanella oneidensis MR-1] spIQ8EB93IKSGA_SHEON Dimethyladenosine transferase (S-adenosylmethionine-6-N ', N'adenosyl (rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) gbjAAN56625. 1 IAE015799_12 dimethyladenosine transferase [Shewanella oneidensis MR-1] Length = 268 Best-BlastP =>> nrprot 63% Identities = 232/443 (52%), Positives = 286/443 (64%), Gaps = 2/443 (0) %) refiNP_629805. 1 putative 4-aminobutyrate aminotransferase [Streptomyces coelicolor A3 (2)] pirjJT35794 probable 4-aminobutyrate aminotransferase Streptomyces coelicolor embICAA20213. 11 putative 4-aminobutyrate aminotransferase [Streptomyces coelicolor A3 (2)] Length = Best-BlastP =>> nrprot 76% Identities = 118/196 (60%), Positives = 153/196 (78%) refINP_249757. 1 probable short-chain dehydrogenase [Pseudomonas aeruginosa PA0I] pir11H83512 probable short-chain dehydrogenase PA1066 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG04455. 11AE004538_7 probable short-chain dehydrogenase [Pseudomonas aeruginosa PAOI] Length = 218 2804. 1 2806. 1 2807. 1 Best-BlastP =>> nrprot 71% Identities = 54/113 (47%), Positives = 81/113 (71%), Gaps = 5/113 (4%) refINP_798658. 1 Arsenate reductase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC60542. 1 arsenate reductase [Vibrio parahaemolyticus] Length = 116 Best-BlastP =>> nrprot 60% Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 1/83 (1%) gblAAL07519 . 11 RNA-binding protein precursor [Solanum tuberosum] Length = 339 Best-BlastP =>> nrprot 48% Identities = 130/457 (28%), Positives = 218/457 (47%), Gaps = 24/457 (5% ) embICAD48863. 1 EefC outer membrane protein [Enterobacter aerogenes] Length = 454 Best-BlastP =>> nrprot 25% Identities = 43/179 (24%), Positives = 89/179 (49%), Gaps = 4/179 (2%) refINP_820323. 1 I conserved domain protein [Coxiella burnetii

  RSA 493] gblAAO90837.1 I conserved domain protein [Coxiella burnetii RSA 493] Length = 377 Best-BlastP =>> nrprot 9% Identities = 31/89 (34%), Positives = 54/89 (60%) ReflNP 819452.1 I hypothetical protein [Coxiella burnetii RSA 493] gbjAAO89966.11 hypothetical protein [Coxiella burnetii RSA 493] Length = 262 Best-BlastP =>> nrprot 50% Identities = 191/730 (26%), Positives = 361/730 (49%) , Gaps = 43/730 (5%) COG0659: Sulfate permease and related transporters (MFS superfamily) [Magnetospirillum magnetotacticum] Length = 733 Best-BlastP =>> nrprot 61% Identities = 155/372 (41%) , Positives = 219/372 (58%), Gaps = 37/372 (9%) gbiAAK97454.11AF388182_2 alkane 1-monooxygenase [Rhodococcus sp. Q15] Length = 408 Best-BlastP =>> nrprot 53% Identities = 58/179 (32%), Positives = 103/179 (57%), Gaps = 12/179 (6%) refINP_900154.1 f probable type IV prepilin [Chromobacterium violaceum ATCC 12472] gbIAAQ58161.1 probable type IV prepilin [Chromobacterium violaceum ATCC 12472] Length = 185 2820.1 Best-BlastP =>> nrprot 64% Identities = 145/273 (53%), Positives = 183/273 (67 %), Gaps = 4/273 (1%) refINP_439796.1 Hypothetical protein HI1654 pirJJA64174 ] Length = 283 2822.1 Best-BlastP =>> nrprot 52% Identities = 202/610 (33%), Positives = 315/610 (51%), Gaps = 29/610 (4%) ref! ZP_00137912.1 I COG3107 : Putative lipoprotein [Pseudomonas aeruginosa UCBPP-PA14] Length = 604 2824.1 Best-BlastP =>> nrprot 72% Identities = 83/138 (60%), Positives = 102/138 (73%) refINP_254240.1 I ATP sy nthase epsilon chain [Pseudomonas aeruginosa PA0I] ATP_PSEAE ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) ATP_PSEAE ATP_PSEAE ATP_PSEAE ATP_PSEAE ATP_PSEAE ATP_PSEAE ATP_PSEA ATP synthase epsilon chain PA5553 [imported] - Pseudomonas aeruginosa (PAO1 strain) gbIAAG08938.1 1AE004967_9 ATP synthase epsilon chain [Pseudomonas aeruginosa PAO1] Length = 141 2826.1 Best-BlastP =>> nrprot 42% Identities = 110/540 (20%), Positives = 217/540 (40%), Gaps = 94/540 (17%) refiZP 00144200.1 EXONUCLEASE SBCC [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gblEAA24200.11 EXONUCLEASE SBCC [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 921 2827.3 Best-BlastP =>> nrprot No Nits found 2808.1 2810.1 2811.2 2815.2 2816.2 2818.1 282.2 2828.3 Best-BlastP =>> nrprot 72% Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 2/52 (3%) refINP 885117.1 I phosphatidylserine decarboxylase proenzyme [Bordetella parapertussis] embICAE38217.11 phosphatidylserine decarboxylase proenzyme [Bordetella parapertussis] Length = 328 283.1 Best-BlastP =>> nrprot 47% Identities = 52 / 142 (36%), Positives = 86/142 (60%), Gaps = 8/142 (5%) refINP_900149.1 I probable type-4 fimbrial biogenesis protein [Chromobacterium violaceum ATCC 12472] gbIAAQ58156.1 j probable type- 4 fimbrial biogenesis protein [Chromobacterium violaceum ATCC 12472] Length = 159 2830.3 Best-BlastP =>> nrprot No Hits found 2831.1 Best-BlastP =>> nrprot 47% Identities = 71/219 (32%), Positive = 106/219 ( 48%), Gaps = 10/219 (4%) refINP_801239: 1! transcriptional regulator, LuxR family [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC63072.1 I transcriptional regulator, LuxR family [Vibrio parahaemolyticus] Length = 251 2833.1 Best-BlastP =>> nprot 56% Identities = 125/332 (37%), Positive = 186 / 332 (56%), Gaps = 22/332 (6%) spIQ56686ICPDP_VIBFI 3 ', 5'-CYCLICONUCLEOTIDE PHOSPHODIESTERASE PRECURSOR (PDEASE) (3': 5'-CNP) pirIIA40602 3 ', 5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17) - Vibrio fischeri gbIAAA27513.1 Length = 330 2835.1Best-BlastP =>> nrprot 70% Identities = 151/281 (53%), Positives = 200/281 (71%), Gaps = 1/281 (0%) refINP254359.1 I Putative 3-hydroxyacyl-CoA dehydrogenase [Escherichia coli CFT073] gbIAAN80926.1 IAE016762_179 Putative 3-hydroxyacyl-CoA dehydrogenase [Escherichia coli CFT073] Length = 289 2838.1 Best-BlastP =>> nrprot 67% Identities = 176/365 (48%), Positives = 253/365 (69%) refIZP_00110259.11 COG1960: Acyl-CoA dehydrogenases [Nostoc punctiform] Length = 395 284.2 Best-BlastP =>> nrprot 57% Id entities = 128/361 (35%), Positives = 203/361 (56%), Gaps = 24/361 (6%) refINP_900150.1 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbIAAQ58157. 11 = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 354 2840.1 Best-BlastP =>> nrprot 62% Identities = 225/502 (44%), Positives = 316/502 (62%), Gaps = 9/502 (1) MycC [Bacillus subtilis] MycC [Bacillus subtilis] MycC [Bacillus subtilis] Length = 2609 2841.4 Best-BlastP =>> nrprot 58% Identities = 175/439 (39%), Positives = 259/439 (%) MycC [Bacillus subtilis] mycosubtilin synthetase 58%), Gaps = 14/439 (3%) reflZ_00111186.1 I COG3321: Polyketide synthase modules and related proteins [Nostoc punctiform] Length = 1853 2847.4 Best-BlastP =>> nrprot No Hits found 2848.4 Best-BlastP =>> Best-BlastP =>> nrprot No Hits found 2858.1 Best- BlastP =>> nrprot 28% Identities = 23/33 (69%), Positives = 24/33 (72%) pirIIA44803 pGl protein - human ( fragment) Length = 75 2859.2 Best-BlastP =>> nrprot 76% Identities = 254/393 (64%), Positives = 308/393 (78%) refINP_716935.11 tyrosyl-tRNA synthetase [Shewanella oneidensis MR-1] gbIAAN54380. 11AE015575_6 t yrosyl-tRNA synthetase [Shewanella oneidensis MR-1] Length = 398 286.2 Best-BlastP =>> nrprot 48% Identities = 48/165 (29%), Positives = 83/165 (50%), Gaps = 18/165 ( 10%) refINP_900151.1 j hypothetical protein CVO481 [Chromobacterium violaceum ATCC 12472] gbIAAQ58158.11 hypothetical protein CVO481 [Chromobacterium violaceum ATCC 12472] Length = 168 2861.1 Best-BlastP =>> nrprot 67% Identities = 131/262 (50%) , Positives = 185/262 (70%), Gaps = 1/262 (0%) refJZP_00068001.11 COG3220: Uncharacterized protein stored in bacteria [Microbulbifer degradans 2- 40] Length = 290 2862.1 Best-BlastP =>> nrprot 52% Identities = 142/396 (35%), Positives = 210/396 (53%), Gaps = 7/396 (1%) ReflNP_349992.1 Dipeptidyl aminopeptidase / acylaminoacyl peptidase related protein [Clostridium acetobutylicum] A97318 dipeptidyl aminopeptidase / aciphenylamine-peptidase related protein [imported] Clostridium acetobutylicum gbjAAK81332.1 JAE007837_10 Dipeptidyl aminopeptidase / acylaminoacyl-peptidase related protein [Clostridium acetobutylicum] Length = 400 Best-BlastP =>> nrprot 35% Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 4/117 (3%) ref! ZP_00008611. COG0845: Membrane fusion protein [Rhodopseudomonas palustris] Length = 267 Best-BlastP =>> nrprot 78% Identities = 276/431 (64%), Positives = 347/431 (80%), Gaps = 1/431 ( 0%) refjNP_901043.1 Probable oxidoreductase [Chromobacterium violaceum ATCC 12472] gbjAAQ59048.1 Probable oxidoreductase [Chromobacterium violaceum ATCC 12472] Length = 438 Best-BlastP =>> nrprot 60% Identities = 247/585 (42%), Positive = 357/585 (61%), Gaps = 15/585 (2%) ref: disulfide interchange protein DsbD [Coxiella burnetii RSA 493] gbjAAO91218.1 thiol: disulfide interchange protein DsbD [Coxiella burnetii RSA 493] Length = 584 Best-BlastP =>> nrprot 98% Identities = 96/96 (100%), Positive = 96/96 (100%) spjP26879jCH10_LEGPN 10 kDa chaperonin (Protein Cpn10) (groES protein) (heat shock protein A) pirllB41468 heat shock protein groES Legionella pneumophila gblAAA25297.1 1 htpA Length = 96 2873.1 Best-BlastP =>> nrprot 40% Identities = 66/274 (24%), Positives = 130/274 (47%), Gaps = 16/27 4 (5%) refjNP_692096.1 hypothetical protein [Oceanobacillus iheyensis HTE831] dbjjBAC13131.1 hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 314 2874.1 Best-BlastP =>> nrprot 59% Identities = 111/225 (49%), Positives = 155/225 (68%), Gaps = 1/225 (0%) refjNP_662190.11 hypothetical protein [Chlorobium tepidum TLS] gbjAAM72532.1 I hypothetical protein [Chlorobium tepidum TLS] Length = 232 2877.2 Best-BlastP =>> nrprot 49% Identities = 71/206 (34%), Positive = 109/206 (52%), Gaps = 3/206 (1%) refjNP_902629.1 hypothetical protein CV2959 [Chromobacterium violaceum ATCC 12472] gbjAAQ60627.1 j hypothetical protein CV2959 [Chromobacterium violaceum ATCC 12472] Length = 214 2878.2 Best-BlastP =>> nrprot 98% Identities = 226/230 (98%), Positive = 228/230 (99%) gbjAAK00284.11AF288536_6 possible transcriptional regulatory protein [Legionella longbeachae] Length = 230 2879.3 Best-BlastP =>> nrprot 96% Identities = 419/444 (94%), Positives = 430/444 (96%), Gaps = 2/444 (0%) gbjAAK00283.1 jAF288536_5 unknown [Legionella longbeachae] Length = 444 2881.2 Best-BlastP =>> nrprot 93% Identities = 270/302 (89%), Positives = 281/302 (93%), Gaps = 1/302 (0% ) gbjAAK00282.1 jAF288536 4 unknown [Legionella longbeachae] Length = 302 2863.1 2866.1 2868.1 2869.1 2882.2 Best-BlastP =>> nrprot 76% Identities = 146/221 (66%), Positives = 175/221 (79%), Gaps = Recipient of Pseudomonas aeruginosa [Pseudomonas aeruginosa PA01] [Pseudomonas aeruginosa UCBPP-PA14] [Pseudomonas aeruginosa UCBPP-PA14] strain PAO1) gbJAAGO4365.1JAE004531_2 conserved hypothetical protein [Pseudomonas aeruginosa PAOI] gbJAAP82946.1I conserved hypothetical protein [Pseudomonas aeruginosa] Length = 224 2884.1 Best-BlastP =>> nrprot No Hits found 2889.2 Best-BlastP =>> nrprot 69% Identities = 72/124 (58%), Positives = 90/124 (72%) refINP_719248.1 J membrane protein, putative [Shewanella oneidensis MR-1] gbJAAN56692. 11AE015805_1 protein membrane, putative [Shewanella oneidensis MR-1] Length = 127 2891.2 Best-BlastP =>> nrprot 58% Identities = 235/584 (40%), Positives = 358/584 (61%), Gaps = 4/584 (0%) refINP_359923.11 multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] pirJIF97735 hypothetical protein abcT3 [imported] - Rickettsia conorii (Malish strain 7) gbJAAL02824.1 J multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] Length = 589 2893.2 Best-BlastP =>> nrprot 51% Identities = 263/741 (35%), Positives = 402/741 (54%), Gaps = 32/741 (4%) refJZP_00080393.1 J hypothetical protein [Geobacter metallireducens] Length = 768 2898.4 Best-BlastP =>> nrprot 61% Identities = 27/72 (37%), Positive = 47/72 (65%) refINP_660683.11 acyl carrier protein [Buchnera aphidicola str. Sg (Schizaphis graminum)] spIQ8K9J4JACP_BUCAP Acyl carrier protein (ACP) gbJAAM67894.11 acyl carrier protein [Buchnera aphidicola str. Sg (Schizaphis graminum)] Length = 79 29.1 Best-BlastP =>> nrprot 39% Identities = 26/62 (41%), Positives = 38/62 (61%) gblAAO43539.1 J probable conjugal transfer protein TraD [Rhizobium etli ] Length = 71 290.2 Best-BlastP =>> nrprot 58% Identities = 501/1050 (47%), Positives = 679/1050 (64%), Gaps = 57/1050 (5%) refINP_900152.1 I conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbjAAQ58159. 21 = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 1040 2900.2 Best-BlastP =>> nrprot 50% Identities = 121/308 (39%), Positives = 170/308 (55%), Gaps = 4/308 (1) %) 3-oxoacyl- (acylcarrier-protein) synthase III [Chlamydophila caviae GPIC] gblAAP05228.1 J-oxoacyl- (acyl-carrier-protein) synthase III [Chlamydophila caviae GPIC] Length = 335 2905.2 Best- BlastP =>> nrprot No Hits found 2906.2 Best-BlastP =>> nrprot 62% Identities = 95/201 (47%), Positives = 127/201 (63%), Gaps = 1/201 (0%) refINP_929829.1 J Glutathione S-transferase [Photorhabdus luminescens subsp. laumondii TTO1] embICAE14968. Glutathione S-transferase [Photorhabdus luminescens subsp. laumondii TTO1] Length = 201 2908.2 Best-BlastP =>> nrprot No Hits found 2909.1 Best-BlastP =>> nrprot 54% Identities = 137/387 (35%), Positives = 210/387 (54%), Gaps = 25 / 387 (6%) D-alanyl-D-alanine carboxypeptidase refINP_441897.1 [Synechocystis sp. PCC 6803] pirJIS76446 hypothetical protein - Synechocystis sp. (strain PCC 6803) dbjIBAA18575.1 D-alanyl-D-alanine carboxypeptidase [Synechocystis sp. PCC 6803] Length = 400 291.4 Best-BlastP =>> nrprot 79% Identities = 283/419 (67%), Positive = 342/419 (81%) refINP_820426.1 I NADH dehydrogenase I, F subunit [Coxiella burnetii RSA 493 ] gbIAAO90940.11 NADH dehydrogenase I, F subunit [Coxiella burnetii RSA 493] Length = 422 2910.1 Best-BlastP =>> nrprot 73% Identities = 272/465 (58%), Positives = 348/465 (74%), Gaps = 1/465 (0%) refINP_928701.11 glutamyl-tRNA synthetase, catalytic subunit [Photorhabdus luminescens subsp. laumondii TTO1] embICAE13694.1 J glutamyl-tRNA synthetase, catalytic subunit [Photorhabdus luminescens subsp. laumondii TTO1] Length = 472 2911.3 Best-BlastP =>> nrprot 58% Identities = 47/95 (49%), Positive = 62/95 (65%) refINP_931076.1 I BoIA protein [Photorhabdus luminescens subsp. laumondii TTO1] embICAE16243.11 BoIA protein [Photorhabdus luminescens subsp. laumondii TTO1] Length = 104 2914.1 Best-BlastP =>> nrprot 60% Identities = 90/225 (40%), Positives = 135/225 (60%), Gaps = 15/225 (6%) refINP_759151.11 Inactive homolog of inhibited metal-dependent proteases [Vibrio vulnificus CMCP6] gbIAAO08678.1 1AE016797_133 Inactive homolog of metal-dependent proteases [Vibrio vulnificus CMCP6] Length = 233 2915.2 Best-BlastP =>> nrprot 8% Identities = 45/199 (22%), Positive = 77/199 (38%), Gaps = 4/199 (2%) refINP_497967.1 I cyclin-like F-box (3F797) [Caenorhabditis elegans] pirIIT24435 hypothetical protein T04A8. [Caenorhabditis elegans] Length = 791 2916.1 Best-BlastP =>> nrprot No Hits found 2917.1 = 71/132 (53%), Gaps = 11/132 (8%) refINP_707288.1 1 Activator of ProP osmoprotectant transporter [Shigella flexneri 2a str. 301] gbIAAN42995.1 1AE015164_2 Activator of ProP osmoprotectant transporter [Shigella flexneri 2a str. 301] Length = 232 2919.1 Best-BlastP =>> nrprot 55% Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 4/55 (7%) refINP_768003.1 I bs11363 [ Bradyrhizobium japonicum] dbjIBAC46628.1 bsll 363 [Bradyrhizobium japonicum USDA 110] Length = 73 292.1 Best-BlastP =>> nrprot 69% Identities = 75/152 (49%), Positives = 108/152 (71%), Gaps = 1 / 152 (0%) dbjIBAA25988.1 j 24-kDa subunit of complex I [Homo sapiens] Length = 231 2920.1 Best-BlastP =>> nrprot No Hits found 2921.3 Best-BlastP =>> nrprot 17% Identities = 81/447 (18%), Positives = 193/447 (43%), Gaps = 55/447 (12%) pirIIE71606 hypothetical protein PFB0765w malaria parasite (Plasmodium falciparum) Length = 980 2924.3 Best-BlastP =>> nrprot No Hits found 2925.1 Best -BlastP =>> nrprot 61% Identities = 385/477 (80%), Positives = 412/477 (86%), Gaps = 24/477 (5%) gbIAAD50296.11AF173009_1 Rep. Helicase [Legionella pneumophila] Length = 467 2926.1 Best-BlastP =>> nrprot No Hits found 2928.2 Best-BlastP =>> nrprot 63% Identities = 116/298 (38%), Pos itives = 178/298 (59%), Gaps = 22/298 (7%) COG1281: Disulfide bond chaperones of the family HSP33 [Burkholderia fungorum] Length = 316 2929.1 Best-BlastP =>> nrprot 46% Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 1/130 (0%) refINP_635963.1 conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gbIAAM39887.1 conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 171 293. 2 Best-BlastP =>> nrprot 89% Identities = 326/417 (78%), Positive = 374/417 (89%) refINP_820428.1 I NADH dehydrogenase I, D subunit [Coxiella burnetii RSA 493] gbjAAO90942.1 I NADH dehydrogenase I, D subunit [Coxiella burnetii RSA 493] Length = 417 2932.2 Best-BlastP =>> nrprot 60% Identities = 309/814 (37%), Positives = 491/814 (60% ), Gaps = 18/814 (2%) refINP_890811.1 Probable membrane protein [Bordetella bronchiseptica] likely emblCAE34640.1l membrane protein [Bordetella bronchiseptica] Length = 1028 2933.2 Best-BlastP =>> nrprot 60% Identities = 122/303 (40%), Positives = 184/303 (60%), Gaps = 14/303 (4%) refINP_603145.1 I Hypothetical protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gblAAL94444.1 J Hypothetical protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 310 2934.1 Best-BlastP =>> nrprot No Hits found 2938.3 Best-BlastP =>> nrprot 41% Identities = 250/1286 (19%), Positives = 507/1286 (39%), Gaps = 229/1286 (17%) refINP_212646.11 B. burgdorferi predicted coding region BB0512 [Borrelia burgdorferi] pirIIG70163 hypothetical protein BB0512 - Lyme disease spirochete gbIAAC66876.1 I B.

* burgdorferi predicted coding region BB0512 [Borrelia burgdorferi B31] Length = 2166 294.1 Best-BlastP =>> nrprot 67% Identities = 121/219 (55%), Positives = 153/219 (69%), Gaps = 1/219 ( 0%) refINP_820429.1 I NADH dehydrogenase I, C subunit [Coxiella burnetii RSA 493] gbIAAO90943.1! NADH dehydrogenase I, C subunit [Coxiella burnetii RSA 493] Length = 227 2941.1 Best-BlastP =>> nrprot 49% Identities = 173/480 (36%), Positives = 267/480 (55%), Gaps = 7/480 (1%) refINP_819594.1 Apolipoprotein N-acyltransferase [Coxiella burnetii RSA 493] gblAAO90108.11 apolipoprotein N-acyltransferase [Coxiella burnetii RSA 493] Length = 485 2942.1 Best-BlastP =>> nrprot 76% Identities = 502/825 ( 60%), Positive = 628/825 (76%), Gaps = 8/825 (0%) refINP819590.1 I leucyl-tRNA synthetase [Coxiella burnetii RSA 493] gblAAO90104.1 I leucyl-tRNA synthetase [Coxiella burnetii RSA 493 ] Length = 820 2943.1 Best-BlastP =>> nrprot 42% Identities = 48/160 (30%), Positives = 76/160 (47%), Gaps = 4/160 (2%) Refl NP_252677.1 Hypothetical protein [ Pseudomonas aeruginosa PA01] refJZP_00137430.1 I COG2980: Rare lipoprotein B [Pseudomonas aeruginosa UCBPP-PA14] pirlIF83148 hypothetical protein PA3988 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG07375.1 1AE004816_11 hypothetical protein PA39 88 [Pseudomonas aeruginosa PAO1] Length = 207 2949.2 Best-BlastP =>> nrprot 74% Identities = 185/307 (60%), Positive = 238/307 (77%) refJP_00087322.1 J hypothetical protein [Pseudomonas fluorescens PfO-1 Length = 325 295.1 Best-BlastP =>> nrprot 88% Identities = 128/152 (84%), Positives = 141/152 (92%) reflZP_00023480.1 I COG0377: NADH: ubiquinone oxidoreductase 20 kD subunit and related Fe- S oxidoreductases [Ralstonia metallidurans] Length = 160 Best-BlastP =>> nrprot 26% Identities = 100/453 (22%), Positives = 179/453 (39%), Gaps = 86/453 (18%) refINP_703829.1I hypothetical protein [Plasmodium falciparum 3D7] emblCAD50441.1 I hypothetical protein [Plasmodium falciparum 3D7] Length = 1321 Best-BlastP =>> nrprot 8% Identities = 32/93 (34%), Positive = 53/93 (56%), Gaps = 4/93 (4%) gbIAAL78307.11AF288617 4 Dotl [Legionella longbeachae] Length = 212 2951.2 2952.1 Best-BlastP =>> nrprot 97% Identities = 161/166 (96%), Positives = 163/166 (98% ) pirIIS49042 global stress protein gspA - Legio nella pneumophila Length = 166 Best-BlastP =>> nrprot 74% Identities = 198/312 (63%), Positives = 247/312 (79%), Gaps = 5/312 (1%) refINP_903586.1 I likely electrontransferring- flavoprotein dehydrogenase [Chromobacterium violaceum ATCC 12472] gbIAAQ61577.11 Probable electron-transferringflavoprotein dehydrogenase [Chromobacterium violaceum ATCC 12472] Length = 539 Best-BlastP =>> nrprot 99% Identities = 126/127 (99%), Positive = 127/127 ( 100%) gbIAAD51393.1 IAF117715_2 unknown [Legionella pneumophila] Length = 127 Best-BlastP =>> nrprot 98% Identities = 248/252 (98%), Positives = 250/252 (99%), Gaps = 1/252 ( 0%) spIQ9S4T3ISURE_LEGPN Acid phosphatase onE. gbIAAD51394.1 IAF117715_3 survival protein homolog [Legionella pneumophila] Length = 251 Best-BlastP =>> nrprot 97% Identities = 242/247 (97%), Positive = 243/247 (98%) gbIAAD51395.1 IAF117715 4 novel lipoprotein homolog [Legionella pneumophila] Length = 247 Best-BlastP =>> nrprot 78% Identities = 76/118 (64%), Positives = 93/118 (78%) refINP_820431.11 NADH dehydrogenase I, A subunit [Coxiella burnetii RSA 493] ## EQU1 ## IAF117715_5 stationary phase specific sigma factor homolog [Legionella pneumophila] Length = 341 Best-BlastP =>> nrprot 99% Identities = 410/416 (98%), Positives = 414/416 (99%) spIQ9S4TOIHGD_LEGPN Homogentisate 1,2-dioxygenase ( Homogentisicase) (Homogentisate oxygenase) Length = 416 Best-BlastP =>> nrprot 95% Identities = 235/238 (98%), Positives = 236/238 (99%) gbIAAD51398 .1 IAF117715_7 YebC [Legionella pneumophila] Length = 238 Best-BlastP =>> nrprot 59% Identities = 110/257 (42%), Positives = 151/257 (58%), Gaps = 10/257 (3%) refINP_231867 .1 hydroxyacylglutathione hydrolase GIoB, putative [Vibrio cholerae 01 biovar eltor str. N16961] pirIIA82102 probable hydroxyacylglutathione hydrolase GIoB VC2236 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF95380.1 j hydroxyacylglutathione hydrolase GIoB, putative [Vibrio cholerae 01 biovar eltor str. N16961] Length = 252 2964.1 Best-BlastP =>> nrprot 62% Identities = 121/275 (44%), Positives = 177/275 (64%), Gaps = 3/275 (1%) refINP_229844.1 I conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] pirIIB82353 conserved hypothetical protein VC0187 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF93363.1 1 conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str.

  N16961] Length = 279 2965.1 Best-BlastP =>> nrprot No Hits found 2966.1 Best-BlastP =>> nrprot 73% Identities = 164/276 (59%), Positives = 209/276 (75%), Gaps = 1 / 276 (0%) refINP 438767.1 methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase [Haemophilus influenzae Rd] spIP44313IFOLD_HAEIN FoID bifunctional protein [Includes: Methylenetetrahydrofolate dehydrogenase; Methenyltetrahydrofolate cyclohydrolase] pirIIA64081 methylenetetrahydrofolate dehydrogenase (NADP) (EC 1.5.1.5) / methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) Haemophilus influenzae (strain Rd KW20) gbIAAC22268.1 I methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase (folD) [Haemophilus influenzae Rd] Length = 282 2953.2 2954.2 2955.2 2958.2 2959.1 296.1 2960.1 2961.1 2962.1 2963.2 2967.1 Best-BlastP =>> nrprot No Hits found 2968.3 Best-BlastP =>> nrprot 13% Identities = 115/119 (96%), Positives = 117/119 (98% gblAAM21056.11 FimV [Legionella pneumophila] Length = 119 2969.1 Best-BlastP =>> nrprot 81% Identities = 50/79 (63%), Positives = 64/79 (81%) ref! NP_389755.1! Similar to transcriptional regulator [Bacillus subtilis] pirJjC69931 transcription regulator homolog YozG - Bacillus subtilis emb | CAB13766.1 jyozG [Bacillus subtilis subsp. subtilis str. 168] Length = 84 297.2 Best-BlastP =>> nrprot 63% Identities = 59/101 (58%), Positives = 69/101 (68%), Gaps = 8/101 (7%) refINP_820432.1! preprotein translocase, SecG subunit [Coxiella burnetii RSA 493] gblAAO90946.11 preprotein translocase, SecG subunit [Coxiella burnetii RSA 493] Length = 98 2970.2 Best-BlastP =>> nrprot 32% Identities = 34/103 (33%), Positives = 56/103 (54%) refJZP_00136103.1 hypothetical protein [Pseudomonas aeruginosa UCBPP-PAI4] Length = 185 2972.3 Best-BlastP =>> nrprot 10% Identities = 43/138 (31%), Positive = 63/138 (45% ), Gaps = 15/138 (10%) refINP_704193.1 Jubilee carboxylterminal hydrolase, putative [Plasmodium falciparum 3D7] embICAD51009.1 I ubiquitin carboxyl-terminal hydrolase, putative [Plasmodium falciparum 3D7] Length = 3183 2973.2 Best-BlastP => > nrprot No Hits found 2975.2 Best-BlastP =>> nrprot No Hits found 2976.1 Best-BlastP =>> nrprot No Hits found 2978.1 Best-BlastP =>> nrprot 22% Identities = 41/121 (33%), Positives = 64 / 121 (52%), Gaps = 11/121 (9%) ref! NP_818058.1! gp85 [Mycobacteriophage Che9d] gblAAN08003.1! gp85 [Mycobacteriophage Che9d] Length = 301 2982.1 Best-BlastP =>> nrprot 38% Identities = 174/388 (44%), Positives = 236/388 (60%), Gaps = 17/388 (4%) reflNP_706610.1 orf, partial conserved hypothetical protein [Shigella flexneri 2a str. 301] refINP_836390.1I putative bacteriophage protein [Shigella flexneri 2a str.

  2457T] gblAAN42317.1IAE015098_7 orf, partial conserved hypothetical protein [Shigella flexneri 2a str. 301] gblAAP16196.11 putative bacteriophage protein [Shigella flexneri 2a str. 2457T] Length = 619 2983.1 Best-BlastP =>> nrprot 54% Identities = 33/66 (50%), Positive = 47/66 (71%) ref! NP_478090.1 hypothetical protein [Corynebacterium glutamicum] embICAD12221.1! hypothetical protein [Corynebacterium glutamicum] Length = 81 2985.1 Best-BlastP =>> nrprot No Hits found 2986.1 Best-BlastP =>> nrprot No Hits found 2987.1 Best-BlastP =>> nrprot No Hits found 2988.1 Best- BlastP =>> nrprot No Hits found 2990.1 Best-BlastP =>> nrprot 44% Identities = 34/97 (35%), Positives = 49/97 (50%), Gaps = 1/97 (1%) ref! NP_771656.1! bI15016 [Bradyrhizobium japonicum] dbj! BAC50281.1! bl15016 [Bradyrhizobium japonicum USDA 110] Length = 198 2991.1 Best-BlastP =>> nrprot 43% Identities = 90/344 (26%), Positives = 145/344 (42%), Gaps = 68/344 (19%) gb ## EQU1 ## 1%) gblEAA26507.11 unknown [Rickettsia sibirica] Length = 73 2993.2 Best-BlastP =>> nrprot 31% Identities = 40/160 (25%), Positives = 76/160 (47%), Gaps = 11/160 ( 6%) dbjlBAA00448.1 I open reading frame (196 AA) Mus musculus Length = 196 2994.2 Best-BlastP =>> nrprot 65% Identities = 55/118 (46%), Positives = 82/118 (69%) refINP_353891.1 l AGR_C_1587p [Agrobacterium tumefaciens] refINP_531567.1l conserved hypothetical protein [Agrobacterium tumefaciens str. [Agrobacterium tumefaciens (strain C58, Cereon)). C58 (Cereon)] gbIAAL41883.1 conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 122 2995.1 Best-BlastP =>> nrprot 32% Identities = 68/290 (23%), Positives = 135/290 (46%), Gaps = 39/290 (13%) refINP_473345 .21 hypothetical protein [Plasmodium falciparum 3D7] emblCAB39052.21 hypothetical protein [Plasmodium falciparum 3D7] Length = 670 2996.1 Best-BlastP =>> nrprot No Hits found 2998.1 Best-BlastP =>> nrprot 51% Identities = 44/134 (32 %), Positive = 73/134 (54%), Gaps = 1/134 (0%) refINP_820925.1 I hypothetical protein [Coxiella burnetii RSA 493] gblAAO91439.11 hypothetical protein [Coxiella burnetii RSA 493] Length = 148 2999.3 Best -BlastP =>> nrprot 24% Identities = 39/156 (25%), Positives = 69/156 (44%), Gaps = 33/156 (21%) reflZP_00047224.1 l COG3774: Mannosyltransferase OCHI and related enzymes [Lactobacillus gasseri] Length = 233 3.1 Best-BlastP =>> nrprot 49% Identities = 36/79 (45%), Positive = 50/79 (63%) refINP_907749.1 I hypothetical protein WS1616 [Wolinella succinogenes] embICAE10649.11 hypothetical protein [Wolinella succino genes] Length = 96 30.1 Best-BlastP =>> nrprot No Hits found 300.2 Best-BlastP =>> nrprot 75% Identities = 346/570 (60%), Positives = 431/570 (75%), Gaps = 3 / 570 (0%) refINP_752183.1 l Prolyl-tRNA synthetase [Escherichia coli CFT073] gbIAAN78727.1 1AE016755_227 Prolyl-tRNA synthetase [Escherichia coli CFT073] Length = 590 3000.1 Best-BlastP =>> nrprot 58% Identities = 312/711 ( 43%), Positives = 440/711 (61%), Gaps = 35/711 (4%) REFZP 00090403.1 I COG3243: Poly (3-hydroxyalkanoate) synthetase [Azotobacter vinelandii] Length = 824 3001.1 Best-BlastP =>> nrprot No Hits found 3002.1 Best-BlastP =>> nrprot 36% Identities = 96/343 (27%), Positive = 152/343 (44%), Gaps = 29/343 (8%) refIz_00019713.1 I hypothetical protein [Chloroflexus aurantiacus] Length = 360 3003.1 Best-BlastP =>> nrprot 57% Identities = 77/202 (38%), Positives = 119/202 (58%), Gaps = 3/202 (1%) reflZP_00008122.1 I COG0500: SAM-dependent methyltransferases [Rhodobacter sphaeroides] Length = 204 3005.2 Best-BlastP =>> nrprot 6 9% Identities = 74/164 (45%), Positives = 116/164 (70%), Gaps = 2/164 (1%) refINP_924145.1 I hypothetical protein g111199 [Gloeobacter violaceus] dbjIBAC89140.11 g111199 [Gloeobacter violaceus] Length = 175 3008.1 Best-BlastP =>> nrprot 55% Identities = 65/195 (33%), Positives = 114/195 (58%), Gaps = 1/195 (0%) refINP820992.1 l conserved hypothetical protein [ Coxiella burnetii RSA 493] gbIAAO91506.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 3009.2 Best-BlastP =>> nrprot No Hits found 3011.2 Best-BlastP =>> nrprot 49% Identities = 88/315 (27%), Positives = 164/315 (52%), Gaps = 27/315 (8%) refINP_819925.1 l hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90439.1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 324 Best-BlastP = >> nrprot 48% Identities = 48/152 (31%), Positives = 75/152 (49%), Gaps = 5/152 (3%) refINP_720010.11 acetyltransferase, GNAT family [Shewanella oneidensis MR-1] gb! AAN57454.1! AE015881_1 acetyltransferase, GNAT family [Shew anella oneidensis MR-1] Length = 154 Best-BlastP =>> nrprot 48% Identities = 57/192 (29%), Positives = 98/192 (51%), Gaps = 22/192 (11%) refINP656418.1 APS_kinase, Adenylylsulfate kinase [Bacillus anthracis A2012] refINP_844924.11 hypothetical protein [Bacillus anthracis str. Ames] gblAAP26410.11 hypothetical protein BA2556 [Bacillus anthracis str. Ames] Length = 186 3015.1 Best-BlastP =>> nrprot 50% Identities = 83/250 (33%), Positives = 124/250 (49%), Gaps = 7/250 (2%) refINP_656739.1 I Ubie_methyltran, ubiE / COQS methyltransferase family [Bacillus anthracis A2012] refINP_845200.1 conserved hypothetical protein [Bacillus anthracis str. Ames] [Bacillus anthracis str. Ames] Length = 254 3016.1 Best-BlastP =>> nrprot No Hits found 3017.1 Best-BlastP =>> nrprot No Hits found 3018.1 Best-BlastP =>> nrprot No Hits found 3022.1 Best- BlastP =>> nrprot No Hits found 3023.1 Best-BlastP =>> nrprot 58% Identities = 26/56 (46%), Positives = 41/56 (73%) refINP_832415.1 I Glutamate-rich protein grpB [Bacillus cereus ATCC 14579] gblAAP09616.11 Glutamate-rich protein grpB [Bacillus cereus ATCC 14579] Length = 168 3024.1 Best-BlastP =>> nrprot 76% Identities = 253/425 (59%), Positives = 326/425 (76%), Gaps = 2/425 (0%) refizP_00091804 .1 I COG0172: SeryltRNA synthetase [Azotobacter vinelandii] Length = 607 3027.1 Best-BlastP =>> nrprot 68% Identities = 86/149 (57%), Positives = 111/149 (74%) gbJAAM89273.11AF528189_2 SecB [Serratia marcescens ] Length = 156 3028.1 Best-BlastP =>> nrprot 75% Identities = 48/83 (57%), Positives = 64/83 (77%) refZGP_00089760.1 I COG0695: Glutaredoxin and related proteins [Azotobacter vinelandii] Length = 84 3030.2 Best-BlastP =>> nrprot 63% Iden tients = 70/163 (42%), Positives = 104/163 (63%), Gaps = 2/163 (1%) REFIZP_00021668.1 I COG2606: Uncharacterized preserved protein [Ralstonia metallidurans] Length = 165 3031.2 Best-BlastP = >> nrprot 42% Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 2/136 (1%) refINP_347707.11 Hypothetical protein [Clostridium acetobutylicum] pin ID97032 hypothetical protein CAC1073 [imported ] - Clostridium acetobutylicum gblAAK79047.11AE007622_9 Hypothetical protein [Clostridium acetobutylicum] Length = 152 3035.2 Best-BlastP =>> nrprot 62% Identities = 89/185 (48%), Positives = 120/185 (64%), Gaps = 9 / 185 (4%) refINP_753759.1 I Hypothetical protein ydcN [Escherichia coli CFT073] gbIAAN80321.11AE016760_180 Hypothetical protein ydcN [Escherichia coli CFT073] Length = 178 3013.2 3014.1 Best-BlastP =>> nrprot 46% Identities = 54/146 (36% Positive kinase from adenilate kinase family, FLAR-like protein ir1IH97205 probable kinase from adenilate family kinase, FLAR- like protein [imported] - Clostridium acetobutylicum gbjAAK80435. 11AE007747 4 Predicted kinase from adenilate kinase family, FLAR-like protein [Clostridium acetobutylicum] Length = 177 Best-BlastP =>> nrprot 21% Identities = 122/500 (24%), Positives = 202/500 (40%), Gaps = 87/500 (17%) gbIAAH16985.21 Unknown (protein for MGC: 21968) [Homo sapiens] Length = 579 Best-BlastP =>> nrprot 16% Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 20/146 (13%) gbIAAQ55479.11 hypothetical protein [Methanococcus voltae] Length = 178Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 58% Identities = 162/484 ( 33%), Positive = 261/484 (53%), Gaps = 46/484 (9%) gblAAP68896.1 1 putative N5'- nucleotidase [Oryza sativa (japonica cultivar-group)] Length = 569 Best-BlastP => > nrprot 26% Identities = 39/103 (37%), Positives = 50/103 (48%), Gaps = 10/103 (9%) pirjlF72654 hypothetical protein APE0666 - Aeropyrum pernix (strain K1) dbjjBAA79638.1 long hypothetical 1102aa protein [Aeropyrum pernix] 'Length = 102 Best-BlastP =>> nrprot 73% Identities = 131/210 (62%), Positives = 159/210 (75%) refINP_716775.1 I ribose-5-phosphate isomerase [Shewanella oneidensis MR-1] spIQ8EHR7jRPIA_SHEON Ribose 5-phosphate isomerase A (Phosphoriboisomerase A) (PRI) gblAAN54220. 1 jAE015559 4 ribose 5-phosphate isomerase [Shewanella oneidensis MR-1] Length = 219 Best-BlastP =>> nrprot 69% Identities = 133/239 (55%), Positives = 174/239 (72%), Gaps = 1 / 239 (0%) refNP_746983.1 J RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida KT2440] gbJAAN70447.1 JAE016686_1 RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida KT2440] Length = 248 305.2 Best-BlastP =>> nrprot 69% Identities = 124/236 (52%), Positives = 167/236 (70%) refINP820118.1 I dienelactone hydrolase family protein [Coxiella burnetii RSA 493] gbIAAO90632.11 dienelactone hydrolase family protein [Coxiella burnetii RSA 493] Length = 237 3053.3 Best-BlastP =>> nrprot 54% Identities = 40/122 (32%), Positives = 80/122 (65%), Gaps = 4/122 (3%) gblAAA29909.11 ORF 3 Length = 3054.3 BestBlastP =>> nrprot 59% Identities = 117/304 (38%), Positives = 170/304 (55%), Gaps = 27/304 (8%) refJZP_00067579.1 j COG2304: Uncharacterized protein containing von Willebrand factor type A (vWA) domain [Mic robulbifer degradans 2-40] Length = 658 3055.1 Best-BlastP =>> nrprot 52% Identities = 114/330 (34%), Positives = 164/330 (49%), Gaps = 35/330 (10%) refINP_718657. 1 J TPR domain protein [Shewanella oneidensis MR-1] gbJAAN56101.1 jAE015746_5 TPR domain protein [Shewanella oneidensis MR-1] Length = 679 3057.1 Best-BlastP =>> nrprot 61% Identities = 150/319 (47%), Positive = 213/319 (66%), Gaps = 9/319 (2%) RefGZP_00087368.1 COG2304: Uncharacterized protein containing von Willebrand factor type A (vWA) domain [Pseudomonas fluorescens PfO-1] Length = 3058.1 Best-BlastP =>> nrprot No Hits found 3036.2 304.2 3041.1 3042.1 3045.3 3046.3 3047.2 3049.1 Best-BlastP =>> nrprot 99% Identities = 258/259 (99%), Positives = 259/259 (100%) embjCAA06664.1! 29 kDa immunogenic protein [Legionella pneumophila] Length = 259 Best-BlastP =>> nrprot 75% Identities = 290/467 (62%), Positives = 356/467 (76%), Gaps = 1/467 (0%) refINP_254123 .1 Probable biotin 3059.2 306.1 carboxylase subunit of transcarboxylase [Pseudomonas aeruginosa PAOI] pir1IG82966 probable biotin carboxylase subunit of a transcarboxylase PA5436 [imported] - Pseudomonas aeruginosa (strain PAOI) gbjAAGO8821.11AE004956_5 probable biotin carboxylase subunit of a transcarboxylase [Pseudomonas aeruginosa PAO1 ] Length = 471 3060.1 Best-BlastP =>> nrprot No Hits found 3061.2 Best-BlastP =>> nrprot 72% Identities = 119/204 (58%), Positives = 156/204 (76%), Gaps = 2/204 (0%) COG2011: ABC-type metal ion transport system, permease component [Pseudomonas fluorescens PfO-1] Length = 224 Best-BlastP =>> nrprot 69% Identities = 174/343 (50%), Positives = 238/343 (69%), Gaps = 7/343 (2%) refINP_873575.1! D-methionine transport ATP-binding protein MetN [Haemophilus ducreyi 35000HP] gbJAAP95964.11 D-methionine transport ATP-binding protein Met [Haemophilus ducreyi 35000HP] Length = 344 Best-BlastP =>> nrprot 40% Identities = 39/138 (28 %), Positive = 63/138 (45%), Gaps = 15/138 (10%) refINP_520406.1 I PUTATIVE SIGNAL PROTEIN PEPTIDE [Ralstonia solanacearum] EmbICAD15992.1 I PUTATIVE SIGNAL PROTEIN PEPTIDE [Ralstonia solanacearum] Length = 143 Best -BlastP =>> nrprot 54% Identities = 27/100 (27%), Positives = 59/100 (59%), Gaps = 6/100 (6%) refINP820531.1 I hypothetical protein [Coxiella burnetii RSA 493] gblAAO91045 .1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 124 Best-BlastP =>> nrprot 84% Identities = 290/388 (74%), Positives = 331/388 (85%) refINP_800128.11 putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61961.11 putative acyl-CoA dehydrogenase [Vibrio parahaemolyticus] Length = 389 Best-BlastP =>> nrprot 55% Identities = 83/222 (37%), Posit ives = 126/222 (56%), Gaps = 4/222 (1%) refINP_819980.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90494.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 230 307.2 Best -BlastP =>> nrprot 47% Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 8/168 (4%) refINP_796502.1 I hypothetical protein VP0123 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC58386.1 hypothetical protein [Vibrio parahaemolyticus] Length = 180 3070.2 Best-BlastP =>> nrprot No Hits found 3072.2 Best-BlastP =>> nrprot 67% Identities = 300/598 (50%), Positives = 400/598 (66 %), Gaps = 9/598 (1%) refINP_637990.1 j ATP-dependent RNA helicase [Xanthomonas campestris pv. campestris str. ATCC 33913] gbIAAM41914.1 ATP-dependent RNA helicase [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 642 3074.1 Best-BlastP =>> nrprot No Hits found 3075.2 Best-BlastP =>> nrprot No Hits found 3063.2 3065.1 3067.1 3068.1 3069.1 Best-BlastP =>> nrprot 42% Identities = 66/214 (30% ), Positives = 103/214 (48%), Gaps = 18/214 (8%) refINP_355106.1 [AG Agrobacterium tumefaciens] C58 (U. Washington)] pirlJAH2839 conserved hypothetical protein Atu2144 [imported] - Agrobacterium tumefaciens (strain C58, Dupont) pirJJB97617 similar to orf3 gene in methylobacterium extorquenS [imported] - Agrobacterium tumefaciens (strain C58, Cereon) gblAAK87891.11 AGR_C_3887p [Agrobacterium tumefaciens str. C58 (Cereon)] gbJAAL43134.1 J conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 257 Best-BlastP =>> nrprot 53% Identities = 128/399 (32%), Positives = 219/399 (54%), Gaps = 38/399 (9%) refINP_071132. 1 j hypothetical protein [Archaeoglobus fulgidus DSM 4304] spJ027977JYN07_ARCFU Hypothetical protein AF2307 pirjJC69538 hypothetical protein AF2307 - Archaeoglobus fulgidus gbjAAB88957.1 I A. fulgidus predicted coding region AF2307 [Archaeoglobus fulgidus DSM 4304] Length 3080.2 Best-BlastP =>> nrprot 64% Identities = 210/490 (42%), Positives = 312/490 (63%), Gaps = 12/490 (2%) reflZP_00139612.1 I COG0189: Giutathione synthase / Ribosomal protein S6 enzyme modification (glutaminyl transferase) [Pseudomonas aeruginosa UCBPP - PA14] Length = 495 3081.2 Best-BlastP =>> nrprot No Hits found 3082.1 Best-BlastP =>> nrprot 67% Identities = 75/157 (47%), Positives = 106/157 (67%) refINP_231147.1 I hypothetical protein VC1506 [Vibrio cholerae 01 biovar eltor str. N16961] pirlIB82191 hypothetical protein VC1506 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbJAAF94661.1 J hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 158 3083.1 Best-BlastP =>> nrprot 48% Identities = 52/171 (30%), Positives = 90/171 (52%), Gaps = 1/171 (0%) refINP 404077.1 j osmotically inducible protein Y [Yersinia pestis] refINP_671042.1 J hyperosmotically inducible periplasmic protein [Yersinia pestis KIM] pirJJAF0053 osmotically inducible protein Y [imported] - Yersinia pestis (strain 0092) embJCAC89289.1 1 osmotically inducible Y protein [Yersinia pestis CO92] gbjAAM87293.11AE013978_5 hyperosmotically inducible periplasmic protein [Yersinia pestis KIM] Length = 204 3085.2 Best-BlastP =>> nrprot 84% Identities = 693/944 (73%), Positives = 805/944 (85%), Gaps = 4/944 (0%) refINP_819318.1 excinuclease ABC, A subunit [Coxiella burnetii RSA 493] gbJAAO89832.11 excinuclease ABC, A subunit [Coxiella burnetii RSA 493] Length = 954 3086.1 Best-BlastP =>> nrprot 78% Identities = 133/191 (69% ), Positive = 152/191 (79%) refAp_819577.1 J lemA protein [Coxiella burnetii RSA 493] gbJAAO90091.1 lemA protein [Coxiella burne tii RSA 493] Length = 192 3087.1 Best-BlastP =>> nrprot 77% Identities = 198/344 (57%), Positives = 265/344 (77%), Gaps = 6/344 (1%) refINP_819578.1 J heat shock protein HtpX [Coxiella burnetii RSA 493] gbJAAO90092.1 j heat shock protein HtpX [Coxiella burnetii RSA 493] Length = 348 3088.1 Best-BlastP =>> nrprot 71% Identities = 141/251 (56%), Positives = 185 / 251 (73%) RefGZP_00128291.1 J COG0842: ABC-type multidrug transport system, permease component [Pseudomonas syringae pv. syringae B728a] Length = 262 309.2 Best-BlastP =>> nrprot 67% Identities = 545/1113 (48%), Positives = 752/1113 (67%), Gaps = 2/1113 (0%) refINP_820221.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90735.1 J conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 3091.1 Best-BlastP =>> nrprot No Hits found 3077.1 3078.2 3093.1 Best-BlastP =>> nrprot 73% Identities = 139/243 (57%), Positives = 185/243 (76%), Gaps = 2/243 (0%) refINP_928570.1 tRNA (guanine-N1 -) - methyltransferase (MIG-methyltransferase) [Photorhabdus luminescens subsp. laumondii TTOI] embEAE13553.11 tRNA (guanine-NI -) - methyltransferase (MIG-methyltransferase) [Photorhabdus luminescens subsp. laumondii TTO1] Length = 250 3095.1 Best-BlastP =>> nrprot 61% Identities = 65/169 (38%), Positives = 105/169 (62%), Gaps = 7/169 (4%) refI NP_716978.1 116S rRNA processing protein RimM [Shewanella oneidensis MR-1] gblAAN54423.1 1AE015579_12 16S rRNA processing protein RimM [Shewanella oneidensis MR-1] Length = 177 3096.1 Best-BlastP =>> nrprot 74% Identities = 51/85 (60%), Positive = 65/85 (76%) refINP_841705.1 Ribosomal protein S16 [Nitrosomonas europaea ATCC 19718] embjCAD85582.1 1 Ribosomal protein S16 [Nitrosomonas europaea ATCC 19718] Length = 89 3097.3 Best-BlastP =>> nrprot 79% Identities = 299/447 (66%), Positives = 365/447 (81%), Gaps = 1/447 (0%) refINP 716976.1 Signal recognition 310.1 3101.1 3102.2 Fe2 + / Zn2 + uptake regulation proteins [Pseudomonas fluorescens PfO-1] Length = 160 3104.2 Best-BlastP =>> nrprot 38% Identities = 208/652 (31%), Positives = 329/652 (50%), Gaps = 68/652 (10%) refINP_717300.11 cation transport ATPase, E1-E2 family [Shewanella oneidensis MR-1] gbjA AN54744. 11AE015614_11 ATPase transport cation, E1-E2 family [Shewanella oneidensis MR-1] Length = 753 3105.2 Best-BlastP =>> nrprot 41% Identities = 26/69 (37%), Positives = 42/69 (60%) refZIP_00117353. 11 COG0642: Signal transduction histidine kinase [Cytophaga hutchinsonii] Length = 856 3106.2 Best-BlastP =>> nrprot 36% Identities = 149/353 (42%), Positives = 220/353 (62%), Gaps = 3/353 ( 0%) refINP_442598.1 j PIeD gene product homologue [Synechocystis sp. PCC 6803] pirlIS76977 pleD-4 protein - Synechocystis sp. (strain PCC 6803) dbjJBAA10669.1 I s1r0302 [Synechocystis sp. PCC 6803] Length = 768 3107.2 Best-BlastP =>> nrprot No Hits found 3109.2 Best-BlastP =>> nrprot 55% Identities = 39/100 (39%), Positives = 63/100 (63%), Gaps = 1 / 100 (1%) refINP 455037.1 I cytochrome o ubiquinol oxidase C subunit [Salmonella enterica subsp. enterica serovar Typhi] refINP_459436.1 f cytochrome o ubiquinol oxidase subunit IV [Salmonella typhimurium LT2] refINP_806150.1 f cytochrome o ubiquinol oxidase C subunit [Salmonella enterica subsp. enterica serovar Typhi Ty2] pirffACO557 cytochrome o ubiquinol oxidase C chain [imported] - Salmonella enterica subsp.

  enterica serovar Typhi (strain CT18) gblAAL19395.1 1 cytochrome o ubiquinol oxidase subunit IV [Salmonella typhimurium LT2] embfCAD08899.1 f cytochrome o ubiquinol oxidase C subunit [Salmonella enterica subsp. enterica serovar Typhi] gbfAAO70010.1 cytochrome o ubiquinol oxidase C subunit [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 109 particle protein Ffh [Shewanella oneidensis MR-1] gbIAAN54421. 11AE015579_10 signal recognition particle protein Ffh [Shewanella oneidensis MR-1] Length = 457 Best-BlastP =>> nrprot No Hits found BestBlastP =>> nrprot 12% Identities = 46/178 (25%), Positives = 78/178 (43 %), Gaps = 12/178 (6%) gbTAAQ73211.1! M protein [Streptococcus pyogenes] Length = 243 Best-BlastP =>> nrprot 50% Identities = 61/141 (43%), Positives = 80/141 (56%), Gaps = 3/141 (2%) refIZP_00084504.1 ## EQU1 ## 1 I cytochrome and ubiquinol oxidase, subunit III [Coxiella burnetii RSA 493] Length = 198 3113.1 Best-BlastP =>> nrprot 85% Identities = 482/665 (72%), Positives = 568/665 (85%), Gaps = 3/665 (0%) refINP_820041.1 J cytochrome o ubiquinol oxidase, subunit I [Coxiella burnetii RSA 493] gbJAAO90555.1 l cytochrome o ubiquinol oxidase, subunit I [Coxiella burnetii RSA 493] Length = 668 3114.2 Best-BlastP => > nrprot 69% Identities = 173/292 (59%), Positives = 222/292 (76%), Gaps = 10/292 (3%) refINP_820042.1 I cytochrome and ubiquinol oxidase, subunit II [Coxiella burnetii RSA 493] gblAAO90556.1 I cytochrome o ubiquinol oxidase, subunit II [ Coxiella burnetii RSA 493] Length = 298 3116.2 Best-BlastP =>> nrprot 80% Identities = 82/130 (63%), Positives = 106/130 (81%) refINP820044.1 I hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90558 .1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 133 3117.2 Best-BlastP =>> nrprot 68% Identities = 116/211 (54%), Positives = 152/211 (72%), Gaps = 2/211 ( 0%) reflZ_00085665.11 COG0323: DNA mismatch repair enzyme (predicted ATPase) [Pseudomonas fluorescens PfO-1] Length = 262 3118.1 Best-BlastP =>> nrprot No Hits found 3119.1 Best-BlastP =>> nrprot 61% Identities = 111 / 264 (42%), Positives = 162/264 (61%), Gaps = 7/264 (2%) refINP_794780.1 Pyrroline-5-carboxylate reductase [Pseudomonas syringae pv. tomato str. DC3000] gbIAAO58475.11 pyrroline-5-carboxylate reductase [Pseudomonas syringae pv. tomato str. DC3000] Length = 272 312.3 Best-BlastP =>> nrprot No Hits found 3121.2 Best-BlastP =>> nrprot 67% Identities = 119/225 (52%), Positives = 156/225 (69%) reflZP_00089980.1 I COG0325 : Predicted enzyme with a TIM-barrel fold [Azotobacter vinelandii] Length = 234 3124.2 Best-BlastP =>> nrprot 88% Identities = 258/345 (74%), Positives = 305/345 (88%) refINP_638103.1 I twitching motility protein [Xanthomonas campestris pv. campestris str. ATCC 33913] refINP_643233.1 twitching motility protein [Xanthomonas axonopodis pv. citri str.

  306] gbJAAM37769.1 I twitching motility protein [Xanthomonas axonopodis pv. citri str. 306] gbIAAM42027.1 J twitching motility protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 345 3127. 1 Best-BlastP =>> nrprot 99% Identities = 235/235 (100%), Positives = 235/235 (100%) spIQ9X528IRNPH_LEGPN Ribonuclease PH (RNase PH) (tRNA nucleotidyltransferase) gbIAAD28218. 11AF120720_1 ribonuclease PH [Legionella pneumophila] Length = 235 Best-BlastP =>> nrprot 57% Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 13/172 (7%) refINP_747016. I = conserved hypothetical protein [Pseudomonas putida KT2440] gbIAAN70480.1 IAE016689_8 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 172 Best-BlastP =>> nrprot 73% Identities = 195/336 (58%), Positives = 247/336 ( 73%) refINP_252513.1 J Sadenosylmethionine: trna ribosyltransferase-isomerase [Pseudomonas aeruginosa PA01] spIQ9HXH8IQUEA_PSEAE S-adenosylmethionine: tRNA ribosyltransferase-isomerase (Queuosine biosynthesis protein thanA) pin 1A83170 S-adenosylmethionine-tRNA ribosyltransferase-isomerase (EC 5.4.99.- ) thatA PA3824 [similarity] - Pseudomonas aeruginosa (strain PAOI) gbIAAG07211. ## EQU1 ## Gaps = 3/100 (3%) refINP 562861.1 queuine tRNAribosyltransferase [Clostridium perfringens] spIQ8XJ16ITGT_CLOPE Queuin tRNA-ribosyltransferase (tRNA-guanine transglycosylase) (Guanine Insertion Enzyme) dbjIBAB81651.1 I queuine tRNA-ribosyltransferase [Clostridium perfringens str. 13] Length = 380 3131.1 Best-BlastP =>> nrprot 68% Identities = 53/111 (47%), Positives = 77/111 (69%) COG1862: Preprotein translocase subunit YajC [Pseudomonas fluorescens PfO-1 ] Length = 111 3132.1 Best-BlastP =>> nrprot No Hits found 3133.2 Best-BlastP =>> nrprot No Hits found 3134.1 Best-BlastP =>> nrprot 57% Identities = 65/150 (43%), Positives = 91 / 150 (60%), Gaps = 6/150 (4%) refINP 419685.11 hypothetical protein [Caulobacter crescentus CB15] pirIIA87357 hypothetical protein 000868 [imported] - Caulobacter crescentus gbIAAK22853.1I hypothetical protein [Caulobacter crescentus CB15] Length = 196 3135.1 Best- BlastP =>> nrprot 69% Identities = 43/63 (68%), Positives = 49/63 (77%) COG4728: Uncharacterized Protein Preserved in Bacteria [Microbulbifer degradans 2-40] Length = 93 3136.1 Best- BlastP =>> nrprot 54% Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 2/105 (1%) gbIAAN62313.1 1AF440524_100 conserved hypothetical protein [Pseudomonas s aeruginosa] Length = 130 3137.1 Best-BlastP =>> nrprot No Hits found 3138.2 Best-BlastP =>> nrprot No Hits found 3142.2 Best-BlastP =>> nrprot 53% Identities = 106/281 (37%), Positives = 158/281 (56%), Gaps = 19/281 (6%) REFGP_00065061.1 COG3951: Rod binding protein [Microbulbifer degradans 2-40] Length = 318 3145.1 Best-BlastP =>> nrprot No Hits found 3146.2 Best- BlastP =>> nrprot 48% Identities = 74/241 (30%), Positive = 122/241 (50%), Gaps = 7/241 (2%) refINP_928923.1 1 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] embICAE13928.1I unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 279 3147.1 Best-BlastP =>> nrprot 78% Identities = 107/158 (67%), Positives = 127/158 (80%) refINP 439483.1 I transcription elongation factor [Haemophilus influenzae Rd] spIP43881 IGREA_HAEIN Transcription elongation factor greA (Transcript cleavage factor greA) 011E364117 transcription elongation factor greA - Haemophilus influenzae (strain Rd KW20) gbIAAC22976.1 I transcription elongation factor (greA) [Haemophilus influenzae Rd] Length = 158 3148.1 Best-BlastP =>> nrprot 55% Identities = 101/297 (34%), Positive = 150/297 (50%), Gaps = 36/297 (12%) refINP_842462.1 Prescribed hypothetical protein [Nitrosomonas europaea ATCC 19718] ATCC 19718] Length = 304 3149.1 Best-BlastP =>> nrprot 36% Identities = 69/341 (20%), Positives = 132/341 (38%), Gaps = 53/341 (15%) refINP_616447.1 J Hypothetical protein (multi-domain) [Methanosarcina acetivorans str. C2A] gbIAAM04927.11 hypothetical protein (multidomain) [Methanosarcina acetivorans str. C2A] Length = 584 315.3 Best-BlastP =>> nrprot 37% Identities = 97/212 (45%), Positives = 127/212 (59%) gbIAAO50865.1 Similar to Leishmania major. Ppg3 [Dictyostelium discoideum] Length = 374 3150.1 Best-BlastP =>> nrprot 60% Identities = 94/212 (44%), Positives = 138/212 (65%), Gaps = 3/212 (1%) refINP819377.1 J acid phosphatase, class B [Coxiella burnetii RSA 493] gblAAO89891.11 acid phosphatase, class B [Coxiella burnetii RSA 493] Length = 221 Best-BlastP =>> nrprot 98% dentities = 174/177 (98%), Positives = 176/177 (99%) gbIAAM00398.11AF386079_8 CcmG [Legionella pneumophila] Length = 177 Best-BlastP =>> nrprot 99% Identities = 643/650 (98%), Positives = 649/650 (99%) gblAAM00397.11AF386079_7 CcmF [Legionella pneumophila] Length = 650 Best-BlastP =>> nrprot 98% dentities = 142/143 (99%), Positives = 142/143 (99%) gbIAAM00396.11AF386079_6 CcmE [Legionella pneumophila] Length = 143 Best-BlastP = >> nrprot 97% Identities = 72/73 (98%), Positives = 72/73 (98%) gbIAAM00395. 11AF386079_5 CcmD [Legionella pneumophila] Length = 73 Best-BlastP =>> nrprot 98% dentities = 247/251 (98%), Positives = 249/251 (99%) gblAAM00394.1 JAF386079_4 CcmC [Legionella pneumophila] Length = 251 Best - BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 44% Identities = 60/224 (26%), Positives = 103/224 (45%), Gaps = 13/224 (5%) gbjAAK18828.1 . 1AF327739_5 Peb1 [Streptococcus thermophilus] Length = 277 Best-BlastP =>> nrprot 69% Identities = 49/91 (53%), Positives = 68/91 (74%) gblAAP83334. 1 1AF469614_2 unknown [Francisella tularensis subsp. tularensis] Length = 94 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 65% Identities = 99/176 (56%), Positives = 127/176 (72%), Gaps = 2/176 ( 1%) refINP_903124.1 probable DNA-directed DNA polymerase, bacteriophage-type [Chromobacterium violaceum ATCC 12472] gbIAAQ61115.11 probable DNA-directed DNA polymerase, bacteriophage-type [Chromobacterium violaceum ATCC 12472] Length = 280 3167.1 Best-BlastP => > nrprot 63% Identities = 199/415 (47%), Positives = 270/415 (65%), Gaps = 4/415 (0%) refINP_820906. 1 transport, putative [Coxiella burnetii RSA 493] gbJAAO91420.1 I transport, putative [Coxiella burnetii RSA 493] Length = 435 3169.1 Best-BlastP =>> nrprot 50% Identities = 90/186 (48%), Positive = 122 / 186 (65%), Gaps = 3/186 (1%) refINP_926264.1 I unknown protein [Gloeobacter violaceus] dbjIBAC91259.1 I glr3318 [Gloeobacter violaceus] Length = 228 317.1 Best-BlastP =>> nrprot 59% Identities = 142/362 (39%), Positives = 202/362 (55%), Gaps = 33/362 (9%) reflZP_00069313.11 COG0517: FOG: CBS domain [Oenococcus oeni MCW] Length = 382 3172.2 Best-BlastP => > nrprot 68% Identities = 118/270 (43%), Positives = 188/270 (69%), Gaps = 5/270 (1%) COG1752: Predicted esterase of alpha-beta hydrolase superfamily [Rhodospirillum rubrum] Length = 369 3173.1 Best-BlastP =>> nrprot 63% dentities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 3/88 (3%) refJZP_00068002.1 j hypothetical protein [Microbulbifer degradans 2-40] Length = 128 3174.1 Best-BlastP =>> nrprot 53% Identity es = 100/270 (37%), Positives = 155/270 (57%), Gaps = 1/270 (0%) refINP_903183.1 I conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gb! AAQ61174.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 276 3152.1 3153.3 3157.1 3158.1 3159.2 3160.1 3161.1 3163.1 3165.1 3166.1 3175.1 Best-BlastP =>> nrprot 35% Identities = 51/201 (25%), Positives = 92/201 (45%), Gaps = 3/201 (1%) refINP_903184.1 I conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ61175.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 255 3177.1 Best-BlastP =>> nrprot 54% Identities = 64 / 138 (46%), Positives = 84/138 (60%), Gaps = 14/138 (10%) refINP903185.1! conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ61176.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 145 3178.1 Best-BlastP =>> nrprot 72% Identities = 124/219 (56%), Positives = 157/219 ( 71%), Gaps = 4/219 (1%) REFIGP_00066950.1 I COG0036: Pentose-5-phosphate-3-epimerase [Microbulbifer degradans 2-40] Length = 228 3179.1 Best-BlastP =>> nrprot 47% Identities = 179 / 574 (31%), Positives = 288/574 (50%), Gaps = 25/574 (4%) ReflZP_00067610.1 COG0741: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM / invasin domains) [Microbulbifer degradans 2-40] Length = 669 318.2 Best-BlastP =>> nrprot 76% Identities = 266/465 (57%), Positives = 361/465 (77%), Gaps = 7/465 (1%) refINP902486.1 l Probably PhoH-related protein [Chromobacterium violaceum ATCC 12472] gblAAQ60484.11 Probable PhoH-related protein [Chromobacterium violaceum ATCC 12472] Length = 467 3181.2 Best-BlastP =>> nrprot 66% Identities = 1 54/327 (47%), Positives = 218/327 (66%) refIZP_00016063.11 COG0842: ABC-type multidrug transport system, component permease [Rhodospirillum rubrum] Length = 371 3184.3 Best-BlastP =>> nrprot 71% Identities = 221/407 (54%), Positives = 299/407 (73%), Gaps = 7/407 (1%) refINP_820219.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90733.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 445 3186.2 Best-BlastP =>> nrprot 71% Identities = 622/1145 (54%), Positives = 830/1145 (72%), Gaps = 9/1145 (0%) refINP_791924.1 I transcription- repair coupling factor [Pseudomonas syringae pv. tomato str. DC3000] gblAAO55619.11 transcription-repair coupling factor [Pseudomonas syringae pv. tomato str. DC3000] Length = 1150 3190.1 Best-BlastP =>> nrprot 42% Identities = 89/233 (38%), Positives = 127/233 (54%), Gaps = 2/233 (0%) refINP_519922.1 I GALA PROTEIN 3 [Ralstonia solanacearum] Length = 522 3191.1 Best-BlastP =>> nrprot No Hits found 3193.2 Best-BlastP =>> nrprot 50% Identities = 77/223 (34%), Positives = 116/223 (52%), Gaps = 7/223 (3%) spIP57974JRECO_PASMU DNA repair protein recO (Recombination protein O) Length = 240 3196.3 Best-BlastP =>> nrprot 65% Identities = 225/478 (47%), Positive = 330/478 (69%) , Gaps = 2/478 (0%) refINP_462493.11 putative POT family, peptide transport protein [Salmonella typhimurium LT2] gb1AAL22452.1 J putative POT family peptide transport protein [Salmonella typhimurium LT2] Length = 489 3198.1 Best-BlastP =>> nrprot 54% Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 1/174 (0%) RefGZP_00081025.1 J COG0558: Phosphatidylglycerophosphate synthase [Geobacter metallireducens] Length = 198 3199.1 Best- BlastP =>> nrprot 98% Identities = 561/575 ( 97%), Positive = 566/575 (98%) gbJAAC44717.1 J FrgA [Legionella pneumophila] Length = 575 3201.1 Best-BlastP =>> nrprot 81% Identities = 451/609 (74%), Positive = 520/609 (85%), Gaps = 3/609 (0%) refINP_820341.1 ATP-dependent metalloprotease FtsH [Coxiella burnetii RSA 493] gblAΔO90855.11 ATPdependent metalloprotease FtsH [Coxiella burnetii RSA 493] Length = 647 3205.3 3207.5 histidine kinase / response regulator [Coxiella burnetii RSA 493] gblAAO90323.1 sensory box histidine kinase / response regulator [Coxiella burnetii RSA 493] Length = 808 Best-BlastP =>> nrprot 46% Identities = 466/1207 (38%), Positive = 682 / 1207 (56%), Gaps = 45/1207 (3%) embICAC01603.11 peptide synthetase [Anabaena sp. 90] Length = 2258 Best-BlastP =>> nrprot 50% Identities = 247/840 (29%), Positives = 419/840 (49%), Gaps = 91/840 (10%) refINP_819809.1 I sensory box Best - BlastP =>> nrprot 22% Identities = 44/165 (26%), Positives = 67/165 (40%), Gaps = 22/165 (13%) pirllT18253 probable mitochondrial carrier protein - yeast (Candida albicans) embICAA22027. 1 putative mitochondrial carrier protein [Candida albicans] Length = 284 Best-BlastP =>> nrprot 45% Identities = 64/206 (31%), Positives = 105/206 (50%), Gaps = 11/206 (5% refIp_389092.1 I similar to endo-1,4-beta-xylanase [Bacillus subtilis] spIO34798IYJEA_BACSU Hypothetical protein yjeA precursor pirIIG69849 endo1,4-beta-xylanase homolog yjeA - Bacillus subtilis gblAAC46306.11 NodBlike protein [Bacillus subtilis] emblCAB13067.1l yjeA [Bacillus subtilis subsp. subtilis str. 168] Length 467 3217.3 Best-BlastP =>> nrprot 79% Identities = 261/396 (65%), Positives = 314/396 (79%), Gaps = 3/396 (0%) refINP_819161.11 2-amino- 3-ketobutyrate coenzyme A ligase [Coxiella burnetii RSA 493] gbIAAO89675.1 12-amino-3-ketobutyrate coenzyme A ligase [Coxiella burnetii RSA 493] Length = 396 3218.1 Best-BlastP =>> nrprot 59% Identities = 94/211 44%), Positive = 129/211 (61%) refINP_840138.1 I possible pcm; protein-L-isoaspartate omethyltransferase [Nitrosomonas europaea ATCC 19718] may be possible; protein-L-isoaspartate o-methyltransferase [Nitrosomonas europaea ATCC 19718] Length = 218 322.3 Best-BlastP =>> nrprot No Hits found 3221.1 Best-BlastP =>> nrprot 62% Identities = 187/450 (41%), Positives = 275/450 (61%), Gaps = 16/450 (3%) refINP_819109.1! outer membrane protein ToIC, putative [Coxiella burnetii RSA 493] gblAAO89623.11 outer membrane protein ToIC, putative [Coxiella burnetii RSA 493] Length = 616 3223.1 Best-BlastP =>> nrprot 74% Identities = 182/248 (73%), Positive = 212/248 (85%) refINP_820067.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90581.1! conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 256 3224.3 Best-BlastP =>> nrprot 62% Identities = 316/713 (44%), Positives = 464/713 (65%), Gaps = 14/713 (1% ) refINP_869762.1 Probable sulfate transport [Pirellula sp.] embICAD77140.1 Probable sulfate transport [Pirellula sp.] Length = 768 3226.2 Best-BlastP =>> nrprot 50% Identities = 28/64 (43%), Positives = 44/64 (68%) gbIAAP78483.1 I C.Ahdl [Aeromonas hydrophila] Length = 74 3228.1 Best-BlastP =>> nrprot 70% Identities = 40/66 (60%), Positives = 49/66 (74%) , Gaps = 1/66 (1%) refIZP_00067276.1! COG1278: Cold shock proteins [Microbulbifer degradans 2-40] Length = 71323.2 Best-BlastP =>> nrprot No Hits found 3230.1 Best-BlastP =>> nrprot No Hits found 321.3 3212.2 3231.1 Best-BlastP =>> nrprot 56% Identities = 25/52 (48%), Positive = 31/52 (59%) refINP_143190.11 hypothetical protein PH1305 [Pyrococcus horikoshii] pirlIA71001 hypothetical protein PH1305 Pyrococcus horikoshii dbjlBAA30409.1 l 252aa long hypothetical protein [Pyrococcus horikoshii] Length = 252 3232.1 Best -BlastP =>> nrprot No Hits found 3233.1 Best-BlastP =>> nrprot 19% Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 1/98 (1%) refzZP_00106280. 1 j COG2197: Response regulator containing a Chey-like receptor domain and an HTH DNA-binding domain [Nostoc punctiform] Length = 210 3234.3 Best-BlastP =>> nrprot 53% Identities = 71/228 (31%), Positive = 125 / 228 (54%), Gaps = 1/228 (0%) refINP_928824.1 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTOI] emblCAE13825.11 unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 231 3235.3 Best-BlastP =>> nrprot 66% Identities = 89/162 (54%), Positive = 120/162 (74%) refINP_311228.1 The hypothetical protein [Escherichia coli O157: H7] refINP_416820. 1 I orf, hypothetical protein [Escherichia coli K12] spIP09548IDEDA_ECOLI DedA protein (DSG-1 protein) pirIIXMECAD dedA protein - Escherichia coli (strain K-12) pir1IA98029 hypothetical protein ECs3201 [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) gbjAAA23964.1 J dedA gb1AAC75377. 1 I orf, hypothetical protein [Escherichia coli K12] dbjJBAA16174.1 dedA protein [Escherichia coli] dbjIBAB36624.1 l hypothetical protein [Escherichia coli O157: H7] Length = 219 3236.3 Best-BlastP =>> nrprot No Hits found 3238.1 Best- BlastP =>> nrprot 67% Identities = 134/263 (50%), Positives = 195/263 (74%), Gaps = 1/263 (0%) refINP_421700.1 conserved hypothetical protein [Caulobacter crescentus CB15] pir1IH87608 conserved hypothetical protein CC2906 [imported] - Caulobacter crescentus gb1AAK24868.1 conserved hypothetical protein [Caulobacter crescentus CB15] Length = 289 3239.1 Best-BlastP =>> nrprot 58% Identities = 31/85 (36%), Positive = 57/85 ( 67%), Gaps = 2/85 (2%) refINP820572.1 I hypothetical protein [Coxiella burnetii RSA 493] gbIAAO91086.1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 102 324.3 Best-BlastP =>> nrprot 72% Identities = 106/224 (47%), Positives = 160/224 (71%), Gaps = 5/224 (2%) COG2200: FOG: EAL domain [Magnetococcus sp. MC-1] Length = 577 3240.3 Best-BlastP =>> nrprot 52% Identities = 24/64 (37%), Positive = 42/64 (65%) refINP_458973.1 Putative periplasmic protein [Salmonella enterica subsp. enterica serovar Typhi] refjNP 463417.11 hyperosmotically inducible periplasmic protein, RpoS-dependent stationary phase gene [Salmonella typhimurium LT2] refINP_808176.1 l Putative periplasmic protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] pirIIAE1072 Putative periplasmic protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gblAAL23376.11 hyperosmotically inducible periplasmic protein [Salmonella typhimurium LT2] embICAD03396.1 J Putative periplasmic protein [Salmonella enterica subsp. enterica serovar Typhi] gblAAO72036.1 1 Putative periplasmic protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 205 3242.3 Best-BlastP =>> nrprot 14% Identities = 72/325 (22%), Positives = 126/325 (38%), Gaps = 37/325 (11%) gblAAB96623.1 I spheroidin [Heliothis armigera entomopoxvirus] Length = 1007 3243.1 Best-BlastP =>> nrprot No Hits found 3244.2 Best-BlastP =>> nrprot 60% Identities = 102/241 (42%), Positives = 153/241 (63%) , Gaps = 2/241 (0%) refINP_465213.1 similar to glucose 1 dehydrogenase [Listeria monocytogenes EGD-e] pirllAH1285 glucose 1-dehydrogenase homolog! Mol 688 [imported] Listeria monocytogenes (strain EGD-e) embICAC99766.1 I Imo1688 [Listeria monocytogenes] Length = 248 3246.2 Best-BlastP =>> nrprot 24% Identities = 100/360 (27%), Positives = 160/360 (44%), Gaps = 67/360 (18%) refINP_905966.1 I conserved hypothetical protein [Porphyromonas gingivalis W83] gbIAAQ66865.11 conserved hypothetical protein [Porphyromonas gingivalis W83] Length = 339 3248.1 Best-BlastP =>> nrprot 38% Identities = 87/154 (56%), Positive = 114/154 (74% ) refIZP_00111795 .1 j COG0784: FOG: Chey-like receiver Length = 557 3249.2 Best-BlastP =>> nrprot 13% Identifies = 22/55 (40%), Positive = 29/55 (52%) refINP_798062.1 I hypothetical protein VP1683 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC59946.1 I hypothetical protein [Vibrio parahaemolyticus] Length = 325 325.1 Best-BlastP =>> nrprot No Hits found 3250.1 Best-BlastP =>> nrprot No Hits found 3251.1 Best-BlastP = >> nrprot 48% Identities = 39/131 (29%), Positives = 65/131 (49%), Gaps = 3/131 (2%) embICACO5487.11 YcfB protein [Erwinia amylovora] Length = 132 3252.1 Best-BlastP =>> nrprot No Hits found 3257.2 Best-BlastP =>> nrprot 46% Identities = 40/122 (32%), Positives = 70/122 (57%), Gaps = 4/122 (3%) refINP_755556.1 Hypothetical protein [Escherichia coli CFT073] gblAAN82129.11AE016766_217 Hypothetical protein [Escherichia coli CFT073] Length = 131 3258.2 Best-BlastP =>> nrprot 35% Identities = 70/225 (31%), Positives = 111/225 (49%), Gaps = 27/225 (12%) refINP_755557.1 I Hypothetic al protein [Escherichia coli CFT073] gbIAAN82130.11AE016766_218 Hypothetical protein [Escherichia coli CFT073] Length = 305 326.2 Best-BlastP =>> nrprot No Hits found 3260.2 Best-BlastP =>> nrprot No Hits found 3263.2 Best-BlastP =>> nrprot 6l / o Identities = 128/368 (34%), Positives = 227/368 (61%), Gaps = 10/368 (2%) refINP819469.1 Major facilitator family transporter [Coxiella burnetii RSA 493] gblAAO89983.1 I major facilitator family transporter [Coxiella burnetii RSA 493] Length = 428 3265.1 Best-BlastP =>> nrprot 65% Identities = 140/293 (47%), Positives = 195/293 (66%), Gaps = 2/293 (0 %) refINP_820459.1 I hydrogen peroxideinducible genes activator OxyR [Coxiella burnetii RSA 493] gblAAO90973.1 I hydrogen peroxide-inducible genes activator OxyR [Coxiella burnetii RSA 493] Length = 311 3267.1 Best-BlastP =>> nrprot 50% Identities = 57 / 258 (22%), Positives = 104/258 (40%), Gaps = 75/258 (29%) ref1NP_797353.1 I hypothetical protein VP0974 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC 59237.1 I hypothetical protein [Vibrio parahaemolyticus] Length = 269 Best-BlastP =>> nrprot 55% Identities = 400/1113 (35%), Positives = 600/1113 (53%), Gaps = 64/1113 (5%) refINP_820225 .1 J UvrD / REP helicase family protein [Coxiella burnetii RSA 493] gblAAO90739.11 UvrD / REP helicase family protein [Coxiella burnetii RSA 493] Length = 1110 3269.1 327.2 Best-BlastP =>> nrprot 70% Identities = 364/616 59%), Positives = 458/616 (74%), Gaps = 7/616 (1%) refIZP_00141174.1 j hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] Length = 645 3271.3 Best-BlastP =>> nrprot 46% Identities = 187/674 (27%), Positives = 308/674 (45%), Gaps = 55/674 (8%) ReflNP_437090.1 I putative membrane-located cell surface saccharide saccharide acetylase protein [Sinorhizobium meliloti] pirllF95910 probable membrane- saccharide saccharide acetylase protein [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB IcerICAC48950.1 I putative membrane-located cell surface saccharide saccharide acetylase protein [Sinorhizobium meliloti] Length = 677 3272.1 Best-BlastP =>> nrprot 55% Identities = 49/148 (33%), Positives = 82/148 (55%), Gaps = 14/148 (9%) REFINP [Coxiella burnetii RSA 493] gblAAO91356.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 3273.1 Best-BlastP =>> nrprot 40% Identities = 34/95 (35%), Positive = 50/95 (52%), Gaps = 4/95 (4%) refINP_930855.1 J hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] embyCAE16020.1 unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTOI] Length = 175 3275.1 Best-BlastP =>> nrprot No Hits found 3276.2 Best-BlastP =>> nrprot No Hits found 3277.2 Best-BlastP =>> nrprot 61% Identities = 109/264 (41%), Positives = 165/264 (62%), Gaps = 5/264 (1%) refJZP 00055240.1 COG1073: Hydrolases of the alpha / beta superfamily [Magnetospirillum magnetotacticum] Length = 297 3278.1 Best-BlastP =>> nrprot 28% Identities = 19/43 (44%), Positives = 28/43 (65%) ReflNP_523079.1 CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] EmbJCAD18671.11 CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 232 328.1 Best-BlastP =>> nrprot 68% Identities = 161/292 (55%), Positives = 206/292 (70%), Gaps = 3/292 (1%) refJNP_770597.1 J 3-hydroxyisobutyrate dehydrogenase [Bradyrhizobium japonicum] dbjIBAC49222.1! 3-hydroxyisobutyrate dehydrogenase [Bradyrhizobium japonicum USDA 110] Length = 295 3280.1 Best-BlastP =>> nrprot 54% Identities = 101/267 (37%), Positives = 156/267 (58%), Gaps = 18/267 (6) %) refJNP_631554.11 conserved hypothetical protein [Streptomyces coelicolor A3 (2)] embJCAC44686.1 J conserved hypothetical protein [Streptomyces coelicolor A3 (2)] Length = 277 3281.1 Best-BlastP =>> nrprot No Hits found 3282.3 Best-BlastP = >> nrprot 82% Identities = 289/413 (69%), Positives = 341/413 (82%), Gaps = 4/413 (0%) refJNP819190.1 J cell division FtsA protein [Coxiella burnetii RSA 493] gbJAAO89704. 1 J cell division protein FtsA [Coxiella burnetii RSA 493] Length = 410 3283.1 Best-BlastP =>> nrprot 50% Identities = 72/220 (32%), Positives = 120/220 (54%), Gaps = 1/220 (Reft. 7.11AE004856_8 eye division protein FtsQ [Pseudomonas aeruginosa PAOI] Length = 287 3285.3 Best-BlastP =>> nrprot 48% Identities = 106/303 (34%), Positives = 174/303 (57%), Gaps = 1/303 ( 0%) refJZP_00032705.1 J COG0642: Signal transduction histidine kinase [Burkholderia fungorum] Length = 535 3288.3 Best-BlastP =>> nrprot 71% Identities = 120/221 (54%), Positives = 161/221 (72%) reflZP_00080602 .1 I COG0745: Response regulators consisting of a Chey-like receptor and a winged-helix DNA-binding domain [Geobacter metallireducens] Length = 3290.1 Best-BlastP =>> nrprot No Hits found 3291.2 Best-BlastP =>> nrprot No Hits found 3295.2 Best-BlastP =>> nrprot 77% Identities = 563/923 (60%), Positives = 715/923 (77%), Gaps = 5/923 (0%) ref1ZP_00066862.1 I COG0525: ValyltRNA synthetase [ Microbulbifer degradans 2-40] Length = 922 3297.3 Best-BlastP =>> nrprot 36% Identities = 75/282 (26%), Positives = 129/282 (45%), Gaps = 11/282 (3%) refJNP_603055. 13-oxoacyl- [acylcarrierprotein] synthase III [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gblAAL94354.11 3-oxoacyl- [acyl-carrier-protein] synthase III [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 328 3299.3 Best-BlastP =>> nrprot 36% Identities = 36/137 (26%), Positives = 51/137 (37%), Gaps = 37/137 (27%) refJZP_00014317.1 I hypothetical protein [Rhodospirillum rubrum] Length = 417 33.1 Best-BlastP =>> nrprot 87% Identities = 711/878 (80%), Positives = 774/878 (88%), Gaps = 16/878 (1%) gblAAG45149. 1! TraA-like protein [Legionella pneumophila] Length = 883 330.2 Best-BlastP =>> nrprot 70% Identities = 267/493 (54%), Positives = 353/493 (71%), Gaps = 1/493 (0%) refINP_819940.1 J methylmalonatesemialdehyde dehydrogenase [Coxiella burnetii RSA 493] gbIAAO90454.1 1 methylmalonate-semialdehyde dehydrogenase [Coxiella burnetii RSA 493] Length = 498 3301.2 Best-BlastP =>> nrprot 55% Identities = 160/488 (32%), Positive = 261/488 (53%), Gaps = 38/488 (7%) refINP_787151.1! propionyl-CoA carboxylase beta chain [Tropheryma whipplei str. Twist] refINP_788980.11 propionyl-CoA carboxylase beta chain [Tropheryma whipplei TW08 / 27] I propionyl-CoA carboxylase beta chain [Tropheryma whipplei TW08 / 27] gbjAAO44120.1 propionyl-CoA carboxylase beta chain [Tropheryma whipplei str. Twist] Length = 525 3303.2 Best-BlastP =>> nrprot No Hits found 3304.2 Best-BlastP =>> nrprot 50% Identities = 133/302 (44%), Positives = 189/302 (62%), Gaps = 7 / 302 (2%) refJZP_00043253.1 hypothetical protein [Magnetococcus sp. MC-1] Length = 831 3306.4 Best-BlastP =>> nrprot 29% Identities = 48/138 (34%), Positives = 71/138 (51%), Gaps = 13/138 (9%) ref1ZP_00052545.1 I COG1020: Nonribosomal peptide synthetase and related proteins [Magnetospirillum magnetotacticum] Length = 676 3307.4 Best-BlastP =>> nrprot No Hits found 3308.4 Best-BlastP =>> nrprot No Hits found 331.2 Best-BlastP =>> nrprot 69% Identities = 272/538 (50%), Positive = 371/538 (68%), Gaps = 5/538 (0%) refINP 406414.11 putative glutaminedependent NAD [Yersinia pestis] refINP_668639.1I putative NH3- dependent NAD (+) synthetase [Yersinia pestis KIM] pirIIAG0354 NAD synthase (glutamine-hydrolysing) (EC 6.3.5.1) -Yersinia pestis (strain CO92) embJCAC92162.1 J putative glutamine-dependent NAD [Yersinia pestis CO92] gbIAAM84890.1 IAE013734_5 putative NH3-dependent NAD (+) synthetase [Yersinia pestis KIM] Length = 540 3311.1 Best-BlastP =>> nrprot 74% Identities = 275/459 (59%), Positives = 341/459 (74%), Gaps = 9/459 (1%) refINP_250486. 11 cysteiny l-tRNA synthetase [Pseudomonas aeruginosa PA01] spIQ912U7ISYC_PSEAE Cysteinyl-tRNA synthetase (Cysteine-tRNA ligase) (CysRS) pir1IG83421 cysteinyl-tRNA synthetase PA1795 [imported] Pseudomonas aeruginosa (strain PAO1) gblAAG05184.11AE004605_6 cysteinyl-tRNA synthetase [Pseudomonas aeruginosa PAOI ] Length = 460 3312.1 Best-BlastP =>> nrprot 32% Identities = 20/66 (30%), Positives = 34/66 (51%) refINP_759513.1 Unknown [Vibrio vulnificus CMCP6] gblAAO09040.11AE016798_200 Unknown [Vibrio vulnificus CMCP6] dbjIBAC93437. 1I hypothetical protein [Vibrio vulnificus YJ016] Length = 103 3314.2 Best-BlastP =>> nrprot No Hits found 3316.1 Best-BlastP =>> nrprot 26% Identities = 80/363 (22%), Positive = 152/363 (41% ) Gaps = 41/363 (11%) refINP_659473.11 hypothetical protein MGC33887 [Homo sapiens] gblAAM49719.1 1AF458591_1 hypothetical protein [Homo sapiens] Length = 590 3319.1 Best-BlastP =>> nrprot No Hits found 3322.2 Best-BlastP = >> nrprot 98% Identities = 265/269 (98%), Positives = 267/269 (99%) pirlIT18335 icmG protein - Legionella pneumophila embICAA75166.1 I IcmG protein [Legionella pneumophila] gblAAC38187.1 I DotF [Legionella pneumophila] embICAA75332 .1 IcmG protein [Legionella pneumophila] Length = 269 3323.1 Best-BlastP =>> nrprot 99% Identifies = 194/194 (100%), Positives = 194/194 (100%) pir1IT18336 icmC protein - Legionella pneumophila embJCAA75167.11 IcmC protein [Legionella pneumophila] gbIAAC38186.11 DotE [Legionella pneumophila] embICAA75333.1I IcmC protein [Legionella pneumophila] Length = 194 3324.1 Best-BlastP =>> nrprot 98% Identities = 130/132 (98%), Positives = 131/132 (99%) pir11T18337 icmD protein - Legionella pneumophila embICAA75168.1 IcmD protein [Legionella pneumophila] emblCAA75334.1 I icmD protein [Legionella pneumophila] Length = 132 3326.2 Best-BlastP =>> nrprot 99% Identities = 261/261 (100%), Positives = 261/261 (100%) gbIAAQ10306.11 DotU [Legionella pneumophila] Length = 261 3327.1 Best-BlastP =>> nrprot 46% Identities = 53/219 (24%), Positive = 99/219 (45%), Gaps = 19/219 (8%) refINP_840938.1 conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] ## EQU1 ## (0%) refINP_252414.1 I single-stranded-DNA-specific exonuclease RecJ [Pseudomonas aeruginosa PA01] pin 1A83181 single-stranded-DNA-specific exonuclease RecJ PA3725 [imported] Pseudomonas aeruginosa (strain PAO1) gbjAAG07112.11AE004791_9 singlestranded-DNA-specific exonuclease RecJ [Pseudomonas aeruginosa PAO1] Length = 571 333.3 Best-BlastP =>> nrprot 57% Identities = 426/1088 (39%), Positive = 613/1088 (56%), Gaps = 70/1088 (6%) gbIAAP85938.11 putative helicase, superfamily II [Raistonia eutropha] Length = 1106 3331.1 Best-BlastP =>> nrprot 61% Identities = 145/291 (49%), Positives = 203/291 ( 69%), Gaps = 1/291 (0%) refINP_719443: 1 d TIM-barrel protein, yjbN family [Shewanella 'oneidensis MR-1] gbjAAN56887.11AE015823_9 TIM- barrel protein, yjbN family [Shewanella oneidensis MR-1] Length = 335 3333.1 Best-BlastP =>> nrprot 58% Identifies = 52/122 (42%), Positives = 79/122 (64%), Gaps = 1/122 (0%) refINP_930852.1 I Mutator mutT protein (7) 8-dihydro-8-oxoguanine triphosphatase) (8-oxo-dGTPase) (dGTP pyrophosphohydrolase) [Photorhabdus luminescens subsp.

  Mutant mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (8-oxo-dGTPase) (dGTP pyrophosphohydrolase) [Photorhabdus luminescens subsp. laumondii TTOI] Length = 130 3334.2 Best-BlastP =>> nrprot No Hits found 3336.2 Best-BlastP =>> nrprot No Hits found 3337.2 Best-BlastP =>> nrprot No Hits found 3338.1 Best- BlastP =>> nrprot No Hits found 334.5 Best-BlastP =>> nrprot 42% Identities = 272/697 (39%), Positives = 416/697 (59%), Gaps = 23/697 (3%) refINP_440178.11 regulatory components of the sensory transduction system [Synechocystis sp. PCC 6803] pir1IS74707 nitrogen positive binding activator protein Synechocystis sp. (strain PCC 6803) dbj! BAA16858.1 Regulatory components of sensory transduction system [Synechocystis sp. PCC 6803] Length = 840 3341.2 Best-BlastP =>> nrprot No Hits found 3343.1 Best-BlastP =>> nrprot No Hits found 3345.2 Best-BlastP =>> nrprot 17% Identities = 53/272 (19%), Positives = 137/272 (50%), Gaps = 28/272 (10%) refINP_701067.1 I hypothetical protein [Plasmodium falciparum 3D7] gbIAAN35791.11AE014838_69 hypothetical protein [Plasmodium falciparum 3D7] Length = 964 3346.2 Best-BlastP =>> nrprot 28 % Identities = 105/343 (30%), Positives = 168/343 (48%), Gaps = 60/343 (17%) refINP623492.1 Cell division protein Fts1 / penicillin-binding protein 2 [Thermoanaerobacter tengcongensis] gblAAM25096. 1 = Cell division protein Ftsl / Penicillinbinding Protein 2 [Thermoanaerobacter tengcongensis] Length = 553 3347.1 Best-BlastP =>> nrprot 94% Identities = 239/266 (89%), Positives = 251/266 (94%) EmbICAC35728.1! OXA-29 [Fluoribacter gormanii] Length = 266 3348.2 Best-BlastP =>> nrprot 31% Identities = 115/295 (38%), Positives = 170/295 (57%), Gaps = 15/295 (5%) reflZP_00119503 .1 I COG0726: Predicted xylanase / chitin deacetylase [Cytophaga hutchinsonii] Length = 314 3349.3 Best-BlastP =>> nrprot 45% Identities = 72/238 (30%), Positives = 130/238 (54%), Gaps = 8 / 238 (3%) refINP_638901.1.I conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gblAAM42825.11 conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 314 335.1 Best-BlastP =>> nrprot 67% Identities = 115/207 (55%), Positives = 145/207 (70%), Gaps = 2/207 (0%) refINP903041.1 j conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ61035.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 206 3350.3 Best-BlastP =>> nrprot 41% Identities = 33/101 (32%), Positive = 50/101 (49%) %), Gaps = 3/101 (2%) COG0346: Lactoylglutathione lyase and related lyases [Cytophaga hutchinsonii] Length = 150 3351.3 Best-BlastP =>> nprot 30% Identities = 88/194 (45%), Positives = 121/194 (62%), Gaps = 1/194 (0%) refINP_531634.11 methyltransferase [Agrobacterium tumefaciens str. C58 (U. Washington)] pirJJAH2691 methyltransferase Atu0936 [imported] Agrobacterium tumefaciens (strain C58, Dupont) gbJAAL41950.11 methyltransferase [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 202 3352.1 Best-BlastP =>> nrprot 42% Identities = 52/109 (47%), Positives = 67/109 (61%), Gaps = 6/109 (5%) refINP_819444 .1 acetyltransferase, GNAT family [Coxiella burnetii RSA 493] gbIAAO89958.1 acetyltransferase, GNAT family [Coxiella burnetii RSA 493] Length = 118 3353.1 Best-BlastP =>> nrprot 48% Identities = 157/467 (33%), Positive = 245/467 (52%), Gaps = 16/467 (3%) refINP 417114.1 I hypothetical protein [Escherichia coli K12] spIP52124IYFJI_ECOLI Hypothetical protein yfjl pir1IT08637 hypothetical protein b2625 - Escherichia coli (strain K-12) gblAAA79794.1 ORF_o469 gbIAAC75673.1 J orf, hypothetical protein [Escherichia coli K12] Length = 469 3354.1 Best-BlastP =>> nrprot 47% Identities = 58/190 (30%), Positives = 91/190 (47%), Gaps = 2 / 190 (1%) gblAAD53919.11AF179611_3 pyridoxamine 5'-phosphate oxidase [Zymomonas mobilis] Length = 192 3355.2 Best-BlastP =>> nrprot 72% Identities = 53/94 (56%), Positive = 70/94 (74%) , Gaps = 1/94 (1%) gblAAL55698 .1 JAF246719_2 hypothetical protein [Escherichia coli] Length = 95 3356.2 Best-BlastP =>> nrprot 70% Identities = 44/83 (53%), Positives = 59/83 (71%) refINP_232869.1 I conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] pir1IE82456 conserved hypothetical protein VCA0477 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF96381.11 conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 90 3357.2 Best-BlastP =>> nrprot No Hits found 3359.2 Best-BlastP =>> nrprot 48% Identities = 221/706 (31%), Positives = 362/706 (51%), Gaps = 53 / 706 (7%) refINP_820588.1 l protein membrane, putative [Coxiella burnetii RSA 493] gbjAAO91102.1 protein membrane, putative [Coxiella burnetii RSA 493] Length = 698 336.1 Best-BlastP =>> nrprot 69% Identities = 186/324 (57%), Positives = 230/324 (70%), Gaps = 2/324 (0%) refINP_384292.1 l PHOSPHATE TRANSPORT TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] spl0304991PIT_RHIME Likely low-affinity inorganic phosphate transport gbIAAB70171.1 I phosphate transport protein [Sinorhizobium meliloti] embyCAC41573.1 j PHOSPHATE TRANSPORT TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] Length = 334 3360.1 Best-BlastP =>> nrprot No Hits found 3362.1 Best-BlastP =>> nrprot 43% Identities = 68/209 (32%) , Positives = 106/209 (50%), Gaps = 5/209 (2%) refINP_178286.1 Protein-related membrane [Arabidopsis thaliana] pirjIH84428 probable membrane protein [imported] - Arabidopsis thaliana gbjAAD12695.1 j putative membrane protein [Arabidopsis thaliana] Length = 250 3363.2 Best-BlastP =>> nrprot 64% Identities = 148/300 (49%), Positives = 204/300 (68%) , Gaps = 11/300 (3%) gbjAAC64375.1 I thiamine synthase homolog [Botryotinia fuckeliana] Length = 342 3365.2 Best-BlastP =>> nrprot 66% Identities = 173/347 (49%), Positives = 238/347 ( 68%), Gaps = 13/347 (3%) refINP_819373.1 thiamine biosynthesis oxidoreductase ThiO, putative [Coxiella burnetii RSA 493] gbjAAO89887.1j thiamine biosynthesis oxidoreductase ThiO, putative [Coxiella burnetii RSA 493] Length = 338 3367.1 Best- BlastP =>> nrprot 41% Identities = 81/269 (30%), Positives = 123/269 (45%), Gaps = 20/269 (7%) EmbJCAC17409.1 3'nucleotidase / nuclease [Leishmania mexicana] Length = 378 3368.2 Best-BlastP =>> nrprot No Hits found 337.2 Best-BlastP =>> nrprot 67% Identities = 241/457 (52%), Positives = 311/457 (68%), Gaps = 4/457 (0) %) refINP_830123.11 Amino acid permease [Bacillus this ATCC 14579] gbIAAP07324.1 Amino acid permease [Bacillus cereus ATCC 14579] Length = 471 Best-BlastP =>> nrprot 83% Identities = 321/438 (73%), Positive = 372/438 (84%) refINP819599. 1 l conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90113.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 439 Best-BlastP =>> nrprot 25% Identities = 60/222 (27%), Positives = 94/222 (42%), Gaps = 21/222 (9%) refINP_774046. BII7406 [Bradyrhizobium japonicum] dbjlBAC52671.1lbII7406 [Bradyrhizobium japonicum USDA 110] Length = 300 Best-BlastP =>> nrprot 30% Identities = 62/236 (26%), Positives = 106/236 (44%), Gaps = 1523 (6%) refINP_819950.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90464.1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 3378.2 Best-BlastP =>> nrprot 56% Identities = 210/580 ( 36%), Positive = 331/580 (57%), Gaps = 9/580 (1%) gbIAAC44717.1 I FrgA [Legionella pneumophila] Length = 575 3385.1 Best-BlastP =>> nrprot 74% Identities = 252/254 (99%), Positive = 254/254 (100%) gblAAM00642.1 J essential conserved GTPase [Legionella pneumophila] Length = 254 3386.1 Best-BlastP =>> nrprot 77% Identities = 62/85 (72%), Positive = 72/85 (84%) refINP_636525.1 150S ribosomal protein L27 [Xanthomonas campestris pv. campestris str. ATCC 33913] spIQ8PBH1 IRL27_XANCP 50S ribosomal protein L27 gbIAAM40449.1 150S ribosomal protein L27 [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 86 3388.1 Best-BlastP =>> nrprot 28% Identities = 65/168 (38%), Positives = 105/168 (62%), Gaps = 1/168 (0%) refZOT_00125980.1 l COG2199 : FOG: GGDEF domain [Pseudomonas syringae pv. syringae B728a] Length = 972 3389.1 Best-BlastP =>> nrprot 68% Identities = 149/315 (47%), Positives = 222/315 (70%) refZD_00068004.1 COG0142: Geranylgeranyl pyrophosphate synthase [Microbulbifer degradans 2-40] Length = 320 339.4 Best-BlastP =>> nrprot 89% Identities = 168/194 (86%), Positives = 174/194 (89%), Gaps = 8/194 (4%) gbIAAK52070.1 j Rcp [Legionella pneumophila Length = 186 3390.1 Best-BlastP =>> nrprot 37% Identities = 21/61 (34%), Positive = 32/61 (52%) refINP_820745.1 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91259.1 I RS = 493 = 999 + 99% Identity = 748/751 (99%), Positives = 749/751 (99%) gblAAN17185.1 IAF492466_3 ferrous iron transport B [Coxiella burnetii RSA 493] Length = 72 3391.2 Best-BlastP =>> nrprot 99% Legionella pneumophila] Length = 751 3394.1 Best-BlastP =>> nrprot No Hits found 3395.2 Best-BlastP =>> nrprot No Hits found 3396.1 Best-BlastP =>> nrprot No Hits found 3397.1 Best-BlastP =>> nrprot 62% Identities = 72/167 (43%) Positive = 106/167 (63%), Gaps = 6/167 (3%) refINP840350.1.I putative antirestriction protein [Nitrosomonas europaea ATCC 19718] embICAD84171. 11 putative antirestriction protein [Nitrosomonas europaea ATCC 19718] Length = 171 3371.2 3374.1 3376.1 3398.1 Best-BlastP =>> nrprot 61% Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 7 / 145 (4%) refINP_252922.1 I single-stranded DNAbinding protein [Pseudomonas aeruginosa PA0I] splP409471SSB_PSEAE Singlestrand binding protein (SSB) (Helix-destabilizing protein) pir1IS44302 single-stranded DNA-binding protein - Pseudomonas aeruginosa embICAA83688. 1l single-stranded DNA binding protein [Pseudomonas aeruginosa] gbJAAG07620.1lAE004840_6 single-stranded DNA-binding protein [Pseudomonas aeruginosa PAOI] Length = 165 3399.1 Best-BlastP =>> nrprot No Hits found 34.1 Best-BlastP =>> nrprot No Hits found 3401.2 Best-BlastP =>> nrprot No Hits found 3402.2 Best-BlastP =>> nrprot 53% Identities = 108/298 (36%), Positives = 160/298 (53%), Gaps = 14/298 (4% ) refINP_862370.1 j unknown [Francisella tularensis subsp. novicidae] gbIAAD17308.11 unknown [Francisella tularensis subsp. novicida] Length = 292 3404.2 Best-BlastP =>> nrprot 31% Identities = 51/187 (27%), Positives = 86/187 (45%), Gaps = 9/187 (4%) reflZP_00091084.1 l COG0582: Integrase [Azotobacter vinelandii] Length = 287 3406.2 Best-BlastP =>> nrprot 34% Identities = 46/197 (23%), Positives = 76/197 (38%), Gaps = 13/197 (6%) refINP 466297.1 l hypothetical membrane protein [Listeria monocytogenes EGD-e] pirJIAF1421 hypothetical membrane protein Imo2775 [imported] - Listeria monocytogenes (strain EGD-e) emblCAD00988.1 l Imo2775 [Listeria monocytogenes] Length = 722 341.6 Best-BlastP =>> nrprot 99% Identities = 141/141 (100%), Positives = 141/141 (100%) gblAAC44222.1 J hemin binding protein Hbp [Legionella pneumophila] Length = 141 3411.2 Best-BlastP =>> nrprot 20% Identities = 42/162 (25 %), Positives = 75/162 (46%), Gaps = 10/162 (6%) refINP_871522.1 1 rplA [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] spIQ8D236IRL1_WIGBR 50S ribosomal protein L1 dbj1BAC24665.1 I rplA [Wigglesworthia bre vipalpis] Length = 242 3413.2 Best-BlastP =>> nrprot 49% Identities = 76/296 (25%), Positives = 150/296 (50%), Gaps = 16/296 (5%) refINP_832129.1 I Transcriptional regulators , LysR family [Bacillus cereus ATCC 14579] gblAAP09330.11 Transcriptional regulators, LysR family [Bacillus cereus ATCC 14579] Length = 300 3414.3 Best-BlastP =>> nrprot 33% Identities = 115/406 (28%), Positives = 184 / 406 (45%), Gaps = 47/406 (11%) reflZP_00112010.11 COG0666: FOG: Ankyrin repeat [Nostoc punctiform] Length = 427 3415.2 Best-BlastP =>> nrprot 38% Identities = 48/154 (31%) , Positives = 69/154 (44%), Gaps = 14/154 (9%) refINP_740808.1 I dots Histone Methyltransferase (1C952) [Caenorhabditis elegans] gblAAK39620.21 Hypothetical protein Y39G10AR.18a [Caenorhabditis elegans] Length = 1015 3416.1 Best-BlastP =>> nrprot 73% Identities = 65/99 (65%), Positives = 76/99 (76%) refINP_820718.1 integration host factor, beta subunit [Coxiella burnetii RSA 493] gblAAO91232.1 l integration host factor, beta subunit [ Coxiella burnetii RSA 493] Length = 112 3417.1 Best-BlastP =>> nrprot 91% Identities = 155/191 (81%), Positives = 172/191 (90%), Gaps = 3/191 (1%) refINP_780077.1 the deoxycytidine triphosphate deaminase [Xylella fastidiosa Temeculal] spIQ87AD1IDCD_XYLFT deoxycytidine triphosphate deaminase (dCTP deaminase) gbjAAO29726.1 I deoxycytidine triphosphate deaminase [Xylella fastidiosa Temecula1] Length = 191 3418.1 3419.3 342.2 3421.2 3423.3 3426.1 3428.1 3429.1 343.1 3431.3 3432.2 3437.1 344.1 3442.3 Best-BlastP = >> nrprot 99% Identities = 283/283 (100%), Positives = 283/283 (100%) gblAAC83338.1 I major outer membrane protein precursor [Legionella pneumophila] gbIAAC83342.1 I major outer membrane protein precursor [Legionella pneumophila] Length = 289 Best-BlastP =>> nrprot 36% Identities = 47/225 (20%), Positives = 93/225 (41%), Gaps = 37/225 (16%) refINP_703974.11 erythrocyte membrane protein 1 (PfEMP1 ) [Plasmodium falciparum 3D7] embICAD50587.1 I erythrocyte membrane protein 1 (PfEMP1) [Plasma falciparum modulus 3D7] Length = 2879 Best-BlastP =>> nrprot 74% dentities = 237/407 (58%), Positives = 310/407 (76%) ref1NP_924319.1 I probable aminotransferase [Gloeobacter violaceus] dbjlBAC89314.1 I girl 373 [Gloeobacter violaceus] Length = 417 Best-BlastP =>> nrprot 27% dentities = 56/257 (21%), Positives = 108/257 (42%), Gaps = 32/257 (12%) reflNP_705457.1 j hypothetical protein [Plasmodium falciparum 3D7] embICAD52694.1 j hypothetical protein [Plasmodium falciparum 3D7] Length = 1179 Best-BlastP =>> nrprot 86% dentities = 335/366 (91%), Positives = 346/366 (94%) gbjAAL23711 .1 j RaIF [Legionella pneumophila] Length = 374 Best-BlastP =>> nrprot 33% Identities = 56/142 (39%), Positives = 78/142 (54%), Gaps = 2/142 (1%) refJNP_108258 .1 1 hypothetical protein [Mesorhizobium loti] dbjjBAB53719.11 hypothetical protein [Mesorhizobium loti] Length = 285 Best-BlastP =>> nrprot 47% Identities = 72/233 (30%), Positive = 129/233 (55%), Gaps = 2/233 (0%) refJZP_00006345.1 j COG1409: Predicted ph osphohydrolases [Rhodobacter sphaeroides] Length = 273 Best-BlastP =>> nrprot 33% Identities = 126/638 (19%), Positives = 247/638 (38%), Gaps = 85/638 (13%) gbjEAA15312.1 f hypothetical protein [Plasmodium yoelii yoelii] Length = 1527 Best- BlastP =>> nrprot 70% Identities = 78/139 (56%), Positives = 106/139 (76%) refjNP_924320.1 j hypothetical protein girl 374 [Gloeobacter violaceus] dbjlBAC89315.11 girl 374 [Gloeobacter violaceus] Length = 148 Best-BlastP =>> nrprot 39% Identities = 109/279 (39%), Positives = 169/279 (60%), Gaps = 8/279 (2%) COG2056: Predicted permease [Ralstonia metallidurans] Length = 325 Best-BlastP =>> nrprot 63% Identities = 161/334 (48%), Positives = 218/334 (65%) refJNP_346834.1 j Similar to chloromuconate cycloisomerase [Clostridium acetobutylicum] pirjjC96923 similar to chloromuconate cycloisomerase [imported] - Clostridium acetobutylicum gbjAAK78174.11AE007532_7 Similar to chloromuconate cycloisomerase [Clostridium acetobutylicum] Length = Best-BlastP =>> nrprot 32% Identities = 79/336 (23%), Positives = 125/336 (37%), Gaps = 58/336 (17%) refJNP_523168.1 j PROBABLE ACID SPHINGOMYELINASE-LIKE PHOSPHODIESTERASE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] embjCAD18760.11 PROBABLE ACID SPHINGOMYELINASE-LIKE PHOSPHODIESTERASE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length 476 Best-BlastP =>> nrprot 67% Identities = 58/107 (54%), Positives = 76/107 (71%) reflZP_00096500 .1 I COG2151: Predicted metal-sulfur cluster biosynthetic enzyme [Novosphingobium aromaticivorans] Length = 160 Best-BlastP =>> nrprot 41% Identities = 160/450 (35%), Positives = 247/450 (54%), Gaps = 6/450 (1%) D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase [Coxiella burnetii RSA 493] gbjAΔO89579.1 Dalanyl-D-alanine carboxypeptidase / D-alanyl-D- alanine-endopeptidase [Coxiella burnetii RSA 493] Length = 477 3443.1 Best-BlastP =>> nrprot 64% Identities = 112/252 (44%), Positives = 170/252 (67%) refIZP_00091089.1 1 COG1475: Predicted transcriptional regulators [Azotobacter vinelandii] Length = 294 3444.1 Best-BlastP =>> nrprot No Hits found 3445.3 Best-BlastP =>> nrprot 53% Identities = 141/332 (42%), Positives = 185/332 ( 55%), Gaps = 16/332 (4%) COG1652: Uncharacterized protein containing LysM domain [UCBPP-PA14 Pseudomonas aeruginosa] Length = 371 3446.1 Best-BlastP =>> nrprot 56% Identities = 158/291 ( 54%), Positives = 205/291 (70%), Gaps = 3/291 (1%) refINP_820973.1 dprA DNA processing protein, putative [Coxiella burnetii RSA 493] gbjAAO91487.11 DprA DNA processing protein, putative [Coxiella burnetii RSA 493] Length = 308 3447.1 Best-BlastP =>> nrprot 43% Identities = 30/121 (24%), Positives = 64/121 (52%), Gaps = 5/121 (4%) refINP 484103.1 I hypothetical protein [Nostoc sp. PCC 7120] pirIjAC1814 hypothetical protein a110059 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB77583.1 J ORF_ID: aII0059 hypothetical protein [Nostoc sp. PCC 7120] Length = 727 3450.2 Best-BlastP =>> nrprot 73% Identities = 202/344 (58%), Positives = 264/344 (76%), Gaps = 1/344 (0%) refINP_469414.1 I similar to E. coli Ada protein (06-methylguanine-DNA methyltransferase) [Listeria innocua] pirIIAE1441 E. coli Ada protein (06-methylguanine-DNA methyltransferase) homolog Iin0068 [Imported] - Listeria innocua (strain CIip11262) bICIC95301.1 I Iin0068 [ Listeria innocua] Length = 350 3451.1 Best-BlastP =>> nrprot No Hits found 3453.1 Best-BlastP =>> nrprot 10% Identities = 40/127 (31%), Positives = 53/127 (41%), Gaps = 19 / 127 (14%) refINP_356305.1 j AGR_L_1030p [Agrobacterium tumefaciens] refINP_534828.11 hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] pirIIAB3091 hypothetical protein Atu4350 [imported] - Agrobacterium tumefaciens (strain C58, Smith) pirjjH98195 hypothetical protein AGR_L_1030 [imported] - Agrobacterium tumefaciens (strain C58, Cereon) gbIAAK89090.11 AGR_L_1030p [Agrobacterium tumefaciens str. C58 (Cereon)] gblAAL45144.1 1 hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 278 3454.1 Best-BlastP =>> nrprot 42% Identities = 31/137 (22%), Positives = 62/137 (45%), Gaps = 21/137 (15%) refINP_832446 .1 I Acetyltransferase [Bacillus cereus ATCC 14579] gbIAAP09647.11 Acetyltransferase [Bacillus cereus ATCC 14579] Length = 141 3455.3 Best-BlastP =>> nrprot No Hits found 3456.4 Best-BlastP =>> nrprot 70% Identities = 83/166 ( 50%), Positives = 119/166 (71%), Gaps = 7/166 (4%) reflZ_00012554.1 I COG3158: K + transport [Rhodopseudomonas palustris] Length = 620 3459.3 Best-BlastP =>> nrprot 57% Identities = 189/475 (39%), Positives = 283/475 (59%), Gaps = 7/475 (1%) gbIAAP85869.1d putative potassium uptake protein [Ralstonia eutropha] Length = 632 346.2 Best-BlastP =>> nrprot 67% Identities = 160/326 (49%), Positives = 216/326 (66%), Gaps = 11/326 (3%) spIQ9KNS61SYK3_VIBCH Putative lysyltRNA synthetase (Lysine - tRNA ligase) (LysRS) (GX) Length = 324 3461.4 Best-BlastP =>> nrprot 18% Identities = 67/286 (23%), Positives = 116/286 (40%), Gaps = 45/286 (15%) gbIEAA19312.11 heat shock protein hsp70 homolog Pfhsp70-3 [Plasmodium yoelii yoelii] Length = 663 3463.1 Best-BlastP =>> nrprot 84% Identities = 199/269 (73%), Positives = 233 / 269 (86%) refJZP_00103515.11 COG2877: 3-deoxy-D-mannooctulosonic acid (KDO) 8-phosphate synthase [Desulfitobacterium hafniense] Length = 277 Best-BlastP =>> nrprot 84% Identities = 371/544 (68% ), Positives = 460/544 (84%), Gaps = 1/544 (0%) refJZP_00067534.1 I COG0504: CTP synthase (UTPammonia lyase) [Microbulbifer degradans 2-40] Length = 543 Best-BlastP =>> nrprot 61% Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 2/60 (3%) refINP_908035.11 HYPOTHETICAL PROTEIN-Putative Site-specific recombinase [Wolinella succinogenes] embiCAE10935.11 HYPOTHETICAL PROTEIN-Putative Site-specific recombinase [Wolinella succinogenes] Length = 207 Best-BlastP =>> nrprot 78% Identities = 236/412 (57%), Positives = 320/412 (77%), Gaps = 14/412 (3%) %) pirIIS42875 dihydrolipoamide S-succinyltransferase (EC 2.3 .1. 61) - Coxiella burnetii embICAA54875.1 I putative dihydrolipoamide succinyltransferase [Coxiella burnetii] Length = 405 Best-BlastP =>> nrprot 60% Identities = 119/292 (40%), Positives = 182/292 (62%), Gaps = 1/292 (0%) COG2933: Predicted SAM-dependent methyltransferase [Magnetospirillum magnetotacticum] Length = 324 Best-BlastP =>> nrprot 27% Identities = 26/50 (52%), Positives = 28/50 ( 56%), Gaps = 10/50 (20%) refINP_773097.1 I bII6457 [Bradyrhizobium japonicum] dbjIBAC51722.1 I bII6457 [Bradyrhizobium japonicum USDA 110] Length = 254 Best-BlastP =>> nrprot No Hits found Best-BlastP = 63% Identities = 160/356 (44%), Positives = 238/356 (66%) refINP_819753.11 protein membrane, putative Length = 377 Best-BlastP =>> nrprot 76% Identities = 140/241 (58%), Positives = 187/241 (77%) refINP_819754.1 I ABC carry, ATP-binding protein [Coxiella burnetii RSA 493] gbl AAO90268.11 ABC carry, ATP-binding protein [Coxiella burnetii RSA 493] Length = 268 3480.4 Best-BlastP =>> nrprot 56% Identities = 185/551 (33%), Positives = 314/551 (56%), Gaps = 12/551 (2%) refINP 441242.1 I hypothetical protein [Synechocystis sp. PCC 6803] pirlIS75060 conserved hypothetical protein s111595 - Synechocystis sp. (strain PCC 6803) dbjIBAA17922.1 I ORF_ID: s111595 hypothetical protein [Synechocystis sp. PCC 6803] Length = 568 3481.2 Best-BlastP =>> nrprot 67% Identities = 38/89 (42%), Positives = 61/89 (68%), Gaps = 1/89 (1%) refINP_442504.1 PCC7942 clock gene ... ORFE [Synechocystis sp. PCC 6803] pirlIS76630 hypothetical protein - Synechocystis sp. (strain PCC 6803) dbjIBAA10574.1 I sII0486 [Synechocystis sp. PCC 6803] Length = 102 3483.3 Best-BlastP =>> nrprot 52% Identities = 71/196 (36%), Positives = 106/196 (54%), Gaps = 7/196 (3%) refINP_216630.1 hypothetical protein Rv2114 [Mycobacterium tuberculosis H37Rv] refINP_855787.1 HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp. bovis AF2122 / 97] pirIIE70512 hypothetical protein Rv2114 - Mycobacterium tuberculosis (strain H37RV) embICAB10705.1I hypothetical protein Rv2114 [Mycobacterium tuberculosis H37Rv] embICAD96991.11 HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp. bovis AF2122 / 97] Length = 207 3484.1 Best-BlastP =>> nrprot No Hits found 3485.1 Best-BlastP =>> nrprot No Hits found 3486.1 Best-BlastP =>> nrprot No Hits found 3488.1 Best-BlastP =>> nrprot 16 % Identities = 52/260 (20%), Positives = 116/260 (44%), Gaps = 26/260 (10%) pir1IT14867 interaptin siime mold (Dictyostelium discoideum) gblAAC34582.11 interaptin [Dictyostelium discoideum] Length = 1738 3465.2 3466.1 3468.2 347.1 3472.1 3473.1 3476.1 3477.2 Best-BlastP =>> nrprot 22% Identities = 37/178 (20%), Positives = 74/178 (41%), Gaps = 13/178 (7%) ref] NP_624872.11 hypothetical protein SCF73.06c [Streptomyces coelicolor A3 (2)] embJCAB57411.1 1 hypothetical protein SCF73.06c [Streptomyces coelicolor A3 (2)] Length 333 Best-BlastP =>> nrprot 66% Identities = 109/211 (51%) , Positives = 143/211 (67%), Gaps = 1/211 (0%) reflZP_00013996.1 COG2872: Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase domain HxxxH [Rhodospirillum rubrum] Length = 214 Best-BlastP => > nrprot 55% Identity s = 41/85 (48%), Positive = 58/85 (68%) reflZ_00015213.1 I COG2823: Predicted periplasmic or secreted lipoprotein [Rhodospirillum rubrum] Length = 104 3496.2 Best-BlastP =>> nrprot 30% Identities = 37 / 120 (30%), Positives = 50/120 (41%), Gaps = 24/120 (20%) refINP_827755.11 hypothetical protein [Streptomyces avermitilis MA-4680] dbjIBAC74290.11 hypothetical protein [Streptomyces avermitilis MA-4680] Length = 574 3498. 1 Best-BlastP =>> nrprot No Hits found 3499.1 Best-BlastP =>> nrprot No Hits found 35.1 Best-BlastP =>> nrprot 98% Identities = 262/265 (98%), Positives = 262 / 265 (98%) EmbICAB60063.1 I IvrE [Legionella pneumophila] Length = 265 350.3 Best-BlastP =>> nrprot 25% Identities = 29/124 (23%), Positive = 50/124 (40%), Gaps = 12/124 (9%) gbIAAD40638.11AF128842_1 extracellular calcium-sensing receptor [Mus musculus] Length = 1079 3500.3 Best-BlastP =>> nrprot 30% Identities = 61/283 (21%), Positives = 120/283 (42%) ), Gaps = 16/283 (5%) refINP_928738.1 I hypothetical protein [Photorha luminescens subsp. laumondii TTO1] embICAE13733.1 I unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 417 3502. 3 Best-BlastP =>> nrprot 55% Identities = 57/145 (39%), Positives = 91/145 (62%), Gaps = 5/145 (3%) pirllJQ0144 probable protein-disulfide oxidoreductase (EC 1. 8. 4. -) - Pseudomonas aeruginosa Length = 163 3503. 2 [Pasteurella multocida] gbIAAK03019. 11 unknown [Pasteurella multocida] Length = 226 Best-BlastP =>> nrprot 52% Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 8/123 (6%) gblEAA21917. 1 1 hypothetical protein [Plasmodium yoelii yoelii] Length = 296 Best-BlastP =>> nrprot 61% Identities = 43/94 (45%), Positives = 61/94 (64%) refJZP_00088933. 1 COG0640: Predicted transcriptional regulators [Azotobacter vinelandii] Length = 107 Best-BlastP =>> nrprot 15% Identities = 31/117 (26%), Positives = 55/117 (47%) refIXP_306772. 1 l ENSANGP00000000282 [Anopheles 3489. 2,349. 2 3494. 2 Best-BlastP =>> nrprot 74% Identities = 229/383 (59%), Positives = 287/383 (74%) refINP 820071. 11 quenin tRNA-ribosyltransferase [Coxiella burnetii RSA 493] gblAAO90585. 1 quenin tRNA-ribosyltransferase [Coxiella burnetii RSA 493] Length = 385 3504. 1 Best-BlastP =>> nrprot 98% Identities = 163/164 (99%), Positive = 163/164 (99%) pir11S49314 peptidylprolyl isomerase (EC 5. 2. 1. 8) Legionella pneumophila embyCAA58722. Cyclophilin [Legionella pneumophila] Length = 164,3506. 1 Best-BlastP =>> nrprot 69% Identities = 116/212 (54%), Positives = 146/212 (68%), Gaps = 4/212 (1%) refINP_245872. 1 I unknown 3507. 1 3508. 2 3509. 2 gambiae] gblEAA02010. 21 ENSANGP00000000282 [Anopheles gambiae str.  PEST] Length = 210,351. 1 Best-BlastP =>> nrprot 59% Identities = 52/141 (36%), Positives = 89/141 (63%), Gaps = 6/141 (4%) refINP_562901. 1! conserved hypothetical protein [Clostridium perfringens] dbjIBAB81691. 1 I conserved hypothetical protein [Clostridium perfringens str.  13] Length = 168 3511. 2 Best-BlastP =>> nrprot 61% Identities = 160/368 (43%), Positives = 237/368 (64%) refINP_902574. I conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbJAAQ60572. 11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 377 3512. 1 Best-BlastP =>> nrprot 13% Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 9/145 (6%) dbjIBAB62990. 1 I hypothetical protein [Macaca fascicularis] Length = 533 3514. 1 Best-BlastP =>> nrprot No Hits found 3515. 2 Best-BlastP =>> nrprot 25% Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 4/85 (4%) refINP_745177. Pyocin R2_PP, repressor transcriptional, Cl / C2 family [Pseudomonas putida KT2440] gbJAAN68641. 11AE016494_1 R2_PP pyocin, repressor transcriptional, Cl / C2 family [Pseudomonas putida KT2440] Length = 243 3516. 2 Best-BlastP =>> nrprot 53% Identities = 25/56 (44%), Positives = 38/56 (67%) refINP_246251. 11 unknown [Pasteurella multocida] spIQ9CLC6jYD13_PASMU Hypothetical UPF0235 protein PM1313 gbjAAK03397. 11 unknown [Pasteurella multocida] Length = 99 Best-BlastP =>> nprot 56% Identities = 135/383 (35%), Positives = 219/383 (57%), Gaps = 2/383 (0%) refINP_820467. 1 major facilitator family transporter [Coxiella burnetii RSA 493] gblAAO90981. 11 major facilitator family transporter [Coxiella burnetii RSA 493] Length = 428 Best-BlastP =>> nrprot 31% Identities = 80/231 (34%), Positives = 124/231 (53%), Gaps = 7/231 (3 %) refINP_828099. I putative glycosyl transferase [Streptomyces avermitilis MA-4680] dbjIBAC74634. 1 putative glycosyl transferase [Streptomyces avermitilis MA-4680] Length = 265 Best-BlastP =>> nrprot 33% Identities = 90/291 (30%), Positives = 153/291 (52%), Gaps = 5/291 ( 1%) refgP_00056311. COG1807: 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Magnetospirillum magnetotacticum] Length = 500 Best-BlastP =>> nrprot 38% Identities = 88/281 (31%), Positive = 147 / 281 (52%), Gaps = 16/281 (5%) refINP_561543. 1 probable choline kinase [Clostridium perfringens] dbjIBAB80333. 1 probable choline kinase [Clostridium perfringens str.  13] Length = 622 3522. 1 Best-BlastP =>> nrprot 70% Identities = 143/261 (54%), Positives = 180/261 (68%), Gaps = 11/261 (4%) refIZP_00022284. COG3298: Predicted 3'-5 'exonuclease related to exonuclease domain of PoIB [Ralstonia metallidurans] Length = 278,324. 1 Best-BlastP =>> nrprot 67% Identities = 76/142 (53%), Positives = 97/142 (68%) refgP_00065344. COG4764: Uncharacterized Protein Preserved in Bacteria [Microbulbifer degradans 2-40] Length = 204 3525. 1 Best-BlastP =>> nrprot 78% Identities = 137/218 (62%), Positives = 171/218 (78%) refINP_888550. 1 adenylate kinase [Bordetella bronchiseptica] emblCAE32502. 1 adenylate kinase [Bordetella bronchiseptica] Length = 218 3527. 1 Best-BlastP =>> nrprot 63% Identities = 50/115 (43%), Positives = 77/115 (66%) refJZP_00042420. COG0526: Thiol-disulfide isomerase and thioredoxins [Magnetococcus sp.  MC-1] Length = 1243517. 3 3519. 1 3520. 1 3521. 2 3530. 1 Best-BlastP =>> nrprot No Hits found 3532. 1 Best-BlastP =>> nrprot 25% Identities = 141/689 (20%), Positives = 276/689 (40%), Gaps = 124/689 (17%) refINP 048227. 1 I ORF MSV156 hypothetical protein [Melanoplus sanguinipes entomopoxvirus] pirIIT28317 ORF MSV156 hypothetical protein - Melanoplus sanguinipes entomopoxvirus gbIAAC97677. 11 MSV156 ORF hypothetical protein [Melanoplus sanguinipes entomopoxvirus] Length = 1127 3533. 1 Best-BlastP =>> nrprot 81% Identities = 155/205 (75%), Positives = 173/205 (84%) refINP_819890. 1 J uridine kinase [Coxiella burnetii RSA 493] gbIAA090404. 11 uridine kinase [Coxiella burnetii RSA 493] Length = 2153534. 2 Best-BlastP =>> nrprot 79% Identities = 353/540 (65%), Positives = 435/540 (80%), Gaps = 1/540 (0%) embICAD23197. 1 j aikaline phosphomonoesterase [Fluoribacter gormanii] Length = 540 3535. 5 Best-BlastP =>> nrprot No Hits found 3536. 2 Best-BlastP =>> nrprot 58% Identities = 38/91 (41%), Positives = 58/91 (63%) refINP_819118. 1 rhodanese domain protein [Coxiella burnetii RSA 493] gbIAA089632. Rhodanese domain protein [Coxiella burnetii RSA 493] Length = 124 3538. 1 Best-BlastP =>> nrprot 47% Identities = 107/257 (41%), Positives = 151/257 (58%), Gaps = 2/257 (0%) refIZP_00025602. COG1052: Lactate dehydrogenase and related dehydrogenases [Ralstonia metallidurans] Length = 312,354. 1 Best-BlastP =>> nrprot 67% Identities = 239/471 (50%), Positives = 320/471 (67%), Gaps = 19/471 (4%) refINP_820171. 1 l deoxyribodipyrimidine photolyase - class I [Coxiella burnetii RSA 493] gbIAA090685. Deoxyribodipyrimidine photolyase - class 1 [Coxiella burnetii RSA 493] Length = 472 3540. 2 Best-BlastP =>> nrprot 95% Identities = 574/614 (93%), Positives = 591/614 (96%) spIQ48806IDLPA_LEGPN Protein dlpA pirIIS61390 dipA protein - Legionella pneumophila gbIAAA79904. 11 DIpA Length = 615 3541. 1 Best-BlastP =>> nrprot 67% Identities = 127/248 (51%), Positives = 172/248 (69%), Gaps = 2/248 (0%) refINP_819461. 1! pantoate - betaalanine ligase [Coxiella burnetii RSA 493] gbIAA089975. 11 pantoate - beta-alanine Igase [Coxiella burnetii RSA 493] Length = 257 3542. 1 Best-BlastP =>> nrprot 70% Identities = 134/256 (52%), Positives = 186/256 (72%) refINP_819462. 1! 3-methyl-2-oxobutanoate hydroxymethyltransferase [Coxiella burnetii RSA 493] gbIAA089976. 1 3methyl-2-oxobutanoate hydroxymethyltransferase [Coxiella burnetii RSA 493] Length = 266 3543. 1 Best-BlastP =>> nrprot 57% Identities = 87/197 (44%), Positives = 127/197 (64%) refINP_820749. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAA091263. 1 j conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 205 3544. 2 Best-BlastP =>> nrprot 99% Identities = 355/360 (98%), Positives = 359/360 (99%) gbIAAN17183. 1AE492466_1 hypothetical protein [Legionella pneumophila] Length = 360 3545. 1 Best-BlastP =>> nrprot 64% Identities = 153/310 (49%), Positives = 211/310 (68%), Gaps = 3/310 (0%) refIZP_00123394. 1 day COG0196: ADF synthase [Haemophilus somnus 129PT] refZNP_00133316. 1! hypothetical protein [Haemophilus somnus 2336] Length = 314 3547. 1 Best-BlastP =>> nrprot 62% Identities = 64/141 (45%), Positives = 90/141 (63%), Gaps = 2/141 (1%) refINP_820893. 1 universal stress protein A, putative [Coxiella burnetii RSA 493] spIP45680IYJ16_COXBU Hypothetical protein CBU1916 pirII140650 hypothetical protein 146 - Coxiella burnetii gbIAAA56915. 11 unknown gbIAA091407. 11 universal stress protein A, putative [Coxiella burnetii RSA 493] Length = Best-BlastP =>> nrprot 41% Identities = 104/503 (20%), Positives = 202/503 (40%), Gaps = 80/503 ( 15%) refJZP_00084271. COG3266: Uncharacterized Protein Preserved in Bacteria [Pseudomonas fluorescens PfO-1] Length = 533 Best-BlastP =>> nrprot 51% Identities = 189/192 (98%), Positives = 190/192 (98%) gbjAAF05326. 11 3-dehydroquinate synthase homolog [Legionella pneumophila] Length = 192 Best-BlastP =>> nrprot 75% Identities = 103/165 (62%), Positives = 133/165 (80%) refZNP_00134627.  1 COG0703: Shikimate kinase [Actinobacillus pleuropneumoniae serovar 1 str.  4074] Length = 173 Best-BlastP =>> nrprot 64% Identities = 92/193 (47%), Positive = 129/193 (66%), Gaps = 5/193 (2%) refINP_794862. 1 J type IV pilus biogenesis protein PiIO [Pseudomonas syringae pv.  tomato str.  DC3000] gbIAAO58557. 1 j type IV pilus biogenesis protein PiIO [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 207 Best-BlastP =>> nrprot 60% Identities = 72/175 (41%), Positives = 111/175 (63%) gbjAAA93087. 1 membrane protein Length = 199 Best-BlastP =>> nrprot 44% Identities = 35/118 (29%), Positives = 63/118 (53%), Gaps = 1/118 (0%) refINP_820127. 1 NifU family protein [Coxiella burnetii RSA 493] gbjAAO90641. 11 NifU family protein [Coxiella burnetii RSA 493] Length = 119 Best-BlastP =>> nrprot 78% Identities = 236/383 (61%), Positives = 303/383 (79%) refINP_717860. Cysteine desulfurase [Shewanella oneidensis MR-1] gblAAN55304. 1jAE015668_5 cysteine desulfurase [Shewanella oneidensis MR-1] Length = 404 3558. 1 Best- BlastP =>> nrprot No Hits found 3559. 2 Best-BlastP =>> nrprot No Hits found 3561. 2 Best-BlastP =>> nrprot 99% Identities = 782/783 (99%), Positives = 783/783 (100%) pir1IT18329 icmO protein - Legionella pneumophila embICAA73241. 1 IcmO protein [Legionella pneumophila] gbjAAC38193. 11 DotL [Legionella pneumophila] emblCAA75326. 1 IcmO protein [Legionella pneumophila] Length = 783 3562. 3 Best-BlastP =>> nrprot 99% Identities = 374/376 (99%), Positive = 376/376 (100%) pirllT18328 icmP protein - Legionella pneumophila embICAA73240. 1 IcmP protein [Legionella pneumophila] gbJAAC38194. 11 DotM [Legionella pneumophila] embyCAA75325. 11 IcmP protein [Legionella pneumophila] Length = 376 3563. 2 Best-BlastP =>> nrprot 47% Identities = 35/90 (38%), Positives = 55/90 (61%), Gaps = 5/90 (5%) dbjIBAC94688. 1 I hypothetical protein [Vibrio vuinificus YJ016] Length = 343 3564. 2 Best-BlastP =>> nrprot No Hits found 3566. 1 Best-BlastP =>> nrprot 76% Identities = 246/389 (63%), Positives = 305/389 (78%) refINP_716561. Phosphoglycerate kinase [Shewanella oneidensis MR-1] spIQ8EIB1! PGK_SHEON Phosphoglycerate kinase gbjAAN54006.  Phosphoglycerate kinase 11AE015538_3 [Shewanella oneidensis MR-1] Length = 391 3568. 3 Best-BlastP =>> nrprot 66% Identities = 231/477 (48%), Positives = 318/477 (66%), Gaps = 6/477 (1%) refINP243521. 1 pyruvate kinase II [Pseudomonas putida KT2440] gblAAN66985. 11AE016326_11 pyruvate kinase II [Pseudomonas putida KT2440] Length = 484,357. 2 Best-BlastP =>> nrprot 75% Identities = 138/234 (58%), Positives 177/234 (75%) refINP_540513. 11 LrgB protein [Brucella melitensis] pirIIAF3451 IrgB protein [imported] - Brucella melitensis (strain 16M) gblAAL52777. Murein hydrolase export regulator [Brucella melitensis 16M] Length = 235 3548. 2 3550. 1 3551. 1 3554. 4 3555. 2 3556. 2 3557. 1 3570. 2 3572. 1 3574. 1 3575. 2 3578. 2 3581. 1 3582. 2 3584. 1 3586. 2 3588. 2,359. 2 3591. 2 3592. 1 3593. 1 Best-BlastP =>> nrprot 67% Identities = 33/70 (47%), Positives = 48/70 (68%) refINP_902003. 11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbIAAQ60005. 11 = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 75 Best-BlastP =>> nrprot 88% Identities = 109/139 (78%), Positives = 124/139 (89%) reflZP_00012735. COG0432: Uncharacterized conserved protein [Rhodopseudomonas palustris] Length = 139 Best-BlastP =>> nrprot 40% Identities = 83/316 (26%), Positives = 130/316 (41%), Gaps = 44/316 (13% ) refINP_790689. 11 conserved hypothetical protein [Pseudomonas syringae pv.  tomato str.  DC3000] gb! AA054384. 1 I conserved hypothetical protein [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 312 Best-BlastP =>> nrprot 42% Identities = 112/408 (27%), Positives = 192/408 (47%), Gaps = 20/408 (4%) refINP638463. I preserved hypothetical protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] gblAAM42387. 1 l conserved hypothetical protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] Length = 414 Best-BlastP =>> nrprot 91% Identities = 465/524 (88%), Positives = 480/524 (91%), Gaps = 6/524 (1%) gblAAC35592. 11 LphB [Legionella pneumophila] Length = 518 Best-BlastP =>> nrprot 64% Identities = 148/160 (92%), Positives = 153/160 (95%) pirlIS61389 small basic protein sbpA - Legionella pneumophila gblAAA79903. 11 SbpA Length = 161 Best-BlastP =>> nrprot 64% Identities = 134/282 (47%), Positives = 186/282 (65%), Gaps = 1/282 (0%) refIZP_00127817. 11 hypothetical protein [Pseudomonas syringae pv.  syringae B728a] Length = 288 Best-BlastP =>> nrprot 60% Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%) refINP_840361. 11 possible transposase [Nitrosomonas europaea ATCC 19718] refINP841665. 1 possible transposase [Nitrosomonas europaea ATCC 19718] emblCAD84183. 1 possible transposase [Nitrosomonas europaea ATCC 19718] emblCAD85541. 1 possible transposase [Nitrosomonas europaea ATCC 19718] Length = 135 Best-BlastP =>> nrprot 67% Identities = 186/367 (50%), Positives = 251/367 (68%) reflZP_00012935. 1 J COG3177: Uncharacterized conserved protein [Rhodopseudomonas palustris] Length = 367 Best-BlastP =>> nrprot 69% Identities = 83/161 (51%), Positives = 115/161 (71%) refINP 531634. 11 methyltransferase [Agrobacterium tumefaciens str.  C58 (U.  Washington)] pirJIAH2691 methyltransferase Atu0936 [imported] Agrobacterium tumefaciens (strain C58, Dupont) gblAAL41950. 1 J methyltransferase [Agrobacterium tumefaciens str.  C58 (U.  Washington)] Length = 202 Best-BlastP =>> nrprot 41% Identities = 67/120 (55%), Positives = 85/120 (70%) refINP_697359. 1 J conserved hypothetical protein [Brucella suis 1330] gbJAAN29274. 11AE014344_9 conserved hypothetical protein [Brucella suis 1330] Length = 139 Best-BlastP =>> nrprot 65% Identities = 83/182 (45%), Positives = 124/182 (68%), Gaps = 1/182 (0%) refJZP_00067204. 1 J COG1678: Putative Transcriptional Regulator [Microbulbifer degradans 2-40] Length = 203 Best-BlastP =>> nrprot 65% Identities = 73/134 (54%), Positives = 94/134 (70%) gbJAAA69116. ORF_ol 80; was also ORF_o62p before spiice Length = 180 Identities = 133/297 (44%), Positives = 193/297 (64%), Gaps = 10/297 (3%) refINP_821065. 1 J aspartate Best-BlastP =>> nrprot 62% carbamoyltransferase [Coxiella burnetii RSA 493] gbIAAO91579. 1 J aspartate carbamoyltransferase [Coxiella burnetii RSA 493] Length = 310 3594. 1 Best-BlastP =>> nrprot No Hits found 3595. 1 Best-BlastP =>> nrprot 64% Identifies = 39/75 (52%), Positives = 56/75 (74%) refINP_820996. 1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91510. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 81 3596. 1 Best-BlastP =>> nrprot 79% Identities = 82/112 (73%), Positives = 99/112 (88%) refgP_00025955. COG0347: Nitrogen regulatory protein Pl (Ralstonia metallidurans) Length = 1123597. 3 Best-BlastP =>> nrprot 56% Identities = 73/189 (38%), Positives = 109/189 (57%), Gaps = 7/189 (3%) refINP_819119. 5formyltetrahydrofolate cyclo-ligase family protein [Coxiella burnetii RSA 493] gblAAO89633. 15-Formyltetrahydrofolate Cyclo Ligase Family Protein [Coxiella burnetii RSA 493] Length = 197 3598. 3 Best-BlastP =>> nrprot No Hits found 3599. 4 Best-BlastP =>> nrprot 48% Identities = 78/229 (34%), Positives = 131/229 (57%), Gaps = 3/229 (1%) refINP_819456. 1 14-amino-4-deoxychorismate lyase, putative [Coxiella burnetii RSA 493] gblAAO89970. 4-amino-4-deoxychorismate lyase, putative [Coxiella burnetii RSA 493] Length = 281 36. 1 Best-BlastP =>> nrprot 98% Identities = 606/613 (98%), Positives = 607/613 (99%) embICAB60062. 1 I IvhD4 [Legionella pneumophila] Length = 691,360. 3 Best-BlastP =>> nrprot 7% Identities = 39/94 (41%), Positives = 47/94 (50%), Gaps = 1/94 (1%) refINP_900714. 1 hypothetical protein CV1044 [Chromobacterium violaceum ATCC 12472] gbIAAQ58719. CV1044 [Chromobacterium violaceum ATCC 12472] Length = 4993600. 2 Best-BlastP =>> nrprot 66% Identities = 147/311 (47%), Positives = 207/311 (66%), Gaps = 1/311 (0%) refINP_232559. 1 I conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str.  N16961] pir1IH82491 conserved hypothetical protein VCA0159 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF96072. 1 1 conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str.  N16961] Length = 313 3601. 1 Best-BlastP =>> nrprot 68% Identities = 183/385 (47%), Positives = 262/385 (68%), Gaps = 8/385 (2%) refIZP_00065865. COG3004: Na + / H + antiporter [Microbulbifer degradans 2-40] Length = 401 3602. 2 Best-BlastP =>> nrprot 20% Identities = 73/282 (25%), Positives = 120/282 (42%), Gaps = 50/282 (17%) gbIEAA19568. 1! hypothetical protein [Plasmodium yoelii yoelii] Length = 5074 3607. 2 Best-BlastP =>> nrprot 56% Identities = 158/379 (41%), Positives = 224/379 (59%), Gaps = 12/379 (3%) refIZP_00128328. COG2850: Uncharacterized conserved protein [Pseudomonas syringae pv.  syringae B728a] Length = 388 3608. 1 Best-BlastP =>> nrprot No Hits found 3609. 1 Best-BlastP =>> nrprot 99% Identities = 191/192 (99%), Positives = 192/192 (100%) spIP31108ISODF_LEGPN Superoxide dismutase [Fe] pirIIJS0749 superoxide dismutase (EC 1. 15. 1. 1) (Fe) - Legionella pneumophila dbjlBAA02306. Iron superoxide dismutase (Fe-SOD) [Legionella pneumophila] gblAAM00603. 11 Superoxide dismutase [Legionella pneumophila] PREFII2014300A Fe superoxide dismutase Length 192 3610. 1 Best-BlastP =>> nrprot 72% Identities = 202/384 (52%), Positives = 284/384 (73%) refINP_841480. 1 I argD; acetylornithine aminotransferase [Nitrosomonas europaea ATCC 19718] embICAD85350. 1 I argD; acetylornithine aminotransferase [Nitrosomonas europaea ATCC 19718] Length = 393 3611. 2 3612. 2 3613. 3614. 3617. 2 3618. 2 3619. 1 3621. 2 3622. 3623. 2 3625. 2 3626. 1 Best-BlastP =>> nrprot 66% Identities = 119/254 (46%), Positives = 169/254 (66%), Gaps = 2/254 (0%) refINP_440288.  1 I unknown protein [Synechocystis sp.  PCC 6803] pir1IS74928 hypothetical protein s110647 -Synechocystis sp.  (strain PCC 6803) dbjIBAA16968. 1 day ORF_ID: sl10647 unknown protein [Synechocystis sp.  PCC 6803] Length = 256 Best-BlastP =>> nrprot 40% Identities = 68/222 (30%), Positives = 106/222 (47%), Gaps = 16/222 (7%) REFINP 229421. 1 hypothetical protein [Thermotoga maritima] JG72232 hypothetical protein - Thermotoga maritima (strain MSB8) gblAAD36688. 11AE001805_13 hypothetical protein [Thermotoga maritima] Length = 222 Best-BlastP =>> nrprot 75% Identities = 245/422 (58%), Positives = 326/422 (77%), Gaps = 2/422 (0%) refINP_405097.  1 NAD-dependent malic enzyme [Yersinia pestis] refINP_669960. 1I NADlinked malate dehydrogenase (malic enzyme) [Yersinia pestis KIM] pirjIAC0184 malate dehydrogenase (oxaloacetate-decarboxylating) (EC 1. 1. 1.  38) [imported] - Yersinia pestis (strain C092) embICAC90334. 1 NADdependent malic enzyme [Yersinia pestis C092] gblAAM86211. 1 JAE013868_5 NAD-linked malate dehydrogenase (malic enzyme) [Yersinia pestis KIM] Length = 565 Best-BlastP =>> nrprot 99% Identities = 353/354 (99%), Positives = 354/354 (100%) gblAAM00637. 11 putative cobalt / magnesium uptake transporter [Legionella pneumophila] Length = 354 Best-BlastP =>> nrprot 83% Identities = 68/101 (67%), Positives = 85/101 (84%) refINP_820421. NADH dehydrogenase I, K subunit [Coxiella burnetii RSA 493] gblAAO90935. 11 NADH dehydrogenase I, K subunit [Coxiella burnetii RSA 493] Length = 101 Best-BlastP =>> nrprot 72% Identities = 388/654 (59%), Positives = 480/654 (73%), Gaps = 4/654 (0%) refINP_820420. 1 NADH dehydrogenase I, L subunit [Coxiella burnetii RSA 493] gblAA090934. NADH dehydrogenase I, L subunit [Coxiella burnetii RSA 493] Length = 653 Best-BlastP =>> nrprot 70% Identities = 63/137 (45%), Positives = 100/137 (72%) refINP_253434. [Pseudomonas aeruginosa PAO446] [Pseudomonas aeruginosa (strain PAO1) gbIAAGO8132). 1 jAE004888_7 conserved hypothetical protein [Pseudomonas aeruginosa PAOI] Length = 152 Best-BlastP =>> nrprot 78% Identities = 307/491 (62%), Positives = 385/491 (78%), Gaps = 2/491 (0% ) refIZP_00066603. COG0195: Transcription elongation factor [Microbulbifer degradans 2-40] Length = 493 Best-BlastP =>> nrprot 71% Identities = 168/313 (53%), Positives = 226/313 (72%), Gaps = 1 / 313 (0%) reflZP_00092328. 1 I hypothetical protein [Azotobacter vinelandii] Length = 379 Best-BlastP =>> nrprot 73% Identities = 74/123 (60%), Positives = 92/123 (74%), Gaps = 1/123 (0%) refINP_716411 . 1 glycine cleavage system H protein [Shewanella oneidensis MR-1] gb1AAN53856. 11AE015522_11 glycine cleavage system H protein [Shewanella oneidensis MR-1] Length = 129 BestBlastP =>> nrprot 73% Identities = 270/452 (59%), Positives = 338/452 (74%), Gaps = 2/452 (0 %) refINP_840693. Glycine cleavage system P-protein [Nitrosomonas europaea ATCC 19718] EmbICAD84520. Glycine cleavage system P-protein [Nitrosomonas europaea ATCC 19718] Length = 453 BestBlastP =>> nrprot 59% Identities = 44/90 (48%), Positive = 61/90 (67%) refINP_713147. I preserved hypothetical protein [Leptospira interrogans serovar lai str.  56601] gbIAAN50165. 11AE011460_7 conserved hypothetical protein [Leptospira interrogans serovar lai str.  56601] Length = 104 to 3629. 2 Best-BlastP =>> nrprot 75% Identities = 170/291 (58%), Positives = 223/291 (76%) refIDP_00065024. 1 J COG1159: GTPase [Microbulbifer degradans 2-40] Length = 2983631. 4 Best-BlastP =>> nrprot No Hits found 3632. 3 Best-BlastP =>> nrprot 49% Identities = 273/1022 (26%), Positives = 507/1022 (49%), Gaps = 42/1022 (4%) gbJAAP44228. 1 J transposase TnpA [Pseudomonas sp.  ND6] Length = 1009 3633. 3 Best-BlastP =>> nrprot 63% Identities = 122/307 (39%), Positives = 196/307 (63%) refJNP_819755. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90269. 1 j conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 3083634. 1 Best-BlastP =>> nrprot 55% Identities = 103/103 (100%), Positive = 103/103 (100%) splP26880jYPA1_LEGPN Hypothetical protein in PAL 5'region (ORFU) Length = 103 3636. 1 Best-BlastP =>> nrprot 99% Identities = 176/176 (100%), Positives = 176/176 (100%) spJP26493JPAL_LEGPN Peptidoglycan-associated lipoprotein precursor (19 kDa antigen surface) (PPL) pirjIA60337 outer membrane protein pplA, peptidoglycan-associated, precursor - Legionella pneumophila embJCAA43033. 1 lipoprotein antigen [Legionella pneumophila] Length = 176 Best-BlastP =>> nrprot 59% Identities = 188/201 (93%), Positives = 193/201 (96%), Gaps = 4/201 (1%) spJP26881 JYPA2_LEGPN Hypothetical protein in PAL 3'region (ORFD) Length = 201 Best-BlastP =>> nrprot 78% Identities = 141/217 (64%), Positives = 171/217 (78%), Gaps = 1/217 (0% ) refJZP_00083811. 1 COG0602: Organic radical activating enzymes [Pseudomonas fluorescens PfO-1] Length = 218 Best-BlastP =>> nrprot 5% Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 3 / 70 (4%) refINP_900714. 11 hypothetical protein CV1044 [Chromobacterium violaceum ATCC 12472] gbjAAQ58719. 1 j hypothetical protein CV1044 [Chromobacterium violaceum ATCC 12472] Length = 499 Best-BlastP =>> nrprot 51% Identities = 94/313 (30%), Positives = 162/313 (51%), Gaps = 21/313 (6) %) embJCAC51371.  1 mevalonate diphosphate decarboxylase [Lactobacillus helveticus] Length = 320 Best-BlastP =>> nrprot 42% Identities = 65/228 (28%), Positives = 108/228 (47%), Gaps = 12/228 (5%) refjNP_820494. 1 J carry, ZIP family [Coxiella burnetii RSA 493] gbjAAO91008. 1 j transport, ZIP family [Coxiella burnetii RSA 493] Length = 261 Best-BlastP =>> nrprot 57% Identities = 154/329 (46%), Positives = 220/329 (66%), Gaps = 3/329 ( 0%) refINP820351. 11 cation-efflux family protein [Coxiella burnetii RSA 493] gbjAAO90865. 1 j cation-efflux family protein [Coxiella burnetii RSA 493] Length = 378 Best-BlastP =>> nrprot 67% Identities = 132/255 (51%), Positives = 171/255 (67%), Gaps = 15/255 (5%) refJZP 00016164. COG0378: Ni2 + GTPase binding involved in regulation of expression and maturation of urease and hydrogenase [Rhodospirillum rubrum] Length = 268 Best-BlastP =>> nrprot 71% Identifies = 37/67 (55%), Positives = 54/67 (80%) refIDP_00021586. COG0298: Hydrogenase maturation factor [Ralstonia metallidurans] Length = 103 Best-BlastP =>> nrprot 49% Identities = 88/327 (26%), Positives = 165/327 (50%), Gaps = 15/327 (4) %) refJNP_819818. Multidrug resistance protein [Coxiella burnetii RSA 493] gbjAAO90332. Multidrug Resistance Protein [Coxiella burnetii RSA 493] Length = 331 3637. 1 3638. 2,364. 2 3640. 2 3641. 1 3642. 2 3645. 3 3647. 2,365. 4,350. 1 Best-BlastP =>> nrprot 52% Identities = 171/363 (47%), Positives = 221/363 (60%), Gaps = 8/363 (2%) refIZP_00089787. COG1145: Ferredoxin [Azotobacter vinelandii] Length = 3823651. 1 Best-BlastP =>> nrprot 56% Identities = 114/269 (42%), Positives = 158/269 (58%), Gaps = 3/269 (1%) ref1ZP_00089785. 1 COG0543: 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Azotobacter vinelandii] Length = 283 3652. 2 Best-BlastP =>> nrprot 64% Identities = 132/249 (53%), Positives = 169/249 (67%), Gaps = 1/249 (0%) refIZP_00089784. COG1941: Coenzyme F420-reducing hydrogenase, gamma subunit [Azotobacter vinelandii] Length = 2563653. 3 Best-BlastP =>> nrprot 56% Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 3/40 (7%) gbjAAG45149. 1 TraA-like protein [Legionella pneumophila] Length = 8833655. 1 Best-BlastP =>> nrprot No Hits found 3657. 1 Best-BlastP =>> nrprot 48% Identities = 65/171 (38%), Positives = 103/171 (60%), Gaps = 2/171 (1%) ref1NP_174343. Expressed protein [Arabidopsis thaliana] Length = 391 3658. 1 Best-BlastP =>> nrprot No Hits found 3659. 2 Best-BlastP =>> nrprot No Hits found 366. 2 Best-BlastP =>> nrprot No Hits found 3661. 4 Best-BlastP =>> nrprot 32% Identities = 71/191 (37%), Positives = 108/191 (56%), Gaps = 22/191 (11%) reflNP_901795. 11 hypothetical protein CV2125 [Chromobacterium violaceum ATCC 12472] gblAAQ59798. 1 1 hypothetical protein CV2125 [Chromobacterium violaceum ATCC 12472] Length = 202 3663. 1 Best-BlastP =>> nrprot No Hits found 3664. 1 Best-BlastP =>> nrprot 52% Identities = 142/332 (42%), Positives = 203/332 (61%), Gaps = 5/332 (1%) gbIAAK49795. 11 WcbB [Burkholderia pseudomallei] Length = 3653665. 1 Best-BlastP =>> nrprot 52% Identities = 109/243 (44%), Positives = 162/243 (66%) refJZP_00125435. COG0500: SAM-dependent methyltransferases [Pseudomonas syringae pv.  syringae B728a] Length = 646 3666. 2 Best-BlastP =>> nrprot 44% Identities = 121/287 (42%), Positives = 173/287 (60%), Gaps = 2/287 (0%) gblAAK49795. 1 J WcbB [Burkholderia pseudomallei] Length = 3653667. 1 Best-BlastP =>> nrprot No Hits found 3669. 1 Best-BlastP =>> nrprot 83% Identities = 227/316 (71%), Positives = 264/316 (83%) refJNP_820997. 1 cystathionine beta-synthase, putative [Coxiella burnetii RSA 493] gbjAAO91511. 1 I cystathionine beta-synthase, putative [Coxiella burnetii RSA 493] Length = 3163670. 2 Best-BlastP =>> nrprot No Hits found 3671. 2 Best-BlastP =>> nrprot 24% Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 7/134 (5%) refIXP_283791. 1 RIKEN cDNA B230210E21 gene [Mus musculus] Length = 4843673. 2 Best-BlastP =>> nrprot 51% Identities = 137/403 (33%), Positives = 211/403 (52%), Gaps = 9/403 (2%) ref1NP_793575. 1 Major facilitator family transporter [Pseudomonas syringae pv.  tomato str.  DC3000] gbIAAO57270. 1 major facilitator family transporter [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 445 3674. 2 Best-BlastP =>> nrprot 63% Identities = 123/273 (45%), Positives = 173/273 (63%), Gaps = 17/273 (6%) reflZP_00084952. COG1766: Flagellar biosynthesis / type III lipoprotein secretory pathway [Pseudomonas fluorescens PfO-1] Length = 595 3675. 1 Best-BlastP =>> nrprot 60% Identities = 45/87 (51%), Positives = 64/87 (73%), Gaps = 5/87 (5%) dbj! BAC95246. 1 I flagellar hook-basal body protein FIeE [Vibrio vulnificus YJ016] Length = 122 3676. 2 Best-BlastP =>> nrprot 60% Identities = 261/267 (97%), Positives = 263/267 (98%) gblAAG45148. I putative response regulator [Legionella pneumophila] Length = 2673679. 3 Best-BlastP =>> nrprot 56% Identities = 129/324 (39%), Positives = 194/324 (59%), Gaps = 5/324 (1%) refINP_746486. 1 I sensory box histidine kinase FIeS [Pseudomonas putida KT2440] gbIAAN69950. 1 JAE016633_8 sensory box histidine kinase FIeS [Pseudomonas putida KT2440] Length = 405 368. 2 Best-BlastP =>> nrprot 22% Identities = 123/487 (25%), Positives = 188/487 (38%), Gaps = 62/487 (12%) embICAD27470. 1 d SPAPB18E9. 04c [Schizosaccharomyces pombe] Length = 8003680. 1 Best-BlastP =>> nrprot 84% Identities = 230/314 (73%), Positives = 268/314 (85%) refIDP_00135925. 1! COG0492: Thioredoxin reductase [Pseudomonas aeruginosa UCBPP-PA14] Length = 3163681. 1 Best-BlastP =>> nrprot 63% Identities = 110/221 (49%), Positives = 142/221 (64%), Gaps = 3/221 (1%) refINP_842221. 1! Leucyl / phenylalanyl tRNA-protein transferase [Nitrosomonas europaea ATCC 19718] spIQ82ST5ILFTR_NITEU Leucyl / phenylalanyl-tRNA-protein transferase (L / F-transferase) (Leucyltransferase) (Phenylalanyltransferase) EmbICAD86131. 1! Leucyl / phenylalanyl-tRNA-Protein Transferase [Nitrosomonas europaea ATCC 19718] Length = 2363682. 1 Best-BlastP =>> nrprot 66% Identities = 58/122 (47%), Positives = 83/122 (68%) refINP_819118. Rhodanese domain protein [Coxiella burnetii RSA 493] gbIAAO89632. Rhodanese domain protein [Coxiella burnetii RSA 493] Length = 124 3683. 2 Best-BlastP =>> nrprot 93% Identities = 63/72 (87%), Positives = 69/72 (95%) refiNP_404963. 1 I translational initiation factor IF-1 [Yersinia pestis] refINP670107. 1 I protein chain initiation factor IF-1 [Yersinia pestis KIM] refINP928886. 1 I translational initiation factor IF-1 [Photorhabdus luminescens subsp.  laumondii TTOI] spIQ8ZGD3IIF1 YERPE Translation initiation factor IF-1 pirIIAD0167 translation initiation factor IF-1 [imported] - Yersinia pestis (strain CO92) embICAC90199. 1 translation initiation factor IF-1 [Yersinia pestis CO92] gblAAM86358. 1 1EE013884_5 protein chain initiation factor IF-1 [Yersinia pestis KIM] embICAE13888. 1 I translational initiation factor IF-1 [Photorhabdus luminescens subsp.  laumondii TTOI] Length = 72 to 3684. 2 Best-BlastP =>> nrprot 30% Identities = 27/117 (23%), Positives = 61/117 (52%), Gaps = 2/117 (1%) refINP_716604. 1 hypothetical protein [Shewanella oneidensis MR-1] gblAAN54049. 11AE015542_5 hypothetical protein [Shewanella oneidensis MR-1] Length = 4743685. 1 Best-BlastP =>> nrprot 47% Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 2/88 (2%) refINP_800276. 1 putative glutamate synthetase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC62109. 1 putative glutamate synthetase [Vibrio parahaemolyticus] Length = 513 3686. 1 Best-BlastP =>> nrprot 39% Identities = 118/353 (33%), Positives = 206/353 (58%), Gaps = 1/353 (0%) refIZP_00084494. 1! COG2199: FOG: GGDEF domain [Pseudomonas fluorescens PfO-1] Length = 6963687. 1 Best-BlastP =>> nrprot 70% Identifies = 182/294 (61%), Positives = 232/294 (78%) refINP_294489. 1 lipoic acid synthase [Deinococcus radiodurans] spIQ9RWA4ILIPA_DEIRA lipoic acid synthase (Lip-syn) (lipoate synthase) pir1IA75480 lipoic acid synthase - Deinococcus radiodurans (strain R1) gblAAF10341. Lipoic acid synthase [Deinococcus radiodurans] Length = 331 3688. 1 Best-BlastP =>> nrprot 59% Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%) refINP_773278. 1 b1r6638 [Bradyrhizobium japonicum] dbjIBAC51903. [Bradyrhizobium japonicum USDA 110] Length = 1123694. 2 Best-BlastP =>> nrprot 81% Identities = 246/361 (68%), Positives = 294/361 (81%) refINP_819175. Phospho-N-acetylmuramoylpentapeptide transferase [Coxiella burnetii RSA 493] gbIAA089689. Phospho-N-acetylmuramoyl pentapeptide transferase [Coxiella burnetii RSA 493] Length = 3613697. 4 Best-BlastP =>> nrprot 61% Identities = 456/1174 (38%), Positives = 715/1174 (60%), Gaps = 26/1174 (2%) refIDP_00065347. COG1196: Chromosome Segregation ATPases [Microbulbifer degradans 2-40] Length = 1168 3699. 3 Best-BlastP =>> nrprot No Hits found 37. 1 Best-BlastP =>> nrprot 98% Identities = 322/334 (96%), Positives = 330/334 (98%) gbIAAM08248. 1 putative component of the IV secretion system [Legionella pneumophila] Length = 334 3701. 1 Best-BlastP =>> nrprot 31% Identities = 57/156 (36%), Positives = 84/156 (53%), Gaps = 8/156 (5%) refINP_522544. 11 PROBABLE TRANSCRIPTION REGULATOR PROTEIN [Ralstonia solanacearum] embiCAD18134. 11 PROBABLE TRANSCRIPTION REGULATOR PROTEIN [Ralstonia solanacearum] Length = 227 3702. 1 Best-BlastP =>> nrprot 69% Identities = 131/242 (54%), Positives = 172/242 (71%), Gaps = 4/242 (1%) refINP 284288. 1 putative Pseudouridine synthase [Neisseria meningitidis Z2491] pin H81849 probable pseudouridine synthase NMA1573 [imported] - Neisseria meningitidis (strain Z2491 serogroup A) embICAB84800. 11 putative pseudouridine synthase [Neisseria meningitidis Z2491] Length = 3703. 1 Best-BlastP =>> nrprot 67% Identities = 90/173 (52%), Positives = 130/173 (75%) refIVE 00127917. COG1386: Predicted transcriptional regulator containing the HTH domain [Pseudomonas syringae pv.  syringae B728a] Length = 255 3705. 1 Best-BlastP =>> nrprot 70% Identities = 140/250 (56%), Positives = 186/250 (74%) refINP_642633. I preserved hypothetical protein [Xanthomonas axonopodis pv.  citri str.  306] gbIAAM37169. 11 conserved hypothetical protein [Xanthomonas axonopodis pv.  citri str.  306] Length = 279,3706. 2 Best-BlastP =>> nrprot 77% Identities = 254/396 (64%), Positives = 314/396 (79%) refINP_519264. 1 PROBABLE TRYPTOPHANYL-TRNA SYNTHETASE (SYW PROTEIN) [Ralstonia solanacearum] spIQ8YOA1 ISYW_RALSO Tryptophanyl-tRNA synthetase (Tryptophan- tRNA ligase) (TrpRS) embICAD14845. PROBABLE TRYPTOPHANYL-TRNA SYNTHASE (SYW PROTEIN) [Ralstonia solanacearum] Length = 400 3708. 1 Best-BlastP =>> nrprot 75% Identities = 130/205 (63%), Positives = 167/205 (81%) reflZP_00067870. 1 I COG0009: Putative Translation Factor (SUA5) [Microbulbifer degradans 2-40] Length = 207,3709. 1 Best-BlastP =>> nrprot 58% Identities = 119/275 (43%), Positives = 165/275 (60%), Gaps = 2/275 (0%) refINP_841756. 1 PHP domain N-terminal region: C-terminal region PHP domain [Nitrosomonas europaea ATCC 19718] embICAD85635. 1 PHP domain N-terminal region: C-terminal region PHP domain [Nitrosomonas europaea ATCC 19718] Length = 316 371. 1 Best-BlastP =>> nrprot No Hits found 3710. 1 Best-BlastP =>> nrprot 67% Identities = 152/329 (46%), Positives = 214/329 (65%), Gaps = 25/329 (7%) REFINP 245983. 1 PhoH [Pasteurella multocida] gblAAK03130. 11 PhoH [Pasteurella multocida] Length = 372 3711. 1 Best-BlastP =>> nrprot 66% Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 2/152 (1%) refINP_746893. 1 1 conserved hypothetical protein TIGR00043 [Pseudomonas putida KT2440] gblAAN70357. 1 IAE016677_8 conserved hypothetical protein TIGR00043 [Pseudomonas putida KT2440] Length = 157,312. 2 Best-BlastP =>> nrprot 65% Identities = 139/261 (53%), Positives = 189/261 (72%) dbjIBAC93678. 1 putative hemolysin [Vibrio vuinificus YJ016] Length = 306 3714. 3 Best-BlastP =>> nrprot No Hits found 3720. 2 Best-BlastP =>> nrprot 86% Identities = 192/264 (72%), Positives = 228/264 (86%) refJZP_00024661. COG0207: Thymidylate synthase [Ralstonia metallidurans] Length = 264 3721. 1 Best-BlastP =>> nrprot 64% Identities = 79/143 (55%), Positives = 101/143 (70%) refINP 819678. 1 j riboflavin synthase, beta subunit [Coxiella burnetii RSA 493] gblAAO90192. 1 riboflavin synthase, subunit beta [Coxiella burnetii RSA 493] Length = 151 3729. 1 Best-BlastP =>> nrprot 53% Identities = 70/188 (37%), Positives = 101/188 (53%), Gaps = 14/188 (7%) refINP_636438. I conserved hypothetical protein [Xarthomonas campestris pv.  campestris str.  ATCC 33913] gblAAM40362. 11 conserved hypothetical protein [Xanthomonas campestris pv.  campestris str.  ATCC 33913] Length = 176,330. 1 Best-BlastP =>> nrprot No Hits found 3731. 1 Best-BlastP =>> nrprot 63% Identities = 56/114 (49%), Positives = 77/114 (67%), Gaps = 1/114 (0%) refINP890078. 1 I phage integrase [Bordetella bronchiseptica] embICAE34037. I integrase phage [Bordetella bronchiseptica] Length = 407 3732. 1 Best-BlastP =>> nrprot 36% Identities = 58/180 (32%), Positives = 107/180 (59%), Gaps = 1/180 (0%) refINP_624053. 1 I predicted transposase [Thermoanaerobacter tengcongensis] gbIAAM25657. Predicted transposase [Thermoanaerobacter tengcongensis] Length = 267 3734. 1 Best-BlastP =>> nrprot 37% Identities = 86/323 (26%), Positives = 140/323 (43%), Gaps = 53/323 (16%) refINP_563745. 1 expressed protein [Arabidopsis thaliana] gblAAM65464. 11 unknown [Arabidopsis thaliana] gblAAN72060. Expressed protein [Arabidopsis thaliana] gblAAP42733. At1g05620 [Arabidopsis thaliana] Length = 322 3735. 2 Best-BlastP =>> nrprot 36% Identities = 106/496 (21%), Positives = 199/496 (40%), Gaps = 61/496 (12%) gblEAA16521. 11 235 kDa rhoptry protein [Plasmodium yoelii yoelii] Length = 2740 3737. 1 Best-BlastP =>> nrprot No Hits found 3739. 3 Best-BlastP =>> nrprot 79% Identities = 100/146 (68%), Positives = 117/146 (80%) refINP_539647. 1 LACTOYLGLUTATHIONE LYASE 374. Poly (3-hydroxyalkanoate) synthetase [Burkholderia fungorum] Length = 642 3740. 3 Best-BlastP =>> nrprot 72% Identities = 95/159 (59%), Positives = 128/159 (80%) refIZP_00021733. COG2862: Predicted Membrane Protein [Ralstonia metallidurans] Length = 206 [Brucella melitensis] pirIIAD3343 Iactoylglutathione lyase (EC 4. 4. 1. 5) [imported] - Brucella melitensis (strain 16M) gblAAL51911. 1 1 LACTOYLGLUTATHIONE LYASE [Brucella melitensis 16M] Length = 173 13/595 (2%) refZep_00029131. 1! COG3243: Best-BlastP =>> nrprot 66% Identities = 302/595 (50%), Positives = 393/595 (66%), Gaps = 3741. 1 Best-BlastP =>> nrprot 32% Identities = 61/271 (22%), Positives = 133/271 (49%), Gaps = 18/271 (6%) refIXP_230851. 2! Rattus norvegicus Length = 396 3742. 1 Best-BlastP =>> nrprot No Hits found 3743. 1 Best-BlastP =>> nrprot No Hits found 3744. 2 Best-BlastP =>> nrprot No Hits found 3747. 2 Best-BlastP =>> nrprot 49% Identities = 99/264 (37%), Positives = 149/264 (56%), Gaps = 7/264 (2%) refINP_743187. 1 peptidase, M23 / M37 family [Pseudomonas putida KT2440] gblAAN66651. 1IAE016293_1 peptidase, M23 / M37 family [Pseudomonas putida KT2440] Length = 2753748. 1 Best-BlastP =>> nrprot 63% Identities = 192/445 (43%), Positives = 280/445 (62%), Gaps = 5/445 (1%) refINP 461447. 1 exonuclease VII, broad subunit [Salmonella typhimurium LT2] spIQ8ZN58JEX7L_SALTY Probable exodeoxyribonuclease VII wide subunit (Exonuclease VII broad subunit) gbIAAL21406. 1 exonuclease VII, broad subunit [Salmonella typhimurium LT2] Length = 449 3750. 2 Best-BlastP =>> nrprot 42% Identities = 156/424 (36%), Positives = 245/424 (57%), Gaps = 2/424 (0%) pirlIS27611 agglutination protein - Pseudomonas putida gbJAAA25695. Agglutination Protein Length = 452 3752. 2 Best-BlastP =>> nrprot 54% Identities = 82/187 (43%), Positives = 116/187 (62%), Gaps = 2/187 (1%) refJZP_00065146. COG3672: Predicted Periplasmic Protein [Microbulbifer degradans 2-40] Length = 241 3753. 2 Best-BlastP =>> nrprot 55% Identities = 197/655 (30%), Positive = 352/655 (53%), Gaps = 41/655 (6%) reffZP 00086698. COG2200: FOG: EAL domain [Pseudomonas fluorescens PfO-1] Length = 648 3754. 2 Best-BlastP =>> nrprot 36% Identities = 48/170 (28%), Positives =

  88/170 (51%), Gaps = 11/170 (6%) ref. BII6577 [Bradyrhizobium japonicum] dbjIBAC51842.1 bll6577 [Bradyrhizobium japonicum USDA 110] Length = 237 3756.2 Best-BlastP =>> nrprot 67% Identities = 234/439 (53%), Positives = 301/439 (68%), Gaps = 7/439 (1%) refINP_713336.1 f putative flavincontaining monooxygenase [Leptospira interrogans serovar lai str. 56601] gbfAAN50354.1 IAE011478_5 putative flavin-containing monooxygenase [Leptospira interrogans serovar lai str. 56601] Length = 468 376.3 Best-BlastP =>> nrprot 69% Identities = 155/329 (47%), Positives = 230/329 (69%), Gaps = 4/329 (1%) refINP_931992.1 glycerol-3 phosphate dehydrogenase [NAD (P) +] (NAD (P) H-dependent glycerol-3-phosphate dehydrogenase) [Photorhabdus luminescens subsp. laumondii TTO1] glycerol-3-phosphate dehydrogenase [NAD (P) +] (NAD (P) H-dependent glycerol-3-phosphate dehydrogenase) [Photorhabdus luminescens subsp. laumondii TTOI] Length = 340 3760.3 Best-BlastP =>> nrprot 69% Identities = 292/614 (47%), Positives = 418/614 (68%), Gaps = 13/614 (2%) refINP_924289.1 J glutathioneregulated potassium efflux system protein KefC homolog [Gloeobacter violaceus] dbjIBAC89284.1 f girl 343 [Gloeobacter violaceus] Length = 634 3761.1 Best-BlastP =>> nrprot No Hits found 3763.1 Best-BlastP =>> nrprot 44% Identities = 59/195 ( 30%), Positive = 90/195 (46%), Gaps = 34/195 (17%) refINP_052362.1 f unnamed protein product [Coxiella burnetii] refINP_819025.11 hypothetical protein [Coxiella burnetii RSA 493] pirf IS38244 hypothetical protein - Coxiella burnetii embfCAA53132.1 [Coxiella burnetii] [Coxiella burnetii] gbfAAO91585.1 f hypothetical protein [Coxiella burnetii RSA 493] Length = 361 3764.3 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 46% Identities = 80/315 (25%), Positives = 147/315 (46%), Gaps = 20/315 (6%) refgP_00124222.1 COG1721: Uncharacterized conserved protein (some members contain von Willebrand factor type A (vWA) domain) [Pseudomonas syringae pv. syringae B728a] Length = 327 Best-BlastP =>> nrprot 66% Identities = 137/265 (51%), Positives = 185/265 (69%), Gaps = 6/265 (2%) ref! NP_819341.1 1 glutamate racemase [Coxiella burnetii RSA 493] gblAAO89855.11 glutamate racemase [Coxiella burnetii RSA 493] Length = 280 Best-BlastP =>> nrprot 66% Identities = 105/197 (53%), Positives = 138/197 (70%) , Gaps = 2/197 (1%) refINP_717670.1 phosphoribosyl-ATP pyrophosphatase / phosphoribosyl-AMP cyclohydrolase [Shewanella oneidensis MR-1] gblAAN55114.11AE0156487 phosphoribosyl-ATP pyrophosphatase / phosphoribosyl-AMP cyclohydrolase [Shewanella oneidensis MR-1] Length = 211 Best-BlastP =>> nrprot 69% Identities = 185/353 (52%), Positives = 245/353 (69%), Gaps = 2/353 (0%) refINP_405132.11 histidinolphosphatase and imidazoleglycerol-phosphate dehydratase [Yersinia pestis] refINP_669926.1 1 imidazoleglycerol phosphate dehydratase; histidinol-phosphate phosphatase [Yersinia pestis KIM] spIQ8ZFX7IHIS7 YERPE Histidine biosynthesis bifunctional protein hisB [Includes: Histidinol-phosphatase; Imidazoleglycerol-phosphate dehydratase (IGPD)] pirIIAF0188 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) [imported] - Yersinia pestis (strain CO92) IICIAC90369.1 I histidinol-phosphatase and imidazoleglycerol-phosphate dehydratase [Yersinia pestis CO92] gbIAAM86177.1 IAE013864_4 imidazoleglycerol phosphate dehydratase; histidinol-phosphate phosphatase [Yersinia pestis KIM] Length = 355 Best-BlastP =>> nrprot 62% Identities = 50/84 (59%), Positives = 62/84 (73%) refiZP_00038938.1 I COG4496: Uncharacterized protein conserved in bacteria [Xylella fastidiosa Dixon] Length = 112 Best-BlastP =>> nrprot 23% Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 5/60 (8%) refINP_700818.1 merozoite surface protein 3 [Plasmodium falciparum 3D7] gblAAC09377.1 I antigen [Plasmodium falciparum] gbjAAN35542.1 JAE014834_39 merozoite surface protein 3 [Plasmodium falciparum 3D7] Length = 354 Best-BlastP =>> nrprot 75% Identities = 55/95 (57 %), Positive = 74/95 (77%) COG2827: Predicted endonuclease containing a URI domain [Novosphingobium aromaticivorans] Length = 111 3784.2 Best-BlastP =>> nrprot 72% Identities = 190/364 (52%) , Positives = 266/364 (73%), Gaps = 3/364 (0%) refJZP_00122463.11 COG3842: ABC-type spermidine / putrescine transport systems, ATPase components [Haemophilus somnus 129PT] Len gth = 372 3785.2 Best-BlastP =>> nrprot 71% Identities = 124/276 (44%), Positives = 203/276 (73%), Gaps = 2/276 (0%) refINP_439497.1 l spermidine / putrescine ABC [Spermidine / putrescine transport system permeaseprotein potB pirIIA64118 spermidine / putrescine transport system permease potB-Haemophilus influenzae (strain Rd KW20) gbIAAC22990.11 spermidine / putrescine ABC transporter, permease protein (potB) Haemophilus influenzae Rd Spermidine / putrescine transport system ] Length = 286 3788.1 Best-BlastP =>> nrprot 68% Identities = 115/251 (45%), Positives = 176/251 (70%) refZD_00128580.1 l COG1177: ABC-type spermidine / putrescine transport system, permease component II [Desulfovibrio desulfuricans G20] Length = 257 3765.1 377.1 3771.2 3772.2 3778.2 3780.2 3783.1 3789.2 Best-BlastP =>> nrprot 65% Identities = 122/283 (43%), Positives = 187/283 (66%), Gaps = 3 / 283 (1%) refINP_231067.11 spermidine / putrescine ABC transporter, periplasmic spermidine / putrescin e-binding protein [Vibrio cholerae 01 biovar eltor str.

  N16961] pirlIB82201 spermidine / putrescine ABC transport, periplasmic spermidine / putrescine-binding protein VC1424 [imported] Vibrio cholerae (strain N16961 serogroup 01) gbJAAF94581.1 spermidine / putrescine ABC transport, periplasmic spermidine / putrescine-binding protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 345 3791.1 Best-BlastP =>> nrprot No Hits found 3792.1 Best-BlastP =>> nrprot No Hits found 3793.3 Best-BlastP =>> nrprot 43% Identities = 78/264 (29%), Positives = 132 / 264 (50%), Gaps = 10/264 (3%) refJZP_00018971.11 hypothetical protein [Chloroflexus aurantiacus] Length = 303 3796.3 Best-BlastP =>> nrprot 58% Identities = 87/178 (48%), Positives = 120/178 (67%) refINP_840387.1 l Bacterial regulatory proteins, TetR family [Nitrosomonas europaea ATCC 19718] emblCAD84211.11 Bacterial regulatory proteins, Tetra family [Nitrosomonas europaea ATCC 19718] Length = 213 3797.1 Best-BlastP =>> nrprot 68 % Identities = 167/346 (48%), Positives = 239/346 (69%), Gaps = 6/346 (1%) refINP_831149.1 J Nitropropane dioxygenase / Trans-enoyl-CoA reductase family [Bacillus cereus ATCC 14579] gbIAAP08350.11 Nitropropane dioxygenase / Trans-enoyl-CoA reductase family [Bacillus cereus ATCC 14579] Length = 363 3798.1 Best-BlastP =>> nrprot No Hits found 3800.4 Best-BlastP =>> nrprot No Hits found 3 801.2 Best-BlastP =>> nrprot 99% Identities = 477/483 (98%), Positives = 481/483 (99%) gbIAAM00644.11 adenylate cyclase [Legionella pneumophila] Length = 483 3802.2 Best-BlastP =>> nrprot 63 % Identities = 189/413 (45%), Positives = 270/413 (65%), Gaps = 2/413 (0%) REFINP_742893.1 Glutamyl-tRNA reductase [Pseudomonas putida KT2440] gblAAN66357.1 1AE016264_1 Glutamyl-tRNA reductase [Pseudomonas putida KT2440] Length = 425 3803.1 Best-BlastP =>> nrprot 84% Identities = 235/358 (65%), Positives = 306/358 (85%) refINP_820940.1 I peptide chain release factor 1 [Coxiella burnetii RSA 493] spIP47849IRF1_COXBU Peptide chain release factor 1 (RF-1) gbjAA091454.1 peptide chain release factor 1 [Coxiella burnetii RSA 493] Length = 361 3804.2 Best-BlastP =>> nrprot 66% Identities = 134/281 (47% ), Positives = 192/281 (68%), Gaps = 6/281 (2%) refJZP_00066170.11 COG2890: Methylase of polypeptide chain release factors [Microbulbifer degradans 2-40] Length = 288 3807.2 Best-BlastP =>> nrprot 84% Identi = 97/133 (72%), Positive = 115/133 (86%) refINP_706093.1 dnaK suppressor protein [Shigella flexneri 2a str. 301] refINP_752128.11 DnaK suppressor protein [Escherichia coli CFT073] gbjAAN41800.11AE015050_16 dnaK suppressor protein [Shigella flexneri 2a str. 301] gbIAAN78672.11AE016755_172 DnaK suppressor protein [Escherichia coli CFT073] Length = 157 381.6 Best-BlastP =>> nrprot 24% Identities = 141/721 (19%), Positives = 282/721 (39%), Gaps = 94 / 721 (13%) refINP_010225.11 involved intracellular protein transport, coiled-coil protein necessary for protein transport from ER to Golgi; Usol p [Saccharomyces cerevisiae] pir1IS67593 transport protein USO1-yeast (Saccharomyces cerevisiae) embICAA98621.11 USO1 [Saccharomyces cerevisiae] Length = 1790 3810.1 Best-BlastP =>> nrprot 53% Identities = 78/237 (32%), Positive = 123 / 237 (51%), Gaps = 22/237 (9%) refINP_721557.1 conserved hypothetical protein [Streptococcus mutans UA159] gbjAAN58863.11AE014954_2 conserved hypothetical protein [Streptococcus mutans UA159] Length = 246 3811.1 Best-BlastP =>> nrprot 48 % Identities = 43/154 (27%), Positives = 73/154 (47%), Gaps = 35/154 (22%) refZGP_00074907.11 COG0534: Na ± 3814.1 3815.2 protein [Chromobacterium violaceum ATCC 12472] gblAAQ59662. ATCC 12472 Length = 104 3816.2 Best-BlastP =>> nrprot 69% Identities = 121/232 (52%), Positives = 170/232 (73%) ReflNP_719120.1 J CDP-diacylglycerol -serine Ophosphatidyltransferase, putative [Shewanella oneidensis MR-1] gbJAAN56564.I IAE015794_2 CDP-diacylglycerol - serine Ophosphatidyltransferase, putative [Shewanella oneidensis MR-1] Length = 269 3818.1 Best-BlastP =>> nrprot 81% Identities = 50/89 (56%), Positives = 73/89 (82%) refJNP_900485.1 I sugar transport PTS system phosphocarrier HPR protein [Chromobacterium violaceum ATCC 12472] gbJAAQ58490.1 J sugar transport PTS phosphoric acid system HPR protein [Chromobacterium violaceum ATCC 12472] Length = 3819.2 Best-BlastP =>> nrprot 76% Identities = 61/95 (64%), Positive = 76/95 (80%) dbjJBAC93211.11 putative sigma-54 modulation protein [Vibrio vulnificus YJ016] Length = 95 3821.1 Best- BlastP =>> nrprot No Hits found 3822.2 Best-BlastP =>> nrprot 41% Identities = 44/157 (2 8%), Positive = 74/157 (47%), Gaps = 16/157 (10%) refJNP_863847.11 Hypothetical protein [Pirellula sp.] EmbICAD71520.1 I hypothetical protein [Pirellula sp.] Length = 171 3824.2 Best- BlastP =>> nrprot 56% Identities = 166/428 (38%), Positives = 244/428 (57%), Gaps = 12/428 (2%) refINP_820492.1 myJ protein [Coxiella burnetii RSA 493] gbJAAO91006.1 J = YJ protein [Coxiella burnetii RSA 493] Length = 449 3826.1 Best-BlastP =>> nrprot 57% Identities = 129/323 (39%), Positives = 190/323 (58%), Gaps = 9/323 (2%) birA bifunctional protein [Coxiella burnetii RSA 493] gbJAAO90523.1 I birA bifunctional protein [Coxiella burnetii RSA 493] Length = 323 3827.2 Best-BlastP =>> nrprot 49% Identities = 224/663 (33%), Positives = 330/663 (49%), Gaps = 66/663 (9%) refJNP_106287.11 0-antigen acetylase [Mesorhizobium loti] dbjJBAB52073.11 0-antigen acetylase [Mesorhizobium loti] Length = 628 3830.2 Best-BlastP => > nrprot No Hits found 3832.1 Best-BlastP =>> nrprot 41% Identities = 107/294 ( 36%), Positive = 168/294 (57%), Gaps = 16/294 (5%) refJNP_899726.1 I probable aminopeptidase [Chromobacterium violaceum ATCC 12472] gblAAQ57736.1 probable aminopeptidase [Chromobacterium violaceum ATCC 12472] Length = 415 3834.1 Best-BlastP =>> nrprot No Hits found 3835.2 Best-BlastP =>> nrprot 47% Identities = 66/245 (26%), Positives = 118/245 (48%), Gaps = 10/245 (4%) embJCAA60105.1 J artJ [Escherichia coin Length = 243 driven multidrug efflux pump [Trichodesmium erythraeum IMS101] Length = 931 Best-BlastP =>> nrprot 98% Identities = 278/282 (98%), Positives = 280/282 (99% ) gbJAAM73852.11AF454863_I putative Lipase lipase [Legionella pneumophila] Length = 282 Best-BlastP =>> nrprot 65% Identities = 41/81 (50%), Positives = 62/81 (76%), Gaps = 2/81 (2) % = n = 351% (37%), Positives = 61/120 (50%), Gaps = 8/120 (6%) gbIAAH52346.1 4921520G13Rik Length = 379 Identities = 710 / 718 (98%), Positive = 716/718 (99%) EmbicAD90951.1 I LssB protein [L egionella pneumophila] Identities = 78/169 (46%), Positives = 111/169 (65%), Gaps = 2/169 (1%) gbIAAN34371.1 ORF1 transposase Length = 180 Best-BlastP =>> nrprot 99% Identities = 352/355 (99%), Positive = 355/355 (100%) EmbicAD90958.1 I LssD protein [Legionella pneumophila] Length = 378 Best-BlastP =>> nrprot 91% Identities = 719/842 (85%) Positive = 774/842 (91%). COG0861: Membrane protein TerC, possibly involved in tellurium resistance [Microbulbifer degradans 2-40] Length = 244 3850.1 Best-BlastP =>> nrprot 72% Identities = 82/139 (58% ) Positive = 102/139 (73%) ReflZP_00086776.1 COG1981: Predicted membrane protein [Pseudomonas fluorescens PfO-1] Length = 142 3851.1 Best-BlastP =>> nrprot 83% Identities = 43/56 (76%), Positive = 49/56 (87%) ReflNP_841467.1 Rubredoxin: Rubredoxin-type Fe (Cys) 4 protein [Nitroso] monas europaea ATCC 19718] embICAD85337.1 I Rubredoxin: Rubredoxin-type Fe (Cys) 4 protein [Nitrosomonas europaea ATCC 19718] Length = 62 3853.2 Best-BlastP =>> nrprot 74% Identities = 264/426 (61%), Positive = 318/426 (74%) ref1ZP_00133736.1 I COG0001: Glutamate-1-semialdehyde aminotransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 426 3855.1 Best-BlastP =>> nrprot 59% Identities = 115/256 (44%), Positive = 157/256 (61%), Gaps = 1/256 (0%) refINP 251460.1 l hypothetical protein [ Pseudomonas aeruginosa PA0I] spIQ9I073IYR70_PSEAE Hypothetical protein PA2770 pirIIA83301 hypothetical protein PA2770 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG06158.11AE004704_12 hypothetical protein PA2770 [Pseudomonas aeruginosa PAOI] Length = 259 3857.3 Best-BlastP =>> nrprot 99% Identities = 367 / 372 (98%), Positives = 371/372 (99%) gblAAD42885.1 1AF157018_1 PrpC [Legionella pneumophila] Length = 372 3859.2 Best-BlastP =>> nrprot 84% Identities = 308/442 (69%), Positives = 374 / 442 (84%), Gaps = 5/442 (1%) ATP-dependent hsl ATP-binding subunit hslU protease [Escherichia coli CFT073] spIQ8FBC0IHSLU_ECOL6 ATP-dependent hsl ATP-binding subunit hslU gblAAN83312.1 IAE016770_112 ATP-dependent hsl ATP-binding subunit hslU protease [Escherichia coli CFT073] Length = 443 3860.2 Best-BlastP => > nrprot 89% Identities = 146/180 (81%), Positives = 164/180 (91%) reflNP_820986.1 HsIVU protease, HsIV subunit [Coxiella burnetii RSA 493] gbIAAO91500.11 HsIVU protease, HsIV subunit [Coxiella burnetii RSA 493] Length = 181 3863.2 Best-BlastP =>> nrprot 99% Identities = 196/199 (98%), Positives = 198/199 (99%) spIO32481 IGRPE_LEGPN PROTEIN GRP (HSP-70 COFACTOR) dbjjBAA22782.1j GrpE [Legionella pneumophila] Length = 199 3837.3 3838.3 384.3 3840.1 3841.2 Length 3846.2 Best-BlastP =>> nrprot 41 '% Identities = 205/677 (30%), Positives = 350/677 (51%), Gaps = 31/677 (4%) ) gblAAM82673.11 PacS [Synechococcus sp. PCC 7942] Length = 747 3849.1 Best-BlastP =>> nrprot 12% protein [Mus musculus] Best-BlastP =>> nrprot 99% Length = 718 Best-BlastP =>> nrprot 30% [Acinetobacter baumannii] 3867.2 Best-BlastP =>> nrprot 72% Identities = 242/435 (55%), Positives = 325/435 (74%), Gaps = 1/435 (0%) gbIAAK14074.1 jAF303107_1 family II 2-keto-3-deoxy-D -arabino-heptulosonate 7-phosphate synthase [Xanthomonas campestris] Length = 478 3871.1 Best-BlastP =>> nrprot No Hits found 3872.1 Best-BlastP =>> nrprot No Hits found 3874.1 Best-BlastP =>> nrprot No Hits found 3876.1 Best -BlastP =>> nrprot 42% Identities = 49/160 (30%), Positives = 71/160 (44%), Gaps = 29/160 (18%) refZGP_00079746.1 l COG3034: Uncharacterized protein preserved in bacteria [Geobacter metallireducens] Length = 175 3878.1 Best-BlastP =>> nrprot 23% Identities = 112/536 (20%), Positives = 244/536 (45%), Gaps = 42/536 (7%) gbIAAO52540.1 Similar to Entamoeba histolytica. Myosin heavy chain [Dictyostelium discoideum] Length = 915 3884.2 Best-BlastP =>> nrprot No Hits found 3887.1 Best-BlastP =>> nrprot 37% Identities = 87/397 (21%), Positives = 155/397 (39%) , Gaps = 28/397 (7%) refINP_764987.1 multidrug resistance protein-like protein [Staphylococcus epidermidis ATCC 12228] gbIAAO05031.1 jAE016748_265 multidrug protein-like protein resistance [Staphylococcus epidermidis ATCC 12228] Length = 404 3888.1 Best-BlastP = >> nrprot No Hits found 3889.1 Best-BlastP =>> nrprot 48% Identities = 75/257 (29%), Positives = 126/257 (49%), Gaps = 23/257 (8%) refINP_922978.1 j hypothetical protein gUI0032 [Gloeobacter violaceus] dbjIBAC87973.1 I g110032 [Gloeobacter violaceus] Length = 267 389.3 Best-BlastP =>> nrprot 61% Identities = 283/637 (44%), Positives = 401/637 (62%), Gaps = Probably ATP-dependent DNA helicase-related protein [Nitrosomonas europaea ATCC 19718] Probable ATP-dependent DNA helicase-related protein [AT] Nitrosomonas europaea ATCC 19718 omonas europaea ATCC 19718] Length = 646 3890.2 Best-BlastP =>> nrprot No Hits found 3891.2 Best-BlastP =>> nrprot 56% Identities = 85/194 (43%), Positives = 120/194 (61%), Gaps = 7/194 (3%) refINP_698073.1 conserved hypothetical protein [Brucella suis 1330] gbIAAN29988.11AE014408_2 conserved hypothetical protein [Brucella suis 1330] Length = 203 3892.3 Best-BlastP =>> nrprot 55% Identities = 149/349 ( 42%), Positives = 207/349 (59%), Gaps = 3/349 (0%) refZD_00008996.1 COG1752: Predicted Esterase of the Superhydrophilic alpha-beta hydrolase [Rhodopseudomonas palustris] Length = 379 3895.2 Best-BlastP = >> nrprot 48% Identities = 92/324 (28%), Positives = 160/324 (49%), Gaps = 11/324 (3%) refINP_819818. Multidrug resistance protein [Coxiella burnetii RSA 493] gbIAAO90332. 1 I multidrug resistance protein [Coxiella burnetii RSA 493] Length = 331 3898.2 Best-BlastP =>> nrprot No Hits found 3899.2 Best-BlastP =>> nrprot No Hits found 39.1 Best-BlastP =>> nrprot 96% Identities = 340 / 363 (93%), Positives = 352/363 (96%) EmbICAB60060.1 IvhB10 [Legionella pneumophila] Length = 363 390.2 Best-BlastP =>> nrprot 86% Identities = 80/106 (75%), Positives = 97 / 106 (91%) spIP088111FER_PSEST Ferredoxin pirjIFEPSTV ferredoxin [3Fe-4S] [4Fe-4S] - Pseudomonas stutzeri prfI j 1410240A ferredoxin Length = 106 3901.2 Best-BlastP =>> nrprot 75% Identities = 152/272 (55%), Positive = 204/272 (75%) refINP_250460.1 conserved hypothetical protein [Pseudomonas aeruginosa PA01] spIQ9I2X01YH69_PSEAE Hypothetical UPF0085 protein PA1769 pirjID83425 conserved hypothetical protein PA1769 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG05158.1 jAE004602_9 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] Length = 274 3902.3 Best-BlastP =>> nrprot 79% Identities = 312/48 1 (64%), Positives = 382/481 (79%) refGZP_00081898.1 COG2079: Uncharacterized protein involved in propionate catabolism [Geobacter metallireducens] Length = 481 3904.3 Best-BlastP =>> nrprot 54% Identities = 222/592 (37%) %), Positive = 332/592 (56%), Gaps = 16/592 (2%) refINP_359923.1 j multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] pirliF97735 hypothetical protein abcT3 [imported] - Rickettsia conorii (strain Malish 7) gbjAAL02824.1 j multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] Length = 589 3908.3 Best-BlastP =>> nrprot No Hits found 3909.3 Best-BlastP =>> nrprot No Hits found 3911.2 Best-BlastP => > nrprot 78% Identities = 384/621 (61%), Positives = 489/621 (78%), Gaps = 3/621 (0%) spjP58480jHTPG_SALTY Chaperone protein htpG (Heat shock protein htpG) = 624 3913.2 Best-BlastP =>> nrprot 71% Identities = 194/356 (54%), Positives = 267/356 (75%) refINP_819581.11 rod shape-determination protein Ro dA [Coxiella burnetii RSA 493] gbjAAO90095.11 rod shape-determination RodA protein [Coxiella burnetii RSA 493] Length = 359 3914.3 Best-BlastP =>> nrprot 65% Identities = 286/604 (47%), Positives = 407/604 (67%), Gaps = 2/604 (0%) refINP_819582.1 Penicillin-binding protein 2 [Coxiella burnetii RSA 493] Penicillin-binding protein 2 [Coxiella burnetii RSA 493] gbjAAO90096.11 Length = 612 3916.3 Best-BlastP =>> nrprot 72% Identities = 267/417 (64%), Positive = 331/417 (79%) refINP_253428.1 Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa PA01] pirlIC83052 polyribonucleotide nucleotidyltransferase PA4740 [imported] - Pseudomonas aeruginosa (strain PAO1) [Anopheles gambiae str.] PEST] Length = 309 Best-BlastP =>> nrprot 64% Identities = 60/113 (53%), Positives = 80/113 (70%), Gaps = 3/113 (2%) refINP_840836.1 j Ribosome-binding factor A [Nitrosomonas europaea ATCC 19718] spIQ82WC9jRBFA_NITEU Ribosome-binding factor A embjCAD84673.1 j Ribosome-binding factor A [Nitrosomonas europaea ATCC 19718] Length = 117 Best-BlastP =>> nrprot 63% Identities = 244/604 (40%) , Positives = 394/604 (65%), Gaps = 9/604 (1%) refINP_622330. [Length = 701 PA1] Length = 701 Identities = 56/88 (63%), Positives nucleoside diphosphate sugar epimerases [Thermoanaerobacter tengcongensis] [GbIAAM23934.1 predicted nucleoside diphosphate sugar epimerases] 73%) refjZP_00091229.1 COG0184: Ribosomal protein S15P / S13E Best-BlastP =>> nrprot 70% [Azotobacter vinelandii] Length = 132 Best-BlastP =>> nrprot 61% Identities = 138/299 (46%), Positive = 188/299 (62%), Gaps = 11/299 (3%) refjXP_306459.1 3920.1 3923.2 3924.2 Best-BlastP =>> nrprot 57% Identities = 90/279 (32%), Positives = 162/279 ( 58%), Gaps = 8/279 (2%) refINP_348443.1 Conserved membrane protein, possible 4-hydroxybenzoate octaprenyltranferase [Clostridium acetobutylicum] pirlID97124 conserved membrane protein, probable 4-hydroxybenzoate octaprenyltransferase CAC1818 [imported] - Clostridium acetobutylicum gblAAK79783.1 1AE007691_1 Conserved membrane protein, possible 4-hydroxybenzoate octaprenyltranferase [Clostrate idium acetobutylicum] Length = 290 3925.2 Best-BlastP =>> nrprot No Hits found 3927.2 Best-BlastP =>> nrprot 67% Identities = 228/453 (50%), Positives = 305/453 (67%), Gaps = 34 / 453 (7%) refINP_820835.1 I ABC peptide transporter, permease protein, putative [Coxiella burnetii RSA 493] gbIAAO91349.11 ABC peptide transporter, permease protein, putative [Coxiella burnetii RSA 493] Length = 465 3928.1 Best-BlastP => > nrprot 99% Identities = 593/596 (99%), Positive = 594/596 (99%) emblCAA67994.1 I oxaloacetate decarboxylase alphachain [Legionella pneumophila] Length = 596 3929.2 Best-BlastP =>> nrprot 99% Identities = 542 / 543 (99%), Positive = 542/543 (99%) spIP21347IPROA_LEGPN Zinc metalloproteinase precursor (PEP1) (PRO A) pirla35355 zinc metalloproteinase (EC 3.4.24.-) precursor - Legionella pneumophila gbjAAA25301.1 J zinc metalloprotease precursor ( EC 3.4.24) Length = 543 393.1 Best-BlastP =>> nrprot 67% Identities = 67/107 (62%), Positives = 87/107 (81%) refINP_747247.1 l (di) nucleoside polyphosphate hydrolase, putative [Pseudomonas putida KT2440] spIQ88CN4INUDH_PSEPK Probable (di) nucleoside polyphosphate hydrolase gbIAAN70711.11AE016714_9 (di) nucleoside polyphosphate hydrolase, putative [Pseudomonas putida KT2440] Length = 159 3933.3 Best-BlastP =>> nrprot Nol-beds found 3936.2 Best -BlastP =>> nrprot 31% Identities = 95/227 (41%), Positives = 131/227 (57%), Gaps = 29/227 (12%) spIQ9ZB07JPURQ_LACLC Phosphoribosylformylglycinamidine synthase I (FGAM synthase I) pirlIT51700 phosphoribosylformylglycinamidine synthase ( EC 6.3.5.3) component I [similarity] - Lactococcus lactis gblAAD12625.1 phosphoribosylformylglycinamidine synthetase I [Lactococcus lactis] Length = 226 3937.2 Best-BlastP =>> nrprot 65% Identities = 216/436 (49%), Positives = 286 / 436 (65%), Gaps = 4/436 (0%) regP_00077753.1 COG0151: Phosphoribosylamine-glycine ligase [Methanosarcina barkeri] Length = 433 3938.2 Best-BlastP =>> nrprot 65% Identities = 75/186 (40% ), Positives = 127/186 (68%), Gaps = 4/186 (2%) r Phosphoribosylglycinamide formyltransferase [Methanosarcina mazei Goel] gbIAAM30139.11 Phosphoribosylglycinamide formyltransferase [Methanosarcina mazei Goel] Length = 202 3942.2 Best-BlastP =>> nrprot 76% Identities = 186/311 (59%), Positives = 241/311 (77%) %), Gaps = 2/311 (0%) refId 00065258.1 I COG2025: Electron transfer flavoprotein, alpha subunit [Microbulbifer degradans 2-40] Length = 312 3950.2 Best-BlastP =>> nrprot 46% Identities = 148/462 (32) %), Positives = 248/462 (53%), Gaps = 23/462 (4%) refINP 488265.1 I hypothetical protein [Nostoc sp. PCC 7120] pirIIAB2334 hypothetical protein a1I4225 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB75924.1 ORF_ID: a114225 hypothetical protein [Nostoc sp. PCC 7120] Length = 565 3953.1 Best-BlastP =>> nrprot 74% Identities = 231/395 (58%), Positives = 292/395 (73%), Gaps = 7/395 (1%) refINP_840860.1 Aminotransferases class1 [Nitrosomonas europaea ATCC 19718] EmbyCAD84697.1 I Aminotransferases class-1 [Nitrosomonas europaea ATCC 19718] Length = 397 3956.2 BestBlastP =>> nrprot 50% Identities = 71/224 (31%), Positives = 124/224 (55%) , Gaps = 11/224 (4%) REFINP841085.1 I SURF1 family [Nitrosomonas europaea ATCC 19718] embJCAD84923.1 I SURF1 family [Nitrosomonas europaea ATCC 19718] Length = 239 Best-BlastP =>> nrprot 67% Identities = 28 / 65 (43%), Positive = 46/65 (70%) refINP_518489.1 I PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] ImbicAD13896.1 I PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 69 Best-BlastP =>> nrprot 42% Identities = 76/80 (95%), Positive = 77/80 (96%) gb1AAO61477.1 I unknown [Legionella pneumophila] Length = 80 Best-BlastP =>> nrprot 18% Identities = 60/197 (30%), Positive = 98/197 (49%), Gaps = 18/197 (9%) refINP_660278.21 similar to RIKEN cDNA 1700007B22 [Homo sapiens] gbjAAH24189.21 Similar to RIKEN cDNA 1700007B22 [Homo sapiens] Length = 345 396.4 Best-BlastP =>> nrprot 68% Identities = 152/296 (51%), Positives = 203/296 (68%), Gaps = 2/296 (0%) refINP_798532.1 L-asparaginase I [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC60416.1 l L-asparaginase I [Vibrio parahaemolyticus] Length = 337 3960.2 Best-BlastP =>> nrprot No Nits found 3962.2 Best-BlastP =>> nrprot 57% Identities = 37/110 (33%), Positives = 65/110 (59%), Gaps = 1/110 (0 % refINP_819167.1 J cell division protein FtsL [Coxiella burnetii RSA 493] gblAAO89681.11 cell division protein FtsL [Coxiella burnetii RSA 493] Length = 115 3964.1 Best-BlastP =>> nrprot 72% Identities = 166/311 (53% ), Positives = 224/311 (72%), Gaps = 7/311 (2%) refINP_930870.11 S-adenosyl-methyltransferase MraW [Photorhabdus luminescens subsp. laumondii TTO1] embedded image S-adenosyl-methyltransferase MraW [Photorhabdus luminescens subsp. laumondii TTO1] Length = 314 3965.1 Best-BlastP =>> nrprot 73% Identities = 89/152 (58%), Positives = 113/152 (74%) refINP_819165.11 conserved hypothetical protein TIGR00242 [Coxiella burnetii RSA 493] gbIAAO89679. 1 l conserved hypothetical protein TIGR00242 [Coxiella burnetii RSA 493] Length = 152 3966.1 Best-BlastP =>> nrprot 64% Identities = 116/251 (46%), Positives = 166/251 (66%), Gaps = 4/251 COG1521: Putative transcriptional regulator, homolog of Bvg accessory factor [Clostridium thermocellum ATCC 27405] Length = 255 3967.1 Best-BlastP =>> nrprot 48% Identities = 73/139 (52%), Positives = 91/139 (65%), Gaps = 1/139 (0%) refINP_819361.1 Preserved domain protein [Coxiella burnetii RSA 493] gbIAAO89875.1 Preserved domain protein [Coxiella burnetii RSA 493] Length = 214 Best-BlastP = >> nrprot 39% Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 3/77 (3%) refINP_760035.1 Cytochrome c5 [Vibrio vulnificus CMCP6] gbIAAO09562.11AE016800_167 Cytochrome c5 [Vibrio vulnificus CMCP6] dbjJBAC92805.1 J cytochrome c5 [Vibrio vulnificus YJ016] Length = 150 Best-BlastP =>> nrprot 49% Identities = 69/204 (33%), Positives = 115/204 (56%), Gaps Of the hypothetical protein [Pseudomonas aeruginosa PA01] pirlIC83227 hypothetical protein PA3350 [imported] - Pseudomonas aeruginosa (PAO1 strain) gbIAAG06738.1 JAE004757_7 hypothetical protein PA3350 [Pseudomonas aeruginosa PAO1] Length = 232 3957.1 3958.1 3959.2 3968.1 3969.1 Best-BlastP =>> nrprot 59% Identities = 68/133 (51%), Positives = 100/133 (75%) ReflZP_00043701.1 J COG 1974: SOS-response transcriptional repressors (RecA-mediated autopeptidases) [ Magnetococcus sp. MC-1] Length = 238 Best-BlastP =>> nrprot 37% Identities = 23/57 (40%), Positives = 40/57 (70%) reflZP_00084200.11 COG2747: Negative regulator of flagellin synthesis (anti-sigma28 factor ) [Pseudomonas fluorescens PfO-1] Length = 131 Best-BlastP =>> nrprot 43% Identities = 41/149 (27%), Positives = 72/149 (48%), Gaps = 6/149 (4%) refIZP_00136724 .1 J hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] Length = 156 Best-BlastP =>> nrprot 71% Identities = 139/251 (55%), Positives = 178/251 (70%), Gaps = 5/251 ( 1%) refINP819867.1 13-oxoacyl- (acylcarrier-protein) reductase [Coxiella burnetii RSA 493] AAO90381.11 3-oxoacyl- (acyl-carrier-protein) reductase [Coxiella burnetii RSA 493] Length = 254 3974.2 Best -BlastP =>> nrprot 64% Identities = 76/181 (41%), Positives = 118/181 (65%), Gaps = 1/181 (0%) refINP_252535.11 hypothetical protein [Pseudomonas aeruginosa PA0I] pir! IA83164 hypothetical protein PA3846 [imported] - Pseudomonas aeruginosa (strain PAOI) gbIAAG07233.1 1AE004802_2 hypothe PA3846 [Pseudomonas aeruginosa PAO1] Length = 180 3977.2 Best-BlastP =>> nrprot 23% Identities = 105/397 (26%), Positives = 174/397 (43%), Gaps = 43/397 (10%) ref! ZP_00008208.1! COG0665: Glycine / D-amino acid oxidases (deaminating) [Rhodobacter sphaeroides] Length = 533 3979.2 Best-BlastP =>> nrprot 61% Identities = 270/546 (49%), Positives = 356/546 (65%), Gaps RefDoc, THE reference in scientific document supply [Xylella fastidiosa 9a5c] pirjIG82738 gamma-glutamyltranspeptidase XF0984 [imported] - Xylella fastidiosa (strain 9a5c) gblAAF83794.11AE003936_8 gamma-glutamyltranspeptidase [Xylella fastidiosa 9a5c] Length = 603 398.2 Best-BlastP = 14/546 (2%) refINP_298274.11 gammaglutamyltranspeptidase =>> nrprot 62% Identities = 203/420 (48%), Positives = 267/420 (63%), Gaps = 7/420 (1%) ref! ZP_00043700.11 COG0389: Nucleotidyltransferase / DNA polymerase involved in DNA repair [Magnetococcus sp. MC-1] Length = 421 3980.1 3982.2 Lipoprotein LoIB, putative [Coxiella burnetii RSA 493] gb! AAO91322.1! outer lipoprotein LoIB membrane, putative [Coxiella burnetii RSA 493] Length = 210 3985.1 Best-BlastP =>> nrprot 34% Identities = 40/148 (27%), Positives = 70/148 (47%) gbIAAC01725.1! rifamycin efflux protein [Amycolatopsis mediterranei] Length = 522 3986.1 Best-BlastP =>> nrprot 59% Identities = 155/374 (41%), Positives = 222/374 (59%), Gaps = 11/374 (2%) refINP 485927.1! hypothetical protein [Nostoc sp. PCC 7120] pirIIAI2041 hypothetical protein aII1887 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB73586.1l ORF_ID: a111887- hypothetical protein [Nostoc sp. PCC 7120] Length = 375 3988.3 Best-BlastP =>> nrprot 21% Identities = 60/228 (26%), Positives = 106/228 (46%), Gaps = 16/228 (7%) dbj! BAB84935.1 ! FLJ00180 protein [Homo sapiens] Length = 499 397.2 3970.1 3971.2 3972.2 Best-BlastP =>> nrprot 68% Identities = 90/158 (56%), Positives = 116/158 (73%) ref! ZP_00021201.1 COG0669: Phosphopantethein adenylyltransferase [Ralstonia metallidurans] Length = 161 Best-BlastP =>> nrprot 55% Identities = 62/185 (33%), Positives = 110/185 (59%), Gaps = 4/185 (2%) refINP820808.1! Outer membrane Best-BlastP =>> nrprot 70% Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 3/147 (2%) refINP_457097.1 conserved hypothetical protein [Salmonella enterica subsp . enterica serovar Typhi] refINP 461503.1 l putative Cytosine / adenosine deaminase [Salmonella typhimurium LT2] refINP_804165.1 conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] pirlIAE0827 conserved hypothetical protein STY2814 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gbIAAL21462.1 putative cytosine / adenosine deaminase [Salmonella typhimurium LT2] iccD02770.1 conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gblAA068014.11 conserved hypothetical protein [Salmonella, enterica subsp.

  enterica serovar Typhi Ty2] Length = 183 Best-BlastP =>> nrprot 20% Identities = 79/403 (19%), Positives = 171/403 (42%), Gaps = 54/403 (13%) 6038.11 repeat organellar protein -related [Plasmodium yoelii yoelii] Length = 1441 3991.3 Best-BlastP =>> nrprot 10% Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 4/108 (3%) refIXP_316738 .1 1 ENSANGP00000016119 [Anopheles gambiae] gblEAA11974.11 ENSANGP00000016119 [Anopheles gambiae str. PEST] Length = 602 3993.2 Best-BlastP =>> nrprot No Hits found 3994.5 Best-BlastP =>> nrprot 29% Identities = 41/133 (30%), Positives = 65/133 (48%), Gaps = 27 / 133 (20%) dbjIBAB21508.1 l protein-glutaminase [Chryseobacterium proteolyticum] Length = 320 3995.5 Best-BlastP =>> nrprot 29% Identities = 85/264 (32%), Positives = 125/264 (47%), Gaps RefDoc, THE reference in scientific document supply. -BlastP =>> nrprot42% Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 10/142 (7%) refINP_751974.1 I Putative glutamate dehydrogenase [Escherichia coli CFT073] gbIAAN78518. 1 IAE016755_18 Putative glutamate dehydrogenase [Escherichia coli CFT073] Length = 678 3999.3 Best-BlastP =>> nrprot 99% Identities = 641/644 (99%), Positive = 642/644 (99%) spIO32482IDNAK_LEGPN Chaperone protein dnaK (H eat shock protein 70) (Heat shock 70 kDa protein) (HSP70) dbjlBAA22783.1 dnaK [Legionella pneumophila] Length = 644 4.1 Best-BlastP =>> nrprot 59% Identities = 120/298 (40%), Positives = 181 / 298 (60%), Gaps = 1/298 (0%) refINP_907748.1 I conserved hypothetical protein [Wolinella succinogenes] embJCAE10648.1 J conserved hypothetical protein [Wolinella succinogenes] Length = 332 Best-BlastP =>> nrprot 30% Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 25/177 (14%) refINP_587991.1 J hypothetical structural protein [Schizosaccharomyces pombe] pirIIT41077 hypothetical structural protein -fission yeast (Schizosaccharomyces pombe ) = SP1916A11.04 [Schizosaccharomyces pombe] Length = 1010 Best-BlastP =>> nrprot 45% Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 5/110 ( 4%) refINP_925923.1 J MarR family transcriptional regulatory protein [Gloeobacter violaceus] dbjlBAC90918.11 MarR family transcriptional regulatory protein [Gloeobacter violaceus] Length = 1 43 3989.1 399.2 400.1 4000.2 4002.2 Best-BlastP =>> nrprot 24% Identities = 99/340 (29%), Positives = 154/340 (45%), Gaps = 53/340 (15%) refINP623249.1 j Cell division protein Ftsl / penicillin-binding protein 2 [Thermoanaerobacter tengcongensis] gbIAAM24853.1 j Cell division protein Ftsl / penicillin binding 2 [Thermoanaerobacter tengcongensis] Length = 678 4003.1 Best-BlastP =>> nrprot 50% Identities = 151/498 (30%) , Positives = 248/498 (49%), Gaps = 51/498 (10%) refGP_00112433.1 I COG0488: ATPase components of ABC transporters with duplicated ATPase domains [Nostoc punctiform] Length = 544 4004.2 Best-BlastP =>> nrprot 61% Identities = 244/575 (42%), Positives = 366/575 (63%), Gaps = 8/575 (1%) refINP_359923.1 l multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] pirlIF97735 hypothetical protein abcT3 [imported] - Rickettsia conorii (Malish strain 7) gb! AAL02824.1 j multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] Length = 589 4005.2 Best-BlastP =>> nrprot 76% Identities = 309/502 (61%), Positives = 381/502 (75%), Gaps = 7/502 (1%) gbjAAP40013.11 lysine tRNA synthetase [Citrobacter freundii] Length = 505 4009.1 Best-BlastP =>> nrprot 85% Identities = 254/332 (76%), Positive = 288/332 (86%) refINP_457439.1 I peptide chain release factor 2 (RF-2) [Salmonella enterica subsp. enterica serovar Typhi] refINP806651.11 peptide chain release factor 2 [Salmonella enterica subsp.

  enterica serovar Typhi Ty2] spIP28353IRF2_SALTY Peptide chain release factor 2 (RF-2) pirIIA36480 translation releasing factor RF-2 - Salmonella typhimurium pirjIAG0871 peptide chain release factor 2 (RF-2) [imported] Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gbIAAA72914.1 peptide chain release factor 2 embjCAD02871.11 peptide chain release factor 2 (RF-2) [Salmonella enterica subsp. enterica serovar Typhi] gbjAAO70511.11 peptide chain release factor 2 [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 365 401.2 Best-BlastP =>> nrprot 44% Identities = 128/335 (38%), Positives = 180/335 (53%), Gaps = 12/335 (3%) refJZP_00005503.1 j hypothetical protein [Rhodobacter sphaeroides] Length = 458 4010.1 Best-BlastP =>> nrprot 42% Identities = 26/118 (22%), Positives = 58/118 (49%), Gaps = 13/118 (11%) refINP_903543 .1 j hypothetical protein CV3873 [Chromobacterium violaceum ATCC 12472] gbjAAQ61535.11 hypothetical protein CV3873 [Chromobacterium violaceum ATCC 12472] Length = 117 4012.1 Best-BlastP =>> nrprot 54% Identities = 98/248 (39%), Positive = 150 / 248 (60%), Gaps = 14/248 (5%) refINP_250152.1 Probable chemotaxis protein [Pseudomonas aeruginosa PA0I] refGZP_00139088.1 j COG1360: Flagellar motor protein [Pseudomonas aeruginosa UCBPP-PA14] pirIIT46617 Likely chemotaxis protein PA1461 [ imported] - Pseudomonas aeruginosa (strain PAO1) dbjjBAA33552.1 I ORF2 [Pseudomonas aeruginosa] gbjAAG04850. Probable chemotaxis protein [Pseudomonas aeruginosa PAO1] Length = 296 4013.1 Best-BlastP =>> nrprot 67% Identities = 129/244 (52%), Positives = 175/244 (71%) refINP_746451.1 j flagellar motor protein MotA [ Pseudomonas putida KT2440] gbjAAN69915.1 IAE016630_6 flagellar motor protein MotA [Pseudomonas putida KT2440] Length = 246 4014.1 Best-BlastP =>> nrprot 97% Identities = 231/238 (97%), Positives = 234/238 (98%) embjCAA67397 .1 j signma factor 28 [Legionella pneumophila] Length = 238 4015.1 Best-BlastP =>> nrprot 76% Identities = 119/229 (51%), Positives = 178/229 (77%) gbjAAC62540.21 MotR [Pseudomonas aeruginosa] Length = 275 4016.1 Best-BlastP =>> nrprot 49% Identities = 124/284 (43%), Positives = 187/284 (65%), Gaps = 5/284 (1%) gbfAAF32412.1 flagellar biosynthesis protein FIhF [ Vibrio parahaemolyticus] Length = 503 4017.4 Best-BlastP =>> nrprot 80% Identities = 433/701 (61%), Positives = 560/701 (79%), Gaps = 9/701 (1%) refINP_250143.1 I flagellar biosynthesis protein FIhA [Pseudomonas aeruginosa PA01] reflZP_00139079.1 I COG1298: Flagellar biosynthesis pathway, component FIhA [Pseudomonas aeruginosa UCBPP-PA14] pir1IF83465 flagellar biosynthesis protein FIhA PA1452 [imported] - Pseudomonas aeruginosa (strain PAOI) gbJAAG04841. 1JAE004574_12 flagellar biosynthesis protein FIhA [Pseudomonas aeruginosa PAO1] Length = 707 402.2 Best-BlastP =>> nrprot No Hits found 4020.2 Best-BlastP =>> nrprot 48% Identities = 177/535 (33%), Positives = 277/535 ( 51%), Gaps = 29/535 (5%) refiNP_819244.1 conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO89758.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = Best-BlastP =>> nrprot 41% Identities = 53/162 (32%), Positives = 81/162 (50%), Gaps = 3/162 (1%) refINP_643713.11 conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] spIQ8PH541YY06_XANAC Hypothetical UPF0149 protein XAC3406 gbJAAM38249.1 1 conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 180 Best-BlastP =>> nrprot 69% Identities = 221/433 (51%), Positives = 306/433 (70%), Gaps = 1/433 (0%) reflZP_00092323.1 I COG0006: Xaa Pro-aminopeptidase [Azotobacter vinelandii] Length = 537 Best-BlastP =>> nrprot 56% Identities = 161/389 (41%), Positives = 227/389 (58%), Gaps = 12/389 (3%) refINP_253910. [Pseudomonas aeruginosa PA0I] pirlIG82992 ubiH protein PA5223 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG08608.1JAE004935_5 ubiH protein [Pseudomonas aeruginosa PAO1] Length = 394 Best-BlastP =>> nrprot 59% Identities = 171/394 ( 43%), Positives = 229/394 (58%), Gaps = 9/394 (2%) refINP_716409. 1 j oxidoreductase, FAD-binding, UbiH / Coq6 family [Shewanella oneidensis MR-1] gbJAAN53854.1 jAE015522_9 oxidoreductase, FAD-binding, UbiH / Coq6 family [Shewanella oneidensis MR-1] Length = 407 Best-BlastP =>> nrprot 35% Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 30/123 (24%) refINP_604443.1 I dystonin isoform b; bullous pemphigoid antigen 1; dystonia musculorum [Mus musculus] spIQ91ZU6IBPA1_MOUSE Bullous pemphigoid antigen 1, isoforms 1/2/3/4 (BPA) (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) gbIAAK83384. 11AF396879_1 bullous pemphigoid antigen 1-b Mus musculus Length = 7389 4032.3 Best-BlastP =>> nrprot 76% Identities = 179/322 (55%), Positives = 242/322 (75%), Gaps = 7/322 ( 2%) refIZP_00090005.1 I hypothetical protein [Azotobacter vinelandii] Length = 328 4035.1 Best-BlastP =>> nrprot 55% Identities = 47/121 (38%), Positives = 68/121 (56%), Gaps = 7 / 121 (5%) gb1AAL25256.1 J TraK [Legionella pneumophila] Length = 114 4036.2 Best-BlastP =>> nrprot 50% Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 6 At least 75% Identity = 42/78 (%) = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] ======================================================================================================================================================= 53%), Positive = 60/78 (76%) Predictive transcriptional regulator [Vibrio vulnificus CMCP6] gbjAAO08902.1 jAE016798_62 Predicted transcriptional regulator [Vibrio vulnificus CMCP6] Length = 85 4021.2 4023.2 4025.1 4026.2 4030.1 4039.2 Best-BlastP =>> nrprot 62% Identities = 206/434 (47%), Positives = 273/434 (62%), Gaps = 5/434 (1%) refINP_932051.1 I HipA protein [Photorhabdus luminescens subsp . laumondii TTO1] embyCAE17272.1I HipA protein [Photorhabdus luminescens subsp. laumondii TTO1] Length = 439 4040.1 Best-BlastP =>> nrprot 32% Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%) ref1NP_297921.11 phage- related integrase [Xylella fastidiosa 9a5c] pir! 1E82782 phage-related integrase XF0631 [imported] - Xylella fastidiosa (strain 9a5c) gbJAAF83441.1 IAE003908_9 phage-related integrase [Xylella fastidiosa 9a5c] Length = 413 4041.1 Best-BlastP =>> nrprot No Hits found 4042.1 Best-BlastP =>> nrprot 84% Identities = 169/231 (73%), Positives = 198/231 (85%) reflNP_435396.1 I hypothetical protein [Sinorhizobium meliloti] pirjJF95280 hypothetical protein SMa0280 [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymA gblAAK64808.1 hypothetical protein [Sinorhizobium meliloti] Length = 262 4043.1 Best-BlastP =>> nrprot 65% Identities = 63/126 (50%), Positives = 88/126 (69%), Gaps = 5/126 (3%) refINP_435397.1 putative regulator, MerR family [Sinorhizobium meliloti] likely to be regulator, MerR family [imported] - Sinorhizobi um meliloti (strain 1021) magaplasmid pSymA gblAAK64809.11 putative regulator, MerR family [Sinorhizobium meliloti] Length = 134 4045.2 Best-BlastP =>> nrprot No Hits found 4047.3 Best-BlastP =>> nrprot 57% Identities = 142/327 ( 43%), Positives = 195/327 (59%), Gaps = 7/327 (2%) refINP_819580.11 lytic murein transglycosylase [Coxiella burnetii RSA 493] gblAAO90094.11 lytic murein transglycosylase [Coxiella burnetii RSA 493] Length = 334 4048.3 Best-BlastP =>> nrprot 86% Identities = 443/598 (74%), Positive = 520/598 (86%) reflZP_00090179.1 I COG0481: GTPase Membrane LepA [Azotobacter vinelandii] Length = 599 405.3 Best-BlastP = >> nrprot 11% Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 4/140 (2%) pirJIOXRTGU L-gulonolactone oxidase (EC 1.1.3.8) - rat dbjJBAA02232.1 1 L-gulono-gamma-lactone oxidase [Rattus norvegicus] Length = 440 4050.1 Best-BlastP =>> nrprot 73% Identities = 133/254 (52%), Positives = 184/254 (72%), Gaps = 9 / 254 (3%) refINP_820098.1 I signal peptidase l [Co xiella burnetii RSA 493] gbjAAO90612.1 l signal peptidase l [Coxiella burnetii RSA 493] Length = 259 4051.2 Best-BlastP =>> nrprot 51% Identities = 37/118 (31%), Positives = 67/118 (56%) , Gaps = 6/118 (5%) refJNP_842322.1! possible transmembrane protein [Nitrosomonas europaea ATCC 19718] possible transmembrane protein [Nitrosomonas europaea ATCC 19718] Length = 126 4054.2 Best-BlastP =>> nrprot 68% Identities = 122/222 (54%), Positive = 155/222 (69%), Gaps = 4/222 (1%) refINP_716968.1 ribonuclease III [Shewanella oneidensis MR-1] gbIAAN54413.1JAE015579_2 ribonuclease III [Shewanella oneidensis MR-1] Length = 226 4055.1 Best-BlastP =>> nrprot 67 % Identities = 309/628 (49%), Positives = 418/628 (66%), Gaps = 14/628 (2%) refIZP_00092302.1! COG0488:

* ATPase components of ABC transporters with duplicated ATPase domains [Azotobacter vinelandii] Length = 830 4056.2 Best-BlastP =>> nrprot 75% Identities = 247/407 (60%), Positives = 308/407 (75%) refINP_052356.11 unnamed protein product [Coxiella burnetii] pir11S38238 hypothetical protein - Coxiella burnetii embICAA53126.1 j unnamed protein product [Coxiella burnetii] embyCAA63678.1 orf 410 [Coxiella burnetii] Length = 410 4058.2 Best-BlastP =>> nrprot No Hits found 406.1 Best-BlastP =>> nrprot 51% Identities = 95/241 (39%), Positives = 143/241 (59%), Gaps = 6/241 (2%) refINP_107761.1.I unknown protein [Mesorhizobium loti] dbjlBAB53547.11 unknown protein [Mesorhizobium loti] Length = 273 4060.1 Best-BlastP =>> nrprot 66% Identities = 208/400 (52%), Positives = 273/400 (68%), Gaps = 5/400 (1%) reflNP_747386.1 phosphopantothenoylcysteine decarboxylase / phosphopantothenate - cysteine ligase [Pseudomonas putida KT2440] gblAAN70850.1 1AE016729_8 phosphopantothenoylcysteine decarboxylase / phospophosphate Hopantothenate - cysteine ligase [Pseudomonas putida KT2440] Length = 403 4061.1 Best-BlastP =>> nrprot 79% Identities = 108/147 (73%), Positives = 121/147 (82%) refJZP_00134300.1 j COG0756: dUTPase [ Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 151 4063.1 Best-BlastP =>> nrprot 66% Identities = 229/455 (50%), Positive = 310/455 (68%) refINP_747389.1 j phosphomannomutase [Pseudomonas putida KT2440] spjQ88C93jALGC_PSEPK Phosphomannomutase / phosphoglucomutase (PMM / PGM) gblAAN70853.1 jAE016729_11 phosphomannomutase [Pseudomonas putida KT2440] Length = 463 4065.3 Best-BlastP =>> nrprot 50% Identities = 181/557 (32%), Positives = 290/557 (52%), Gaps = 17 / 557 (3%) refINP_819579.1 TPR domain protein [Coxiella burnetii RSA 493] gbjAAO90093.11 TPR domain protein [Coxiella burnetii RSA 493] Length = 561 4066.2 Best-BlastP =>> nrprot 69% Identities = 102/190 (53 %), Positives = 136/190 (71%), Gaps = 2/190 (1%) refjNP928489.11 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] embyCAE13471.1j unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTOI] Length = 197 4067.2 Best-BlastP =>> nrprot No Hits found 4068.2 Best-BlastP =>> nrprot 56% Identities = 174/381 (45%), Positives = 240/381 (62%), Gaps = 6 / 381 (1%) refINP_296878.1 sodium: dicarboxylate symporter family protein [Chlamydia muridarum] gbjAAF73565.1 1 sodium: dicarboxylate symporter family protein [Chlamydia muridarum] Length = 415 407.4 Best-BlastP =>> nrprot 78% Identities = 295 / 449 (65%), Positives = 356/449 (79%) RefDNA 253299.1 d DNA repair protein RadA [Pseudomonas aeruginosa PA01] splP969631RADA_PSEAE DNA repair protein radA homolog (DNA repair protein sms homolog) pirljA83069 DNA repair protein RadA PA4609 [imported] Pseudomonas aeruginosa (strain PAO1) gbjAAG07997.1 jAE004875_3 DNA repair protein RadA [Pseudomonas aeruginosa PAOI] Length = 453 4070.3 Best-BlastP =>> nrprot 82% Identities = 322/464 (69%), Positives = 387/464 (83%) %) refINP_415450.11 asparagine tRNA synthetase [Escherichia coli K12] refINP_752997.1 j Asparaginyl-tRNA synthetase [Escheric hia coli CFT073] refINP_836636.1 Asparagine tRNA synthetase [Shigella flexneri 2a str. 2457T] spjP17242ISYN_ECOLI Asparaginyl-tRNA synthetase (Asparagine-tRNA ligase) (AsnRS) pirjjSYECNT asparagine-tRNA ligase (EC 6.1.1.22) - Escherichia coli (strain K-12) embICAA48274.1 j Asparaginyl-tRNA synthetase [Escherichia coli] gbjAAA24666 Asparaginyl-tRNA synthetase (asnS) dbjjBAA35682.1 Asparaginyl-tRNA synthetase (EC 6.1.1.22) (asparagine-tRNA ligase) (asnRS). [Escherichia coli K12] gbjAAC74016.1 j asparagine tRNA synthetase [Escherichia coli K12] gbjAAN79540. 11AE016758_144 Asparaginyl-tRNA synthetase [Escherichia coli CFT073] gbjAAP16442.11 asparagine tRNA synthetase [Shigella flexneri 2a str. 2457T] Length = 466 4071.1 Best-BlastP =>> nrprot No Hits found 4072.1 Best-BlastP =>> nrprot 98% Identities = 215/218 (98%), Positives = 216/218 (99%) gbjAAC32842.1 j unknown [Legionella pneumophila] Length = 218 4073.1 Best-BlastP =>> nrprot 99% Identities = 355/357 (99%), Positives = 356/357 (99%) gb! AAC32841.1! unknown [Legionella pneumophila] Length = 357 4075.3 Best-BlastP =>> nrprot 58% Identities = 69/160 (43%), Positives = 93/160 (58%), Gaps = 4/160 (2%) refJZP_00051893.1 COG3012: Uncharacterized protein stored in bacteria Magnetospirillum magnetotacticum Length = 163 4076.1 Best-BlastP =>> nrprot No Hits found 4078.1 Best-BlastP =>> nrprot 70% Identities = 227/395 (57%), Positive = 303 / 395 (76%), Gaps = 1/395 (0%) ref! ZP_00031357.1 I COG0038: Chloride channel protein EriC [Burkholderia fungorum] Length = 443 408.3 Best-BlastP =>> nrprot 47% Identities = 152/478 ( 31%), Positives = 258/478 (53%), Gaps = 28/478 (5%) refINP_820790.1! outer membrane efflux family protein [Coxiella burnetii RSA 493] gblAAO91304.1 J outer efflux membrane family protein [Coxiella burnetii RSA 493] Length = 507 4080.2 Best-BlastP =>> nrprot 89% Identities = 377/385 (97%), Positive = 381/385 (98%) gbIAAD47247.1 1 putative transport protein [Legionella pneumophila] Length = 387 4082.2 Best-BlastP =>> nrprot 34% Identities = 78/288 (27%), Positive = 138/288 (47% ), Gaps = 2/288 (0%) refINP_931673.1! hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] emblCAE16879.1I unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 833 4083.3 Best-BlastP =>> nrprot No Hits found 4084.2 Best-BlastP =>> nrprot 55% Identities = 143/383 (37%), Positives = 217/383 (56%), Gaps = 1 / 383 (0%) ref! ZP_00058706.11 COG0438: Glycosyltransferase [Thermobifida fusca] Length = 426 4087.2 Best-BlastP =>> nrprot 61% Identities = 175/436 (40%), Positives = 262/436 (60%) , Gaps = 25/436 (5%) refINP_845547.1! conserved hypothetical protein [Bacillus anthracis str. [Bacillus anthracis str. Ames] Length = 445 4088.2 Best-BlastP =>> nrprot 75% Identities = 182/288 (63%), Positives = 224/288 (77%) gbIAAM00632.1 I unknown [Legionella pneumophila] Length = 294 409.2 Best-BlastP =>> nrprot 56% Identities = 123/352 (34%), Positives = 210/352 (59%), Gaps = 8/352 (2%) refINP820789.1! lipoprotein, putative [Coxiella burnetii RSA 493] gblAAO91303.11 lipoprotein, putative [Coxiella burnetii RSA 493] Length = 391 4093.1 Best-BlastP =>> nrprot 72% Identities = 255/481 (53%), Positives = 346/481 ( 71%), Gaps = 9/481 (1%) refINP_820458.1! glutamyl-tRNA (Gln) amidotransferase, B subunit [Coxiella burnetii RSA 493] gbjAAO90972.1 glutamyl-tRNA (GIn) amidotransferase, B subunit [Coxiella burnetii RSA 493] Length = 477 4094.2 Best-BlastP =>> nrprot 75% Identities = 284/480 (59%), Positives = 366/480 (76%), Gaps = 1/480 (0%) refINP_820457.11 glutamyl-tRNA (Gln) amidotransferase, A subunit [Coxiella burnetii RSA 493] gblAAO90971.1 Glutamyl-tRNA (GIn) amidotransferase, A subunit [Coxiella burnetii RSA 493] Length = 483 4096.1 4097.1 4098.1 410.1 4101.1 4104.1 4105.1 4106.1 4107.1 4108.1 4109.2 Best-BlastP =>> nrprot 70% Identities = 86/155 (55%), Positive = 113/155 (72%) refINP_841624.11 Transposase IS4 family [Nitrosomonas europaea ATCC 19718] refInP_841817.1 J Transposase IS4 family [Nitrosomonas europaea ATCC 19718] refInP_842206.1 I Transposase IS4 family [Nitrosomonas europaea ATCC 19718] refINP_842438.1 l Transposase IS4 family [Nitrosomonas europaea ATCC 19718] emblCAD85496.1 I Transposase IS4 family [Nitrosomonas europae ATCC 19718] embjCAD86113. 11 IS4 family Transposase [Nitrosomonas europaea ATCC 19718] emblCAD85700. Transposase IS4 family [Nitrosomonas europaea ATCC 19718] 34 (91%) reflZP_00111545.1! COG4644: Transposase and inactivated derivatives, TnpA family [Nostoc punctiform] Length = 1014 Best-BlastP =>> nrprot 62% Identities = 33/89 (37%), Positives = 57/89 (64%) gbIAAO92366.1 I transposase [ Listonella anguillarum] Length = 980 Best-BlastP =>> nrprot 70% Identities = 125/226 (55%), Positive = 166/226 (73%) refINP_721272.1 putative ABC carry, ATP-binding protein [Streptococcus mutans UA159] gbAAN58578.1 JAE014927_7 putative ABC carry, ATP-binding protein [Streptococcus mutans UA159] Length = 235 Best-BlastP =>> nrprot 50% Identities = 22/49 (44%), Positive = 34/49 (69%) refINP 277100.1 The putative transposase [Deinococcus radiodurans] Length = 828 Best-BlastP =>> nrprot 44% Identities = 121/430 (28%), Positives = 195/430 (45%), Gaps = 67/430 (15%) refINP_873428. 1 j conserved hypothetical protein [Haemophilus ducreyi 35000HP] gblAAP95817. 1 j conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 481 Best-BlastP =>> nrprot 48% Identities = 74/241 (30%), Positives = 126/241 (52%), Gaps = 19/241 (7% ) reflZ_00132729.1! hypothetical protein [Haemophilus somnus 2336] Length = 270 Best-BlastP =>> nrprot 39% Identities = 47/197 (23%), Positives = 88/197 (44%), Gaps = 18/197 (9%) refJZP_00123126. 1 j hypothetical protein [Haemophilus somnus 129PT] Length = 212 Best-BlastP =>> nrprot No Nits found Best-BlastP =>> nrprot 34% Identities = 61/215 (28%), Positives = 97/215 (45%) , Gaps = 29/215 (13%) refINP_928397.1 hypothetical protein [Photorhabdus luminescens subsp. Iaumondii TTO1] emblCAE13363.1j unnamed protein product [Photorhabdus luminescens subsp.

  Iaumondii TTO1] Length = 245 ((AL356172) conserved hypothetical protein [Neurospora crassa]) embICAD11783.1! conserved hypothetical protein [Neurospora crassa] gbjEAA28302.11 hypothetical protein (AL356172) conserved hypothetical protein [Neurospora crassa] Length = 743 Best-BlastP =>> nrprot 97% Identities = 350/359 (97%), Positive = 350 / 359 (97%), Gaps = 8/359 (2%) embyCAB65206.1 I RmIB protein [Legionella pneumophila] Length = 351 Best-BlastP =>> nrprot 99% Identities = 294/294 (100%), Positives = 294 / 294 (100%) EmbJCAB65207. 1 d RmID protein [Legionella Best-BlastP =>> nrprot 34% Identities = 36/145 (24%), Positives = 67/145 (46%), Gaps = 16/145 (11%) refIXP_323218. 1 J hypothetical protein 4111.2 4112.1 pneumophila] Length = 294 Best-BlastP =>> nrprot 94% Identities = 172/188 (91%), Positives = 177/188 (94%), Gaps = 1/188 (0%) embICAB65208 .1 l RmIC protein [Legionella pneumophila] Length = 188 Best-BlastP =>> nrprot 97% Identities = 331/334 (99%), Positive = 332/334 (99%) emblCAB65212.1 1 N-acetylneuraminic acid condensing enzyme [Legionella pneumophila] Length = 338 Best-BlastP =>> nrprot 99% Identities = 232/232 (100%), Positive = 232/232 (100%) embjCAB65213.11 CMP-N-acetlyneuraminic acid synthetase [Legionella pneumophila] Length = 232 Best-BlastP =>> nrprot 99% Identities = 213/213 (100%), Positives = 213/213 (100%) spIQ9RDX3IHIS5_LEGPN Imidazole glycerol phosphate synthase subunit hisH (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) embICAB65214.1 glutamine amidotransferase [Legionella pneumophila] Length = 213 Best-BlastP =>> nrprot 82% Identities = 207/210 (98% ), Positives = 210/210 (100%) spIQ9RDX2IHIS6_LEGPN Imidazole glycerol phosphate synthase subunit hisF (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) embICAB65215.1 HisF protein [Legionella pneumophila] Length = 212 412.3 Best-BlastP =>> nrprot 66% Identities = 189/397 (47%), Positive = 263/397 (66%) refINP_820787.1 ABC carry, permease protein [Coxiella burnetii RSA 493] gbIAAO91301.11 ABC transport, permease protein [Coxiella burnetii RSA 493] Length = 404 4123.2 Best-BlastP =>> nrprot 63% Identities = 39/74 (52%), Positives = 54/74 (72%), Gaps = 1/74 (1 %) gblAAM08234.1 putative phage repressor [Legionella pneumophila] Length = 227 4126.2 Best-BlastP =>> nrprot 54% Identities = 118/267 (44%), Positives = 164/267 (61%), Gaps = 2/267 (0%) gbIAAM08235.1 1 LvrA [Legionella pneumophila] Length = 289 4127.1 Best-BlastP =>> nrprot 51% Identities = 47/155 (30%), Positives = 77/155 (49%), Gaps = 20 / 155 (12%) gbJAAM08236.1 J LvrB [Legionella pneumophila] Length 150 4128.1 Best-BlastP =>> nrprot 61% Identities = 25/62 (40%), Positives = 45/62 (72%), Gaps = 2/62 (3%) EmbICAB60050.1 I IvrC [Legionella pneumophila] Length = 67 4129.1 Best-BlastP =>> nrprot 40% Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 4/114 (3%) gbIAAL05416.1 I PiIL [Yersinia pseudotuberculosis] Length = 356 413.5 Best-BlastP =>> nrprot 23% Identities = 104/399 (26%), Positives = 187/399 (46%), Gaps = 28/399 (7%) refINP_486788.1 I hypothetical protein [Nostoc sp. PCC 7120] pirlIAE2149 hypothetical protein a1I2748 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB74447.1 ORF_ID: aI12748 hypothetical protein [Nostoc sp. PCC 7120] Length = 426 4130.2 Best-BlastP =>> nrprot 45% Identities = 33/104 (31%), Positives = 60/104 (57%), Gaps = 6/104 (5%) refINP_819572.11 SMC family SMC protein [Coxiella burnetii RSA 493] protein SLC protein [Coxiella burnetii] gbIAAO90086.1 SMC family protein [Coxiella burnetii RSA 493] Length = 1169 4131.3 Best-BlastP =>> nrprot 31% Identities = 60/185 (32 %), Positives = 87/185 (47%), Gaps = 8/185 (4%) gblAAN62293.1 IAF440524_80 hypothetical protein [Pseudomonas aeruginosa] Length = 241 4132.3 Best-BlastP =>> nrprot 45% Identities = 42/99 (42%), Positives = 58/99 (58%), Gaps = 2/99 (2%) refjZP_00123136.11 hypothetical protein [Haemophilus somnus 129PT] Length = 170 4113.1 4115.1 4116.3 4118.3 4119.2 4133.1 4134.1 4135.1 4136.1 4138.1 4139.1 4140.1 4141.1 4142.3 Best-BlastP =>> nrprot 75% Identities = 39/61 (63%), Positive = 49/61 (80%) refINP_403868.1 J 50S ribosomal protein L29 [Yersinia pestis] refINP_671291.1J 50S ribosomal subunit protein L29 [ Yersinia pestis KIM] spI 50S ribosomal protein L29 pirJIAB0027 50S ribosomal protein L29 [imported] - Yersinia pestis (strain CO92) 50C ribosomal protein L29 [Yersinia pestis CO92] gbJAAM87542.1 JAE014002_15 50S ribosomal protein L29 [Yersinia pestis KIM] Length = 63 Best-BlastP =>> nrprot 77% Identities = 54/79 (68%), Positives = 66/79 (83%) refJZP_00090912.1 J COG0186: Ribosomal protein S17 [Azotobacter vinelandii] Length = 90 Best-BlastP =>> nrprot 90% Identities = 100/122 (81%), Positives = 110/122 (90%), Gaps = 1/122 (0%) refJZP 00067983.1 J COG0093: Ribosomal protein L14 [Microbulbifer degradans 2-40] Length = 122 Best-BlastP =>> nrprot 70% Identities = 58/106 (54%), Positives = 77/106 (72%), Gaps = 1/106 (0%) refINP_273211.1 D 50S ribosomal protein L24 [Neisseria meningitidis MC58 ] refINP_282968.1 J 50S ribosomal protein L24 [Neisseria meningitidis Z2491] pirIIC81232 50S ribosomal protein L24 NMB0153 [imported] - Neisseria meningitidis (strain MC58 serogroup B, st Z2491 serogroup A) gbJAAF40611.11 50S ribosomal protein L24 [Neisseria meningitidis MC58] embJCAB83433.1J 50S ribosomal protein L24 [Neisseria meningitidis Z2491] Length = 107 Best-BlastP =>> nrprot 83% Identities = 128/178 (71%) , Positive = 153/178 (85%) refINP 273212.1 J 50S ribosomal protein L5 [Neisseria meningitidis MC58] pirlID81232 50S ribosomal protein L5 NMB0154 [imported] - Neisseria meningitidis (strain MC58 serogroup B) gbJAAF40612.1 50S ribosomal protein L5 [Neisseria meningitidis MC58] Length = 179 Best-BlastP =>> nrprot 65% Identities = 49/101 (48%), Positives = 66/101 (65%), Gaps = 1/101 (0%) refJZP_00004335.1 COG0199: Ribosomal protein S14 [Rhodobacter sphaeroides] Length = 101 Best-BlastP =>> nrprot 78% Identities = 79/133 (59%), Positives = 103/133 (77%), Gaps = 5/133 (3%) refINP_273214.1 J 30S ribosomal protein S8 [Neisseria meningitidis MC58] refINP_282965.1J 30S ribosomal protein S8 [Neisseria meningitidis Z2491] spJQ9JR58IRS8_NEIMA 30S ribosomal protein S8 pi rlIF81232 30S ribosomal protein S8 NMB0156 [imported] - Neisseria meningitidis (strain MC58 serogroup B, strain Z2491 serogroup A) gbJAAF40614.1 J 30S ribosomal protein S8 [Neisseria meningitidis MC58] embJCAB83430.1 30S ribosomal protein S8 [Neisseria meningitidis Z2491] Length = 130 subunit protein L6 [Escherichia coli O157: H7 EDL933] refINP312197.1 J 50S ribosomal subunit protein L6 [Escherichia coli O157: H7] refJNP_417764.1 J 50S ribosomal subunit protein L6 [Escherichia coii K12] refINP_709093.1 J 50S ribosomal subunit protein L6 [Shigella flexneri 2a str. 301] refINP_755932.1 J 50S ribosomal protein L6 [Escherichia coli CFT073] refINP_839565.1 J 50S ribosomal subunit protein L6 [Shigella flexneri 2a str. 2457T] spIP02390JRL6_ECOLI 50S ribosomal protein L6 pirlIR5EC6 ribosomal protein L6 [validated] - Escherichia coli (strain K-12) pirlIB91150 50S ribosomal subunit protein L6 [imported] Escherichia coli (strain O157: H7, substrate RIMD 0509952) pir1IF85995 50S ribosomal subunit protein L6 [imported] - Escherichia coli (strain O157: H7, substrain EDL933) gbJAAA58102.1J 50S ribosomal subunit protein L6 [Escherichia coii] gbJAAC76330.1 J 50S ribosomal subunit protein L6 [Escherichia coii K12] gbIAAG58426.1 JAE005556_19 50S ribosomal subunit protein L6 [Escherichia coli O157: H7 EDL933] dbjIBAB37593.1 50S ribosomal subunit Best-BlastP =>> nrprot 71% Identities = 65/117 (55%), Positive = 86/117 (73%), Gaps = 4/117 ( 3%) refINP_252937.1 J 50S ribosomal protein L18 [Pseudomonas aeruginosa PA01] regP_00137735.1J COG0256: Ribosomal protein L18 [Pseudomonas aeruginosa UCBPP-PA14] pirJIE83114 50S ribosomal protein L18 PA4247 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG07635.1 JAE004841_13 50S ribosomal protein L18 [Pseudomonas aeruginosa PAO1] Length = 116 Best-BlastP =>> nrprot 75% Identities = 105/158 (66%), Positives = 127/158 (80%) refZNP_00067978.1 J COG0098: Ribosomal protein S5 [ Microbulbifer degradans 2-40] Length = 170 Best-BlastP =>> nrprot 66% Identities = 31/56 (55%), Positive = 41/56 (73%) refINP_563303.1 J 50S ribosomal protein L30 [Clostridium perfringens] dbjjBAB82093 .1 50S ribosomal protein L30 [Clostridium perfringens str. 13] Length = 57 Best-BlastP =>> nrprot 76% Identities = 92/144 (63%), Positives = 111/144 (77%) refJZP_00067977.1 j COG0200: Ribosomal protein L15 [Microbulbifer degradans 2-40] Length = 144 Best-BlastP =>> nrprot 81% Identities = 293/437 (67%), Positives = 364/437 (83%) refINP_819302.1 J preprotein transiocase, SecY subunit [Coxiella burnetii RSA 493] gbJAAO89816.1 J preprotein transiocase, SecY subunit [Coxiella burnetii RSA 493] Length = 442 Best-BlastP =>> nrprot 81% Identities = 83/114 (72%), Positives = 97/114 (85%) refJZP 00125957.1 J COG0099: Ribosomal protein S13 [ Pseudomonas syringae pv. syringae B728a] refINP_790495.1 ribosomal protein S13 [Pseudomonas syringae pv. tomato str. DC3000] spJQ889U9JRS13_PSESM 30S ribosomal protein S13 gbJAAO54190.1 Ribosomal protein S13 [Pseudomonas syringae pv. tomato str.

  DC3000] Length = 118 Best-BlastP =>> nrprot 57% Identities = 176/280 (62%), Positives = 213/280 (76%), Gaps = 2/280 (0%) refINP_838055.1 j putative transposase [ Shigella flexneri 2a str. 2457T] gbJAAK64580.1 J putative transposase [Vibrio cholerae] dbjJBAB79611.1 J orf6 [Salmonella enterica subsp. enterica serovar Choleraesuis] gbjAAL59686.1 J putative transposase [Vibrio cholerae] gbJAAP17865.1 putative transposase [Shigella flexneri 2a str. 2457T] dbjjBAC79056.1 j putative transposase [Vibrio cholerae] Length = 497 Best-BlastP =>> nrprot 80% Identities = 91/130 (70%), Positives = 107/130 (82%) refINP_660814.1 J 30S ribosomal protein S11 [Buchnera aphidicola str. Sg (Schizaphis graminum)] spIQ8K972IRS11_BUCAP 30S ribosomal protein S11 gbJAAM68025.11 30S ribosomal protein S11 [Buchnera aphidicola str. Sg (Schizaphis graminum)] Length = 130 Best-BlastP =>> nrprot 81% Identities = 139/206 (67%), Positives = 169/206 (82%) refINP_289857.1 J 30S ribosomal subunit protein S4 [Escherichia coli O157 : 30C ribosomal subunit protein S4 [Escherichia coli O157: H7] refINP_417755.1 J 30S ribosomal subunit protein S4 [Escherichia coli K12] refINP_755921.1 J 30S ribosomal protein S4 [Escherichia coli CFT073] spIP02354JRS4_ECOLI 30S ribosomal: H7 EDL933] refINP_312188.1 protein S4 pirJIR3EC4 ribosomal protein S4 [validated] - Escherichia coli (strain K-12) pirJIA91149 30S ribosomal subunit protein S4 [imported] Escherichia coli (strain O157: H7, substrate RIMD 0509952) pirjJE85994 30S ribosomal subunit protein S4 [imported] - Escherichia coli (strain O157: H7, substrain EDL933) [subtype protein product [Escherichia coli] gbJAAA58094.1 30S ribosomal subunit protein S4 [Escherichia coli] gblAAC76321.11 30S ribosomal subunit protein S4 [Escherichia coli K12] gbJAAG58417.1 JAE005556_10 30S ribo somal subunit protein S4 [Escherichia coli O157: H7 EDL933] dbjJBAB37584.1 30S ribosomal subunit protein S4 [Escherichia coli O157: H7] gbJAAN82495.1JAE016767_255 30S ribosomal protein S4 [Escherichia coli CFTO 4154.2 Best-BlastP =>> nrprot 79% Identities = 216/328 (65%), Positives = 264/328 (80%), Gaps = 3/328 (0%) gbJAAM33636.1 JAF506984_1 RpoA [Pseudomonas putida] Length = 333 4156.3 Best-BlastP =>> nrprot 99% Identities = 283/283 (100%), Positives = 283/283 (100%) EmbJCAB65193.1 J Wm protein [Legionella pneumophila] Length = 283 4157.2 Best-BlastP =>> nrprot 99% Identities = 473/474 (99%) , Positives = 473/474 (99%) EmbJCAB65192.1 [Legionella pneumophila] Length = 474 4143.3 4144.3 4145.3 4148.3 4149.1 415.2 4151.1 4153.1 Best-BlastP =>> nrprot 98% Identities = 379/382 (99%), Positive = 379/382 (99%) embJCAB65191.11 hypothetical protein [Legionella pneumophila] Length = 382 Best-BlastP =>> nrprot 91% Identities = 273/279 (97%), Positives = 275/279 (98%) embICAB65190 .1 j put ative glycosyl transferase [Legionella pneumophila] Length = 297 Best-BlastP =>> nrprot 97% Identities = 281/282 (99%), Positive = 281/282 (99%) putative embjCAD43478.1 glycosyltransferase [Legionella pneumophila] Length = 297 Best-BlastP =>> nrprot 99% Identities = 336/339 (99%), Positive = 338/339 (99%) embjCAB65189.11 putative glycosyl transferase [Legionella pneumophila] Length = 339 Best-BlastP =>> nrprot 37% Identities = 188/579 (32%), Positive = 316/579 (54%), Gaps = 35/579 (6%) refINP 834965.1 j Sensory box / GGDEF family protein [Bacillus cereus ATCC 14579] gbjAAP12166.1 j Sensory box / GGDEF family protein [Bacillus cereus ATCC 14579] Length = 909 Best-BlastP =>> nrprot 57% Identities = 138/138 (100%), Positives = 138/138 (100%) gbIAAD41585.1 jAF057704_1 EnhA [Legionella pneumophila] Length = 164 Best-BlastP =>> nrprot 68% Identities = 127/133 (95%), Positives = 130/133 (97%) gbjAAD41586. 11AF057704_2 EnhB [Legionella pneumophila] Length = 142 Best-BlastP =>> nrprot 99% Identities = 1193/1201 (99%), Positives = 1198/1201 (99%), Gaps = 1/1201 (0%) gbjAAD41587.1 jAF057704_3 enhanced entry protein EnhC [Legionella pneumophila] Length = 1201 Best-BlastP =>> nrprot No Nits found Best-BlastP =>> nrprot 30% Identities = 45/190 (23%), Positives = 83/190 (43%) , Gaps = 2/190 (1%) refJZP_00091084.1 j COG0582: Integrase [Azotobacter vinelandii] Length = 287 Best-BlastP =>> nrprot 6% Identities = 36/117 (30%), Positives = 57/117 (48%) %), Gaps = 10/117 (8%) refINP_701057.1 j hypothetical protein [Plasmodium falciparum 3D7] gbjAAN35781.1 jAE014838_59 hypothetical protein [Plasmodium falciparum 3D7] Length = 371 4171.4 Best-BlastP =>> nrprot 52% Identities = 69 / 147 (46%), Positives = 93/147 (63%), Gaps = 1/147 (0%) refJZP_00080184.1 COG1881: Phospholipid-binding protein [Geobacter metallireducens] Length = 176 4172.2 Best-BlastP =>> nrprot 11% Identities = 22/63 (34%), Positives = 39/63 (61%) %), Gaps = 1/63 (1%) gbjEAA24489.1 hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 265 4173.2 Best-BlastP =>> nrprot 62% Identities = 68/129 (52%), Positives = 84/129 (65%), Gaps = 4/129 (3%) refINP_230027.1 j [Vibrio cholerae] pirlIA82330 conserved hypothetical protein VCO373 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbjAAF93546.1 Preserved hypothetical protein [Vibrio cholerae] Length = 139 4174.1 Best-BlastP =>> nrprot 66% Identities = 57/143 (39%), Positives = 93/143 (65%), Gaps = 7/143 (4%) gb1AAC44222.1 hemin binding protein Hbp [Legionella pneumophila] Length = 141 4175.1 Best-BlastP =>> nrprot 54 % Identities = 115/302 (38%), Positives = 169/302 (55%), Gaps = 11/302 (3%) refjZP_00086085.1 j hypothetical protein [Pseudomonas fluorescens PfO-1] Length = 300 4177.2 Best-BlastP =>> nrprot 13% Identities = 48/172 (27%), Positives = 70/172 (40%), Gaps = 25/172 (14%) dbjIBAC27865.1 Product Description [Mus musculus] Length = 531 4158.1 4159.1 4160.3 4161.3 4162.2 4164.1 4165.1 4167.4 41 68.2 417.3 4170.1 4179.2 Best-BlastP =>> nrprot 27% Identities = 86/423 (20%), Positives = 183/423 (43%), Gaps = 69/423 (16%) gbIEAA18183.1 I hypothetical protein [Plasmodium yoelii yoelii] Length = 1154 418.4 Best-BlastP =>> nrprot 69% Identities = 119/215 (55%), Positives = 156/215 (72%), Gaps = 3/215 (1%) refINP_286845.1 I putative carrier / transport protein [Escherichia coli O157: H7 EDL933] refINP_309081. 11 putative carrier / transport protein [Escherichia coli O157: H7] pirlID85624 probable carrier / transport protein yccA [imported] Escherichia coli (strain O157: H7, substrain EDL933) pirlIF90760 probable carrier / transport protein ECs1054 [imported] - Escherichia coli (strain O157 : H7, substrain RIMD 0509952) gbjAAG55456.11AE005287_3 putative carrier / transport protein [Escherichia coli O157: H7 EDL933] dbjlBAB34477. II putative carrier / transport protein [Escherichia coli O157: H7] Length = 219 4181.1 Best-BlastP =>> nrprot No Hits found 4184.1 Best-BlastP =>> nrprot 53% Identities = 34/97 (35%), Positive = 56 / 97 (57%) refINP_820123.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90637.1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 106 4186.1 Best-BlastP =>> nrprot 70% Identities = 155/310 ( 50%), Positive = 210/310 (67%), Gaps = 16/310 (5%) refINP_841212.1 I DnaJ N-terminal domain: DnaJ C terminal domain [Nitrosomonas europaea ATCC 19718] emblCAD85066.1 I DnaJ N- terminal domain: DnaJ C terminal domain [Nitrosomonas europaea ATCC 19718] Length = 314 4188.1 Best-BlastP =>> nrprot 65% Identities = 171/397 (43%), Positives = 244/397 (61%), Gaps = 36 / 397 (9%) refjZP_00016589.1 J hypothetical protein [Rhodospirillum rubrum] Length = 402 419.2 Best-BlastP =>> nrprot 67% Identities = 136/265 (51%), Positives = 182/265 (68%), Gaps = 4/265 (1%) refINP_253165.1 I retain ed hypothetical protein [Pseudomonas aeruginosa PA01] pirIIE83086 conserved hypothetical protein PA4475 [imported] - Pseudomonas aeruginosa (strain PAOI) gblAAG07863.1 JAE004861 4 conserved hypothetical protein [Pseudomonas aeruginosa PAOI] Length = 282 4191.1 Best-BlastP =>> nrprot 71% Identities = 258/457 (56%), Positives = 333/457 (72%), Gaps = 3/457 (0%) refIz_00009339.1 I hypothetical protein [Rhodopseudomonas palustris] Length = 471 4192.2 Best-BlastP =>> nrprot 66 % Identities = 305/605 (50%), Positives = 398/605 (65%), Gaps = 21/605 (3%) refIZP_00029131.11 hypothetical protein [Burkholderia fungorum] Length = 642 4194.3 Best-BlastP =>> nrprot 99% Identities = 428/429 (99%), Positives = 428/429 (99%) gblAAM00638.1 j [Legionella pneumophila] Length = 429 4195.3 Best-BlastP =>> nrprot 46% Identities = 100/388 (25%) %), Positives = 180/388 (46%), Gaps = 7/388 (1%) refINP_820942.1 drug resistance, Bcr / CfIA family [Coxiella burnetii RSA 493] gbjAAO91456.1 drug resistan this transport, Bcr / CfIA family [Coxiella burnetii RSA 493] Length = 409 4197.2 Best-BlastP =>> nrprot 91% Identities = 725/730 (99%), Positives = 727/730 (99%) gbjAAK35045.2jAF330136_1 type II protein secretion LspD [Legionella pneumophila] Length = 730 42.1 Best-BlastP =>> nrprot 98% Identities = 243/250 (97%), Positive = 247/250 (98%) gbjAAM08246.1 I probable conjugal transfer protein [Legionella pneumophila ] Length = 250 4200.2 Best-BlastP =>> nrprot No Hits found 4203.2 Best-BlastP =>> nrprot 47% Identities = 121/412 (29%), Positives = 202/412 (49%), Gaps = 29/412 (7%) refJZP_00034486.1 COG0642: Signal transduction histidine kinase [Burkholderia fungorum] Length = 479 Best-BlastP =>> nrprot 33% Identities = 156/825 (18%), Positives = 318/825 (38%), Gaps = 118/825 (14%) gbIEAA20682.1 I rhoptry protein [Plasmodium yoelii yoelii] Length = 2719 Best-BlastP =>> nrprot 42% Identities = 72/314 (22%), Positives = 139/314 (44%) , Gaps = 28/314 (8%) gblAAB03184.11 TnpA [Pseudomonas putida] Leng th = 584 Best-BlastP =>> nrprot 78% Identities = 307/479 (64%), Positives = 377/479 (78%), Gaps = 4/479 (0%) refINP_520780. 1 I PROBABLE TLDD PROTEIN [Ralstonia solanacearum] ebICAD16366.11 PROBABLE TLDD PROTEIN [Ralstonia solanacearum] Length = 486 Best-BlastP =>> nrprot 61% Identities = 182/449 (40%), Positives = 276/449 (61%) , Gaps = 11/449 (2%) refjZP_00056132.1 J COG1355: Predicted dioxygenase [Magnetospirillum magnetotacticum] Length = 468 Best-BlastP =>> nrprot 72% Identities = 229/348 (65%), Positives = 263/348 ( 75%) refINP_217654.1 I pflA [Mycobacterium tuberculosis H37Rv] refINP_337751.11 pyruvate formate lyase-activating enzyme, putative [Mycobacterium tuberculosis CDC1551] pirlIC70646 probable pflA protein Mycobacterium tuberculosis (strain H37RV) embICAB06292.1 I pflA [Mycobacterium tuberculosis H37Rv] gbIAAK47565 .11 pyruvate formate lyase-activating enzyme, putative [Mycobacterium tuberculosis CDC1551] Length = 362 Best-BlastP =>> nrprot 54% Identities = 176/517 (34%), Positives = 286/517 (55%), Gaps = 21 / 517 (4%) refINP_790671.1 PIIS sensor protein [Pseudomonas syringae pv. tomato str. DC3000] gbJAAO54366.1I PIIS sensor protein [Pseudomonas syringae pv. tomato str. DC3000] Length = 531 Best-BlastP =>> nrprot 63% Identities = 127/295 (43%), Positives = 187/295 (63%), Gaps = 14/295 (4%) refINP 460713.11 putative phosphoesterase [Salmonella typhimurium LT2] gblAAL20672.1 putative phosphoesterase [Salmonella typhimurium LT2] Length = 301 Best-BlastP =>> nrprot 69% Identities = 49/91 (53%), Positive = 68/91 (74%) gblAAP83334.11AF469614_2 unknown [Francisella tularensis subsp. tularensis] Length = 94 Best-BlastP =>> nrprot 58% Identities = 38/86 (44%), Positives = 54/86 (62%) dbjIBAC94314.1 I acylphosphatase [Vibrio vulnificus YJ016] Length = 90 Best-BlastP = >> nrprot 45% Identities = 33/83 (39%), Positives = 48/83 (57%) gbIEAA16908. 1 day Drosophila melanogaster CG8797 product-related gene [Plasmodium yoelii yoelii] Length = 2198 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 82% Identities = 578/861 (67%), Positives = 714 / 861 (82%), Gaps = 5/861 (0%) gblAAB95117.1 DNA gyrase [Serratia marcescens] Length = 880 Best-BlastP =>> nrprot 65% Identities = 238/489 (48%), Positives = 322 / 489 (65%), Gaps = 4/489 (0%) refINP_899921.11 glycerol kinase [Chromobacterium violaceum ATCC 12472] gblAAQ57930.1 Glycerol kinase [Chromobacterium violaceum ATCC 12472] Length = 500 4228.2 Best-BlastP =>> nrprot 64% Identities = 229/504 (45%), Positives = 327/504 (64%), Gaps = 15/504 (2%) REFIZP_00091277.1 I COG0578: Glycerol-3-phosphate dehydrogenase [Azotobacter vinelandii] Length = 510 4205.2 Best-BlastP =>> nrprot No Hits found 4206.2 4209.2 421.2 4211.2 4212.1 4214.3 422.3 4220.2 4221.3 4222.3 4225.1 4226.2 4227.1 423.2 Best-BlastP =>> nrprot 47% Identifies = 139/430 (32%), Positives = 204/430 ( 47%), Gaps = 28/430 (6%) ref INP_407457.11 hypothetical protein [Yersinia pestis] pirllAD0489 hypothetical protein YPO4021 [imported] - Yersinia pestis (strain C092) emblCAC93480.1 hypothetical protein [Yersinia pestis C092] Length = 414 4231.2 Best-BlastP =>> nrprot 16% Identities = 49 / 205 (23%), Positives = 81/205 (39%), Gaps = 31/205 (15%) embiCAE02991.1 j OSJNBa0043LO9.10 [Oryza sativa (japonica cultivar-group)] Length = 687 4232.3 Best-BlastP = >> nrprot 42% Identifies = 73/161 (45%), Positives = 103/161 (63%), Gaps = 1/161 (0%) refIss_00088088.1 I COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Pseudomonas fluorescens PfO-1] Length = 241 4233.3 Best-BlastP =>> nrprot No Hits found 4234.3 Best-BlastP =>> nrprot No Hits found 4236.3 Best-BlastP =>> nrprot 58 % Identities = 257/678 (37%), Positives = 391/678 (57%), Gaps = 37/678 (5%) ReflZP_00087890.11 Hypothetical protein [Pseudomonas fluorescens PfO-1] Length = 701 4238.1 Best-BlastP = >> nrprot No Hits crazy 4239.4 Best-BlastP =>> nrprot No Hits found 424.1 Best-BlastP =>> nrprot 73% Identifies = 63/103 (61%), Positives = 76/103 (73%) refZep_00082900.1 l COG0662: Mannose-6 -phosphate isomerase [Pseudomonas fluorescens PfO-1] Length = 103 4242.2 Best-BlastP =>> nrprot 34% Identifies = 67/250 (26%), Positives = 112/250 (44%), Gaps = 18/250 (7%) %) refIXP_340725.1 I iron / ascorbate oxidoreductase family protein, putative [Trypanosoma brucei] gb! AAQ16084. 11 iron / ascorbate oxidoreductase family protein, putative [Trypanosoma brucei] Length = 319 4243.2 Best-BlastP =>> nrprot 67% Identifies = 76/154 (49%), Positives = 101/154 (65%), Gaps = 8 / 154 (5%) refINP_360925.1 I unknown [Rickettsia conorii] pirIIH97860 hypothetical protein RC1288 [imported] - Rickettsia conorii (strain Malish 7) gblAAL03826.1 I unknown [Rickettsia conorii] Length = 154 4244.1 Best-BlastP =>> nrprot No Hits found 4246.2 Best-BlastP =>> nrprot 54% Identities = 95/280 (33%), Positives = 154/280 (55%), Gaps = 7/280 (2%) gbIAAM73852.1 jAF454863_1 putative lipase LipA [Legionella pneumophila] Length = 282 4247.2 Best-BlastP =>> nrprot 40% Identifies = 63/264 (23%), Positives = 117/264 (44%), Gaps = 9/264 (3%) refgP_00118032.11 COG1560: Lauroyl / myristoyl acyltransferase [Cytophaga hutchinsonii] Length = 307 4248.1 Best-BlastP =>> nrprot 52% Identifies = 31/74 (41%), Positives = 47/74 (63%), Gaps = 6/74 (8%) refIZP_00066809 .1 J COG1748: Saccharopine dehydrogenase and related pr oteins [Microbulbifer degradans 2-40] Length = 371 4249.1 Best-BlastP =>> nrprot 36% Identifies = 89/354 (25%), Positives = 144/354 (40%), Gaps = 39/354 (11%) gbJEAA22829.11 hypothetical protein [Plasmodium yoelii yoelii] Length = 2694 425.1 Best-BlastP =>> nrprot No Hits found 4250.1 Best-BlastP =>> nrprot No Hits found 4251.2 Best-BlastP =>> nrprot No Hits found 4253.1 Best-BlastP =>> nrprot 55% Identities = 173/457 (37%), Positives = 272/457 (59%), Gaps = 19/457 (4%) refINP654426.1 j aa_permeases, Amino acid permease [Bacillus anthracis A2012] refINP_843029 Amino acid permease family protein [Bacillus anthracis str. Ames] amino acid permease family protein [Bacillus anthracis str. Ames] Length = 473 4254.2 Best-BlastP =>> nrprot No Hits found 4255.1 Best-BlastP =>> nrprot No Hits found 4259.2 Best-BlastP =>> nrprot 57% Identities = 104/292 (35%), Positives = 167 / 292 (57%), Gaps = 31/292 (10%) refgZP_00065076.1 t COG1766: Flagellar biosynthesis / type III secretory pathway lipoprotein [Microbulbifer degradans 2-40] Length = 556 426.3 Best-BlastP =>> nrprot No Hits found 4262.2 Best-BlastP =>> nrprot 47% Identities = 42/141 (29%), Positives = 72/141 (51%) refINP_249796.1! flagellar protein FIiJ [Pseudomonas aeruginosa PAOI] COG2882: Flagellar biosynthesis chaperone [Pseudomonas aeruginosa UCBPP-PA14] pirJIB83509 flagellar protein FIiJ PA1105 [imported] - Pseudomonas aeruginosa (strain PAOI) gbIAAG04494.11AE004540_14 flagellar protein FliJ [Pseudomonas aeruginosa PA01] Length = 147 4266.3 Best-BlastP =>> nrprot 35% Identities = 82/312 (26%), Positives = 145/312 (46%), Gaps = 51/312 (16%) gblAAN63820.1 1 lysophospholipase A [Legionella pneumophila] Length = 309 4267.5 Best-BlastP =>> nrprot 68% Identities = 360/694 (51%), Positives = 475/694 (68%), Gaps = 15/694 (2%) emblCAA86935.11 polyphosphate kinase [ Acinetobacter sp. ADP1] Length = 691 4269.3 Best-BlastP =>> nrprot No Hits found 427.3 Best-BlastP =>> nrprot 67% Identities = 127/239 (53%), Positives = 174/239 (72%), Gaps = 5 / 239 (2%) REFINP_743000.1 j RNA methyltransferase, TrmH family, group 1 [Pseudomonas putida KT2440] gb! AAN66464.1 1AE016275_9 RNA methyltransferase, TrmH family, group 1 [Pseudomonas putida KT2440] Length = 251 4272.3 Best-BlastP => > nrprot No Hits found 4273.1 Best-BlastP =>> nrprot 35% Identities = 83/286 (29%), Positives = 133/286 (46%), Gaps = 2/286 (0%) reflZP_00065171.1 COG0583: Transcriptional regulator [Microbulbifer degradans 2-40] Length = 299 4275.2 Best-BlastP =>> nrprot 49% Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 19/244 (7%) refINP_661075.1 I oxidoreductase, shortchain dehydrogenase / reductase family [Chlorobium tepidum TLS] gblAAM71417. 11 oxidoreductase, short chain dehydrogenase / reductase family [Chlorobium tepidum TLS] Length = 246 4276.2 Best-BlastP =>> nrprot 11% Identities = 46/172 (26%), Positives = 73/172 (42%), Gaps = 36/172 (20%) dbjIBAC96628.1 Preserved hypothetical protein [Vibrio vuinificus YJ016] Length = 442 428.1 Best-BlastP =>> nrprot 75% Identities = 142/257 (55%), Positives = 197/257 (76%) ) refINP_820132.1! Inositol-1-monophosphatase [Coxiella burnetii RSA 493] gb! AA090646.1 Inositol-1-monophosphatase [Coxiella burnetii RSA 493] Length = 266 4281.2 Best-BlastP =>> nrprot 50% Identities = 32/88 (36%) , Positives = 45/88 (51%), Gaps = 4/88 (4%) refINP 441652.1 I unknown protein [Synechocystis sp. PCC 6803] pir11S75873 Hypothetical Protein Slr1163 - Synechocystis sp. (strain PCC 6803) dbjIBAA18332.1 ORF_ID: slr1163 unknown protein [Synechocystis sp. PCC 6803] Length = 556 4282.2 Best-BlastP =>> nrprot 67% Identities = 126/249 (50%), Positives = 169/249 (67%), Gaps = 2/249 (0%) gblAAM51645.1 J putative transposase [Francisella tularensis subsp. tularensis] Length = 247 4284.2 Best-BlastP =>> nrprot 41% Identities = 100/266 (37%), Positives = 142/266 (53%), Gaps = 35/266 (13%) refJNP_769986.1 bII3346 [Bradyrhizobium japonicum] dbjIBAC48611.11 bII3346 [Bradyrhizobium japonicum USDA 110] Length = 314 4285.1 Best-BlastP =>> nrprot No Hits found 4288.2 Best-BlastP =>> nrprot 98% Identities = 314/322 (97%), Positives = 318 / 322 (98%) gbIAAD43224.11AF111940_6 LspK precursor [Legionella pneumophila] Length = 322 4289.2 Best-BlastP =>> nrprot 99% Identities = 203/205 (99%), Positives = 204/205 (99%) gbIAAD43223.1 IAF111940_5 LspJ precursor [Legionella pneumophila] Length = 205 429.2 Best-BlastP =>> nrprot 60% Identities = 149/315 (47%), Positives = 207/315 (65%), Gaps = 4/315 (1%) refINP 793611.11 SppA peptide peptidase signal, 36K type [Pseudomonas syringae pv. tomato str. DC3000] gb1AAO57306.11 signal peptide peptidase SppA, 36K type [Pseudomonas syringae pv. tomato str. DC3000] Length = 332 4291.1 Best-BlastP =>> nrprot 98% Identities = 123/125 (98%), Positives = 124/125 (99%) gbjAAD43222.1 1AF111940 4 Lspl precursor [Legionella pneumophila] Length = 125 4293.2 Best -BlastP =>> nrprot 67% Identities = 116/253 (45%), Positives = 173/253 (68%), Gaps = 1/253 (0%) refINP_927916.11 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] emblCAE12861.1l unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 258 4294.3 Best-BlastP =>> nrprot 57% Identities = 107/276 (38%), Positives = 161/276 (58%) refINP_720100.1 cell division ABC carry, FtsX permease protein [Shewanella oneidensis MR -1] gbjAAN57544.11AE015890_5 cell division ABC carry, FtsX permease protein [Shewanella oneidensis MR-1] Length = 321 4295.3 Best-BlastP =>> nrprot 69% Identities = 210/424 (49%), Positive = 301/424 ( 70%) refINP_820879.1 J peptidase, M16 family [Coxiella burnetii RSA 493] gblAAO91393.1 I peptidase, M16 family [Coxiella burnetii RSA 493] Length = 459 4296.1 Best-BlastP =>> nrprot 63% Identities = 164/388 ( 42%), Positive = 248/388 (63%) refiNP_820878.11 peptidase, M16 family [Coxiella burnetii RSA 493] gblAAO91392.1 J peptidase, M16 family [Coxiella burnetii RSA 493] Length = 443 4297.2 Best-BlastP =>> nrprot 64% Identities = 85/182 (46%), Positives = 117/182 (64%), Gaps = 6/182 (3%) refgP_00134417.11 COG0742: N6-adenine-specific methylase [Actinobacillus pleuropneumoniae serum ovar 1 str. 4074] Length = 197 43.1 Best-BlastP =>> nrprot 97% Identities = 228/238 (95%), Positive = 233/238 (97%) gblAAM08245.1 probable marital transfer protein [Legionella pneumophila] Length = 238 4301.1 Best -BlastP =>> nrprot 63% Identities = 130/287 (45%), Positives = 188/287 (65%), Gaps = 2/287 (0%) refiXP_306575.1 ENSANGP00000014633 [Anopheles gambiae] gbjEAA02168.1 J ENSANGP00000014633 [Anopheles gambiae str. PEST] Length = 304 4302.1 Best-BlastP =>> nrprot 81% Identities = 190/271 (70%), Positives = 227/271 (83%) refINP 459218.11 2,3,4,5-tetrahydropyridine-2-carboxylate N succinyltransferase [Salmonella typhimurium LT2] gblAAL19177.11 2,3,4,5tetrahydropyridine-2-carboxylate N-succinyltransferase [Salmonella typhimurium LT2] Length = 274 4303.1 Best-BlastP =>> nrprot 68% Identities = 203/374 (54% ), Positives = 258/374 (68%), Gaps = 1/374 (0%) refGZP_00064957.1 COG0624: Acetylornithine deacetylase / Succinyl-diaminopimelate desuccinylase and related deacylases [Microbulbifer degradans 2-40] Length = 382 4305.2 Best-BlastP =>> nrprot No Hits found 4307.2 Best-BlastP =>> nrprot No Hits found 4309.2 Best-BlastP =>> nrprot 37% Identities = 79/320 (24%), Positives = 143/320 (44%), Gaps = 16/320 (5%) gb1AAC83363.1 outer membrane secretion protein Y [Pseudomonas alkaligenes] Length = 381 431.1 Best-BlastP =>> nrprot No Hits found 4310.1 Best-BlastP =>> nrprot 45% Identities = 34/139 (24) %), Positives = 71/1 39 (51%), Gaps = 3/139 (2%) refINP_755574.11 Putative general secretion pathway protein M-type yghD [Escherichia coli CFT073] gblAAN82147.1 jAE016766_235 Putative general secretion pathway protein Mtype yghD [Escherichia coli CFT073] Length = 4311.1 Best-BlastP =>> nrprot 41% Identities = 47/173 (27%), Positives = 74/173 (42%), Gaps = 14/173 (8%) refINP_232963.1 I DamX-related protein [Vibrio cholerae 01 biovar eltor str. N16961] pirlIB82443 DamX-related protein VCA0573 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF96475.1l DamX-related protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 195 4312.2 Best-BlastP =>> nrprot 57% Identities = 186/432 (43%), Positives = 253/432 (58%), Gaps = 8/432 (1%) refINP_231613.1 1 deoxyguanosinetriphosphate triphosphohydrolase [Vibrio cholerae 01 biovar eltor str. N16961] spiQ9KQL91DG1A_VIBCH Deoxyguanosinetriphosphate triphosphohydrolase-like protein 1 pirjIB82132 deoxyguanosinetriphosphate triphosphohydrolase VC1979 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF95127.1 deoxyguanosinetriphosphate triphosphohydrolase [Vibrio cholerae 01 biovar eltor str. N16961] Length = 441 4316.4 Best-BlastP =>> nrprot 23% Identities = 87/391 (22%), Positives = 154/391 (39%), Gaps = 61/391 (15%) gblAAC21558.11 paramyosin related protein [Echinococcus granulosus] Length = 601 4319.2 Best-BlastP =>> nrprot 38% Identities = 56/226 (24%), Positives = 95/226 (42%), Gaps = 24/226 (10%) refINP_820254.1 I ompA-like transmembrane domain protein [Coxiella burnetii RSA 493] gblAAO90768.11 ompA-like transmembrane domain protein [Coxiella burnetii RSA 493] Length = 248 432.1 Best-BlastP =>> nrprot No Hits found 4320.1 Best-BlastP =>> nrprot 61 % Identities = 163/420 (38%), Positives = 265/420 (63%), Gaps = 4/420 (0%) refI NP_249285.1 I peptidyl-prolyl cistrans isomerase SurA [Pseudomonas aeruginosa PA01] pir11B83572 peptidyl-prolyl cis-trans isomerase PAA594 [imported] Pseudomonas aeruginosa (strain PAOI) gbIAAG03983.1 1AE004495_7 peptidylprolyl cis-trans isomerase SurA [Pseudomonas aeruginosa PAO1] Length = 430 4321.2 Best-BlastP =>> nrprot 48% Identities = 274/8 16 (33%), Positives = 410/816 (50%), Gaps = 61/816 (7%) refINP_820953.1 I organic solvent tolerance protein [Coxiella burnetii RSA 493] AAO91467.1 I organic solvent tolerance protein [ Coxiella burnetii RSA 493] Length = 870 4322.1 Best-BlastP =>> nrprot 57% Identities = 133/323 (41%), Positives = 187/323 (57%), Gaps = 9/323 (2%) refINP840285.1 I Domain of unknown function DUF227 [Nitrosomonas europaea ATCC 19718] emblCAD84102.1 I Domain of unknown function DUF227 [Nitrosomonas europaea ATCC 19718] Length = 332 4323.1 Best-BlastP =>> nrprot 65% Identities = 105/218 (48%), Positives = 145/218 (66%), Gaps = 4/218 (1%) COG1208: Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis / translation initiation factor 2B, gamma / epsilon subunits (eIF-2Bgamma / eIF-2Bepsilon) [Pseudomonas syringae pv. syringae B728a] Length = 223 Best-BlastP =>> nrprot 66% Identities = 154/307 (50%), Positives = 205/307 (66%), Gaps = 1/307 (0%) ref! NP_462824.1! porphobilinogen deaminase (hydroxymethylbilane synthase) [Salmonella typhimurium LT2] gbJAAF33453. 11 89% identity with E. coli porphobilinogen deaminase (HEMC) (SP: P06983); contains similarity to Pfam family PF01379 (Porphobilinogen deaminase), score = 627.8, E = 6.2e-185, N = 1 [Salmonella typhimurium LT2] gb! AAL22783.11 porphobilinogen deaminase [Salmonella typhimurium LT2] Length = 318 Best-BlastP => > nrprot 50% Identities = 75/233 (32%), Positives = 127/233 (54%), Gaps = 3/233 (1%) dbjIBAC92844.1! uroporphyrinogen-III synthase [Vibrio vuinificus YJ016] Length = 260 Best-BlastP =>> nrprot 40% Identities = 86/318 (27%), Positives = 151/318 (47%), Gaps = 26/318 (8%) COG2959: Uncharacterized enzyme of heme biosynthesis [Microbulbifer degradans 2-40] Length = 494 Best-BlastP =>> nrprot 56% Identities = 139/389 (35%), Positive = 224/389 (57%), Gaps = 3/389 (0%) reflHP_821051.1 hemY protein [Coxiella burnetii RSA 493] gbjAAO91565.1! hemY protein [Coxiella burnetii RSA 493] Length = 392 Best-BlastP =>> nrprot 99% Identities = 1007/1009 (99%), Positives = 1008/1009 (99%) pirllT18339 icmB protein Legionella pneumophila emblCAA75170.1! IcmB protein [Legionella pneumophila] gbIAAC38183.1 DotO [Legionella pneumophila] embICAA75336.1 I IcmB protein [Legionella pneumophila] Length = 1009 Best-BlastP =>> nrprot59% Identities = 82/151 (54%), Positives = 107/151 (70%) ref! ZP_00024252.1! COG0412: Dienelactone hydrolase and related enzymes [Ralstonia metallidurans] Length = 435 Best-BlastP =>> nrprot 61% Identities = 128/282 (45%), Positives = 174/282 (61%), Gaps = 4/282 (1 % COG0454: Histone acetyltransferase HPA2 and related acetyltransferases [Methanosarcina barkeri] Length = 286 Best-BlastP =>> nrprot 62% Identities = 135/293 (46%), Positives = 187/293 (63%) ) Gaps = 6/293 (2%) ref! NP_421406.1 I conserved hypothetical protein [Caulobacter crescentus CB15] 011E387572 conserved hypothetical protein CC2605 [imported] - Caulobacter crescentus gblAAK24574.11 conserved hypothetical protein [Caulobacter crescentus CB15] Length = 304 4336.2 Best-BlastP =>> nrprot 59% Identities = 163/401 (40%), Positive = 242/401 (60%), Gaps = 1/401 (0%) reflNP_626512.1 putative integral membrane protein. [Streptomyces coelicolor A3 (2)] pirjJT50573 Probably integral membrane protein [imported] - Streptomyces coelicolor emblCAB61710.1! putative integral membrane protein. [Streptomyces coelicolor A3 (2)] Length = 431 Best-BlastP =>> nrprot 57% Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 2/63 (3%) refINP_799393 .1! putative signal peptide protein [Vibrio parahaemolyticus RIMD 2210633] dbj! BAC61277.1! putative signal peptide protein [Vibrio parahaemolyticus] Length = 86 Best-BlastP =>> nrprot 68% Identities = 147/290 (50%), Positives = 206/290 (71%), Gaps = 1/290 (0%) ref ! NP_781198. 1 Myo-inositol catabolism protein iolE [Clostridium tetani E88] gbIAAO35135.1 1 myo-inositol catabolism protein iolE [Clostridium tetani E88] Length = 298 4339.1 Best-BlastP =>> nrprot 72% Identities = 347/644 (53%) , Positives = 451/644 (70%), Gaps = 25/644 (3%) ref! ZP_00131855.1 I COG3962: Acetolactate synthase [Haemophilus somnus 2336] Length = 645 434.3 Best-BlastP =>> nrprot 99% Identities = 207/208 (99%), Positives = 207/208 (99%) pir! IT18338 icmJ protein Legionella pneumophila emblCAA75169.1! IcmJ protein [Legionella pneumophila] gblAAC38184.11 DotN [Legionella pneumophila] embICAA75335.1I IcmJ protein [Legionella pneumophila] Length = 208 4325.3 4326.1 4327.1 4328.1 433.1 4332.1 4333.1 4334.1 4337.3 4338.3 4340.2 Best-BlastP =>> nrprot 36% Identities = 179 / 356 (50%), Positives = 232/356 (65%), Gaps = 4/356 (1%) refGZP_00122182.1 I COG3892: Uncharacterized Protein Preserved in Bacteria [Haemophilus somnus 129PT] Length = 636 4341.3 Best-BlastP => > nrprot No Hits found 4342.1 0157: H7 EDL933] reflNP_312096.1 j hypothetical protein [Escherichia coli 0157: H7] reflNP_417657.1 l hypothetical protein [Escherichia coli K12] ref1NP 708989.1 I orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] ReflNP_755814.1 Protein yrbA [Escherichia coli CFT073] ReflNP_838699.1I Hypothetical protein [Shigella flexneri 2a str. 2457T] pirllH65109 hypothetical 9.5kD protein in murZ-rpoN intergenic region - Escherichia coli (strain K-12) pli-11E91137 hypothetical protein ECs4069 [imported] Escherichia coli (strain 0157: H7, substrate RIMD 0509952) pirllH85982 hypothetical protein yrbA [imported] Escherichia coli (strain 0157: H7, substrain EDL933) gbJAAA57991.1 1 ORF_f89 [Escherichia coli] gb1AAC76222.1 orf, hypothetical protein [Escherichia coli K12] gblAAF21251.11AF053073 4 YrbA [Shigella flexneri] gbJAAG58324.11AE005547_10 orf, hypothetical protein [ Escherichia coli 0157: H7 EDL933] dbjlBAB37492.1I hypothetical protein [Escherichia coli 0157: H7] gblAAN44696.11AE015334_10 orf, conserved hypothetical protein [Best-BlastP =>> nrprot 80% Identities = 272/419 (64%), Positive = 339 / 419 (80%) ref1NP 794195.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Pseudomonas syringae pv. tomato str. UDP-N-acetylglucosamine 1carboxyvinyltransferase [Pseudomonas syringae pv. tomato str. DC3000] Length = 421 Best-BlastP =>> nrprot 71% Identities = 136/252 (53%), Positives = 182/252 (72%), Gaps = 3/252 (1%) refJNP_718206.11 conserved hypothetical protein TIGR00486 [Shewanella oneidensis MR-1] gblAAN55650.1 IAE015704_1 conserved hypothetical protein TIGR00486 [Shewanella oneidensis MR-1] Length = 250 Best-BlastP =>> nrprot 71% Identities = 153/286 (53%), Positives = 207/286 ( 72%), Gaps = 1/286 (0%) refINP_249701. 1 j dihydrodipicolinate synthase [Pseudomonas aeruginosa PAOI] spIQ9I4W3IDAPA_PSEAE Dihydrodipicolinate synthase (DHDPS) pir1lC83520 dihydrodipicolinate synthase PA1010 [imported] - Pseudomonas aeruginosa (strain PA01) gblAAG04399.1 jAE004533_10 dihydrodipicolinate synthase [Pseudomonas aeruginosa PAOI] Length = 292 4347.2 Best-BlastP =>> nrprot 44% Identities = 31/68 (45%), Positives = 38/68 (55%), Gaps = 7/68 (10%) refJZP_00035058.1 I COG2885: Outer membrane protein and related peptidoglycan-associated (lipo) proteins [Burkholderia fungorum] Length = 237 4349.2 Best-BlastP =>> nrprot 81% Identities = 180/260 (69%), Positives = 213/260 (81%) refINP_900365.1 13-hydroxybutyrate dehydrogenase [Chromobacterium violaceum ATCC 12472] gbIAAQ58371 .1! 3-hydroxybutyrate dehydrogenase [Chromobacterium violaceum ATCC 12472] Length = 260 4350.2 Best-BlastP =>> nrprot 59% Identities = 152/375 (40%), Positives = 230/375 (61%), Gaps = 4/375 (1) % = reficto esterase of the alpha-beta hydrolase superfamily [Rhodopseudomonas palustris] Length = 379 4351.2 Best-BlastP =>> nrprot 73% Identities = 161/286 (56%), Positive = 221/286 (%) 77%) refINP_522970.1 I PROBABLE CHEMOTAXIS (MOTILITY PROTEIN A) TRANSMEMBRANE [Ralstonia solanacearum] embICAD18562.1 l PROBABLE CHEMOTAXIS (MOTILITY PROTEIN A) TRANSMEMBRANE [Ralstonia solanacearum] 'Length = 286 4352.3 Best-BlastP =>> nrprot 61% Identities = 140/284 (49%), Positives = 191/284 (67%), Gaps = 1/284 (0%) ReflNP_840146.1 Bacterial outer membrane protein [Nitrosomonas europaea ATCC 19718] emblCAD83956.1 Bacterial outer membrane protein [ Nitrosomonas europaea ATCC 19718] Length = 307 4353.2 Best-BlastP =>> nrprot No Hits found 4344.1 4345.1 4346.2 441 4354.2 Best-BlastP =>> nrprot No Hits found 4355.2 Best-BlastP =>> nrprot 64% Identities = 161/310 (51%), Positives = 204/310 (65%), Gaps = 5/310 (1%) refINP 438574.1 J hypothetical protein [Haemophilus influenzae Rd] splP44433IRLUC_HAEIN Ribosomal broad subunit pseudouridine synthase C (Pseudouridylate synthase) (Uracil hydrolyase) pirlIG64151 hypothetical protein HI0412 - Haemophilus influenzae (strain Rd KW20) gbJAAC22071.1 1 conserved hypothetical protein [Haemophilus influenzae Rd] Length = 322 4356.2 Best-BlastP => > nrprot 52% Identities = 77/215 (35%), Positives = 116/215 (53%), Gaps = 8/215 (3%) reflZP_00013688.1 l hypothetical protein [Rhodospirillum rubrum] Length = 236 4357.3 Best-BlastP =>> nrprot 98% Identities = 414/424 (97%), Positive = 420/424 (99%) gbjAAM00604.1 I putative histidine kinase [Legionella pneumophila] Length = 424 4358.2 Best-BlastP =>> nrprot 490/0 Identities = 64/187 (34%), Positives = 91/187 (48%), Gaps = 7/187 (3%) refINP_761114.1 I Guanylate cyclaserelated protein [Vibrio vulnificus CMCP6] gbjAAO10641. 11AE016804_151 Guanylate cyclase-related protein [Vibrio vulnificus CMCP6] dbjIBAC94846.1 I guanylate cyclase-related protein [Vibrio vulnificus YJ016] Length = 185 436.4 Best-BlastP =>> nrprot No Hits found 4363.2 Best-BlastP =>> nrprot 43% Identities = 68/183 (37%), Positives = 106/183 (57%), Gaps = 2/183 (1%) COG3555: Aspartyl / asparaginyl beta-hydroxylase and related dioxygenases [Trichodesmium erythraeum IMS101] Length = 283 4364.2 Best-BlastP =>> nrprot 41% Identities = 36/77 (46%), Positives = 44/77 (57%) pir1ID72548 hypothetical protein APE1672 Aeropyrum pernix (strain K1) dbjIBAA80673.1 1113aa long hypothetical protein [Aeropyrum pernix ] Length = 113 4365.4 Best-BlastP =>> nrprot 63% Identities = 78/175 (44%), Positives = 115/175 (65%), Gaps = 6/175 (3%) refZD_00021197.1 I COG0262: Dihydrofolate reductase [Ralstonia metallidurans] Length = 177 4366.1 Best-BlastP =>> nrprot 47% Identities = 37/123 (30%), Positives = 66/123 (53%), Gaps = 4/123 (3%) refINP800262.1glutathione S- transfersae-related protein [Vibrio parahaemolyticus RIMD 2210633] dbjlBAC62095.1 glutathione S-transfersae-related protein [Vibrio parahaemolyticus] Length = 128 4367.1 Best-BlastP =>> nrprot No Hits found 4369.1 Best-BlastP =>> nrprot 35% Identities = 53/153 (34%), Positives = 79/153 (51%), Gaps = 2/153 (1%) refJZP_00026335.1 COG3714: Predicted Membrane Protein [Ralstonia metallidurans] Length = 233 4370.1 Best- BlastP =>> nrprot No Hits found 4371.1 Best-BlastP =>> nrprot 57% Identities = 122/252 (48%), Positives = 171/252 (67%), Gaps = 4/252 (1%) refINP819457.1 I polysaccharide deacetylase-related protein [Coxiella burnetii RSA 493] gblAA089971.11 polysaccharide deacetylase-related protein [Coxiella burnetii RSA 493] Length = 276 4372.3 Best-BlastP =>> nrprot 61% Identities = 167/391 (42%), Positive = 247/391 (63%), Gaps = 5/391 (1%) refINP_820110.1 membrane-bound lytic murein family protein transglycosylase [Coxiella burnetii RSA 493] gblAAO90624.1 J membrane-bound l yt = msein transglycosylase family protein [Coxiella burnetii RSA 493] Length = 400 4373.3 Best-BlastP =>> nrprot 64% Identities = 45/105 (42%), Positives = 68/105 (64%), Gaps = 7/105 ( 6%) refINP_800642.1 I hypothetical protein VPA1132 [Vibrio parahaemolyticus RIMD 2210633] dbj1BAC62475.1 I hypothetical protein [Vibrio parahaemolyticus] Length = 108 4374.4 4376.3 4377.4 4378.2 4379.1 4381.2 4383.2 4384.2 4385.1 4386.2 4387.3 4388.1 4389.2 Best-BlastP =>> nrprot 68 % Identities = 262/502 (52%), Positives = 358/502 (71%) refINP_819429.1 Integral membrane protein MviN [Coxiella burnetii RSA 493] gbIAAO89943.1 Integral membrane protein MviN [Coxiella burnetii RSA 493] Length = 515 Best-BlastP =>> nrprot 63% Identities = 105/215 (48%), Positive = 143/215 (66%) pdbllAZOI Dna Mismatch Repair Protein Muth From E. Coli Length = 232 Best-BlastP =>> nrprot No Hits found Best- BlastP =>> nrprot 75% Identities = 135/205 (65%), Positives = 167/205 (81%), Gaps = 1/205 (0%) refINP299538.1 I antibi otic acetyltransferase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61371.1 1 antibiotic acetyltransferase [Vibrio parahaemolyticus] Length = 212 Best-BlastP =>> nrprot 40% Identities = 85/221 (38%), Positive = 120/221 (54%), Gaps = 8/221 (3%) COG3393: Predicted acetyltransferase [Nostoc punctiform] Length = 222 Best-BlastP =>> nrprot 79% Identities = 276/420 (65%), Positive = 340/420 (80%) amino acid permease family protein [Coxiella burnetii RSA 493] gblAAO90476.1 amino acid permease family protein [Coxiella burnetii RSA 493] Length = 437 BestBlastP =>> nrprot 37% Identities = 83/190 (43%), Positive = 109/190 (57%), Gaps = 3/190 (1%) refINP 435788.1 hypothetical protein [Sinorhizobium meliloti] pir1IF95329 hypothetical protein SMa1005 [imported] Sinorhizobium meliloti (strain 1021) magaplasmid pSymA gblAAK65200.1 I hypothetical protein [Sinorhizobium meliloti] Length = 266 Best-BlastP =>> nrprot 55% Identities = 171/477 (35%), Positives = 267/47 7 (55%), Gaps = 9/477 (1%) refINP_819538.1 I proton / peptide symporter family protein [Coxiella burnetii RSA 493] gbIAAO90052.1 1 proton / peptide symporter family protein [Coxiella burnetii RSA 493] Length = 492 Best-BlastP =>> nrprot 85% Identities = 411/546 (75%), Positive = 474/546 (86%), Gaps = 3/546 (0%) refINP_230848.1 J urocanate hydratase [Vibrio cholerae 01 biovar eltor str. N16961] spiQ9KSQ3IHUTU_VIBCH Urocanate hydratase (Urocanase) (Imidazolonepropionate hydrolase) pir1IF82228 urocanate hydratase VC1203 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbJAAF94362.1 urocanate hydratase [Vibrio cholerae 01 biovar eltor str. N16961] Length = 565 Best-BlastP =>> nrprot 73% Identities = 296/486 (60%), Positives = 375/486 (77%), Gaps = 1/486 (0%) refINP_230847.1 J histidine ammonia Iyase [Vibrio cholerae 01 biovar eltor str. N16961] spIQ9KSQ4IHUTH_VIBCH Histidine ammonia-lyase (Histidase) pirIIE82228 histidine ammonia-lyase (EC 4.3.1.3) [similarity] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF94361.1 J histidine ammonia-lyase [Vibrio cholerae 01 biovar eltor str. N16961] Length = 511 Best-BlastP =>> nrprot 62% Identities = 96/190 (50%), Positives = 128/190 (67%), Gaps = 1/190 (0%) refINP_246159.1 J Dam [Pasteurella multocida] gbIAAK03306.1 J Dam [Pasteurella multocida] gbJAAL05864.11AF411317_2 DNA adenine methylase [Pasteurella multocida] Length = 301 Best-BlastP =>> nrprot 54% Identities = 151/402 (37%), Positives = 232/402 (57) %), Gaps = 5/402 (1%) refINP_819596.1 major facilitator family transporter [Coxiella burnetii RSA 493] gbJAAO90110.11 major facilitator family transporter [Coxiella burnetii RSA 493] Length = 421 Best-BlastP =>> nrprot 62% Identities = 206/405 (50%), Positives = 270/405 (66%), Gaps = 8/405 (1%) refInP_820255.1 D-alanyl-D-alanine carboxypeptidase [Coxiella burnetii RSA 493] gblAAO90769.1 D-alanyl-D-alanine carboxypeptidase [Coxiella burnetii RSA 493] Length = 418 Best-BlastP =>> nrprot 98% Identities = 270/278 (97%), Positives = 275/278 (98%) putative embICAD90964.1 D-Alaamino transferase [Legionella pneumophila] Length = 278 Best-BlastP =>> nrprot 60% Identities = 35/87 (40%), Positives = 53/87 (60%) refINP_841528.1 J conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] spIQ82UJ7IYE87_NITEU Hypothetical UPF0250 protein NE1487 embjCAD85398. 11 conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] Length = 87 Best-BlastP =>> nrprot 98% Identities = 192/199 (96%), Positives = 196/199 (98%) EmbICAD90955.1 I LssX protein [Legionella pneumophila Length = 199 Best-BlastP =>> nrprot 98% Identities = 666/678 (98%), Positives = 672/678 (99%) EmbICAD90962.1 1 LssY protein [Legionella pneumophila] Length = 678 Best-BlastP => > nrprot 63% Identities = 337/723 (46%), Positives = 453/723 (62%), Gaps = 27/723 (3%) refINP_251738.1 J conserved hypothetical protein [Pseudomonas aeruginosa PA01] pirlJA83266 conserved hypothetical protein PA3048 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAG06436.1 JAE004729_10 conserved hypothetical protein [Pseudomonas aeruginosa PAOI] Length = 725 Best- BlastP =>> nrprot 59% Identities = 66/157 (42%), Positive = 95/157 (60%) refJZP_00090069.1 J COG3028: Uncharacterized protein stored in bacteria [Azotobacter vinelandii] Length = 172 4398. 2 Best-BlastP =>> nrprot 48% Identities = 70/252 (27%), Positives = 135/252 (53%), Gaps = 4/252 (1%) refJNP_784615.1 integral membrane protein [Lactobacillus plantarum WCFS1] embJCAD63460.1 J integral membrane protein [Lactobacillus plantarum WCFS1] Length = 293 44.1 Best-BlastP =>> nrprot 97% Identities = 335/346 (96%), Positive = 339/346 (97%) gbJAAM08244.1 probable conjugal transfer protein [Legionella pneumophila ] Length = 346 440.4 Best-BlastP =>> nrprot 14% Identities = 134/534 (25%), Positives = 215/534 (40%), Gaps = 106/534 (19%) pirJJJC6009 surface-located membrane protein Imp3 Precursor - Mycoplasma hominis EmbJCAA64858.11 Lmp3 protein [Mycoplasma hominis] Length = 1302 4402.2 Best-BlastP =>> nrprot 65% Identities = 83/174 (47%), Positives = 119/174 (68%), Gaps = 2 / 174 (1%) refJNP_930722.1 1 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] embyCA15878.1 unnamed protein product [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 176 4403.2 Best-BlastP =>> nrprot 60% Identities = 124/258 (48%), Positive = 160/258 (62%) ReflNP_252268.1 J conserved hypothetical protein [Pseudomonas aeruginosa PA01] spJQ9HY42JYZ78_PSEAE Hypothetical protein PA3578 [Pseudomonas aeruginosa (strain PAO1)] [Pseudomonas aeruginosa PAO1] Length = 261 4404.1 Best-BlastP =>> nrprot 49% Identities = 51/124 (41%) Positive = 69/124 (55%) refJNP_105863.1 J transcriptional regulator [Mesorhizobium loti] dbjJBAB51649.1 J transcriptional regulator [Mesorhizobium loti] Length = 143 4405.1 Best-BlastP =>> nrprot 73% Identities = 77/148 (52% ), Positives = 112/148 (75%) refJNP_662760.1 J conserved hypothetical protein [Chlorobium tepidum TLS] gbJAAM73102.1 J conserved hypothetical protein [Chlorobium tepidum TLS] Length = 155 4406.1 Best-BlastP =>> nrprot 63% Identities = 78/187 (41%), Positives = 121/187 (64% ), Gaps = 1/187 (0%) refJZP_00092584.1J COG1278: Cold shock proteins [Azotobacter vinelandii] Length = 333 4391.1 4392.1 4393.1 4394.4 4395.2 4396.1 4407.1 Best-BlastP =>> nrprot 65% Identities = 39/69 (56% ), Positives = 51/69 (73%) refINP_743260.1 J cold-shock domain family protein [Pseudomonas putida KT2440] gbJAAN66724.1 jAE016300_9 cold-shock domain protein family [Pseudomonas putida KT2440] Length 69 4408.1 Best-BlastP =>> nrprot No Hits found 4409.1 Best-BlastP =>> nrprot 71% Identities = 120/212 (56%), Positives = 150/212 (70%), Gaps = 3/212 (1%) refINP_403711.1 Orotate Phosphoribosyltransferase [ Yersinia pestis] refINP_667439.1 orotate phosphoribosyltransferase [Yersinia pestis KIM] spIQ8ZJP71PYRE YERPE Orotate phosphoribosyltransferase (OPRT) (OPRTase) pirIIAF0006 orotate phosphoribosyltransferase (EC 2.4.2.10) [imported] Yersinia pestis (strain C092) embICAC88912.1 I orotate phosphoribosyltransferase [Yersinia pestis C092] gbIAAM83690.1 1AE013610_2 orotate phosphoribosyltran Sferase [Yersinia pestis KIM] Length = 215 4415.3 Best-BlastP =>> nrprot 55% Identities = 157/417 (37%), Positives = 239/417 (57%), Gaps = 8/417 (1%) reflZP_00034486. 1 l COG0642: Signal transduction histidine kinase [Burkholderia fungorum] Length = 479 4419.2 Best-BlastP =>> nrprot 72% Identities = 161/317 (50%), Positive = 233/317 (73%) refINP_794895.1 J proline iminopeptidase [Pseudomonas syringae pv. tomato str. DC3000] gblAA058590.1 Proline iminopeptidase [Pseudomonas syringae pv. tomato str. DC3000] Length = 323 4421.2 Best-BlastP =>> nrprot 41% Identities = 77/254 (30%), Positives = 111/254 (43%), Gaps = 51/254 (20%) refINP_052363.11 unnamed protein product [Coxiella burnetii] refINP_819024.11 hypothetical protein [Coxiella burnetii RSA 493] pirlIS38245 hypothetical protein - Coxiella burnetii embJCAA53133.1 unnamed protein product [Coxiella burnetii] gblAA091584.1 l hypothetical protein [Coxiella burnetii RSA 493] Length = 341 4422.1 Best-BlastP =>> nrprot No Hits found 4424.1 Best-BlastP =>> nrprot No Hits found 4425.1 Best-BlastP =>> nrprot 46% Identities = 57/160 (35%), Positives = 80/160 (50%), Gaps = 3/160 (1%) refINP_105070.1 I hypothetical protein, acetyltransferase, putative [Mesorhizobium loti] dbjIBAB50856.11 hypothetical protein [Mesorhizobium loti] Length = 168 4427.1 Best-BlastP =>> nrprot No Hits found 4428.1 Best-BlastP => > nrprot No Hits found 4429.2 Best-BlastP =>> nrprot No Hits found 443.3 Best- BlastP =>> nrprot 99% Identities = 190/191 (99%), Positives = 191 / 191 (100%) pirlIT18327 icmQ protein - Legionella pneumophila emblCAA73239.11 lcmQ protein [Legionella pneumophila] embJCAA75324.1 l lcmQ protein [Legionella pneumophila] Length = 191 4431.2 Best-BlastP =>> nrprot 14% Identities = 61/293 ( 20%), Positives = 128/293 (43%), Gaps = 33/293 (11%) dbjlBAC86266.1 I unamed protein product [Homo sapiens] Length = 486 4432.2 Best-BlastP =>> nrprot No Hits found 4433.1 Best -BlastP =>> nrprot 42% Identities = 64/200 (32%), Positives = 86/200 (43%), Gaps = 12/200 (6%) refINP_799850.1 j putative tellurite resistance protein-related protein [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC61683.1 I putative tellurite resistance protein-related protein [Vibrio parahaemolyticus] Length = 195 Best-BlastP =>> nrprot 34% Identities = 52/215 (24%), Positive = 91/215 (42%) , Gaps = 23/215 (10%) refINP_788733.1 multiple ankyrin repeats single KH domain CG33106-PA [Drosophila melanogaster] refINP_788734.1 J multiple ankyrin repeats single KH domain CG33106-PB [Droso phila melanogaster] gbJAAO41600.1 j CG33106-PA [Drosophila melanogaster] gbIAAO41601.1 l CG33106-PB [Drosophila melanogaster] Length = 4001 Best-BlastP =>> nrprot 13% Identities = 50/196 (25%), Positive = 92 / 196 (46%), Gaps = 32/196 (16%) refINP_001804.1 J centromere protein E; Centromere autoantigen E (312kD); centromere protein E (312kD); kinesin family member 10 [Homo sapiens] spIQ0222410ENE_HUMAN Centromeric protein E (CENP-E protein) pirIIS28261 centromere protein E-human embJCAA78727.1 I CENP-E [Homo sapiens] Length = 2663 444.2 Best-BlastP =>> nrprot 96% Identities = 116/120 (96%), Positive = 117/120 (97%) pin IT18326 icmR protein - Legionella pneumophila embICAA73238.1I lcmR protein [Legionella pneumophila] emblCAA75323.11 lcmR protein [Legionella pneumophila] Length = 120 4440.1 Best-BlastP = >> nrprot 73% Identities = 71/144 (49%), Positives = 104/144 (72%), Gaps = 4/144 (2%) refZG_00065054.1 COG1558: Flagellar basal body rod protein [Microbulbifer degradans 2-40 ] Length = 148 4441.1 Best-BlastP =>> nrprot 61% Identities = 61/132 (46%), Positives = 80/132 (60%), Gaps = 1/132 (0%) gblAAN08637.1! FIgB [Aeromonas hydrophila] Length = 132 4442.1 Best-BlastP =>> nrprot 75% Identities = 202/297 (68%), Positives = 235/297 (79%) refINP_928683.1 Oxygen-dependent coproporphyrinogen III oxidase [Photorhabdus luminescens subsp. laumondii TTOI] emblCAE13676.1I oxygen-dependent coproporphyrinogen III oxidase [Photorhabdus luminescens subsp. laumondii TTOI] Length = 302 4444.2 Best-BlastP =>> nrprot 57% Identities = 168/420 (40%), Positives = 249/420 (59%), Gaps = 12/420 (2%) reflZ_00030428.1 J COG0477 : Permeases of the major facilitator superfamily [Burkholderia fungorum] Length = 645 4452.2 Best-BlastP =>> nrprot 34% Identities = 127/238 (53%), Positives = 161/238 (67%) refZNP_00112372.1 I COG2114: Adenylate cyclase, family 4453.2 4454.4 4457.2 regulator OruR [Pseudomonas aeruginosa PA0I] refjZP 00138425.1 COG2207: AraC-type DNA-binding domain-containing proteins [Pseudomonas aeruginosa UCBPP-PA14] sp1P72171 jORUR_PSEAE Ornithine regulation regulator pir1IG83540 transcription regulator OruR PA0831 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAB94774.1 OruR [Pseudomonas aeruginosa] gblAAG04220.11AE004518_1 transcriptional regulator OruR [Pseudomonas aeruginosa PAOI] Length = 339 4462.3 Best-BlastP =>> nrprot 71% Identities = 115/192 (59%), Positive = 145 / 192 (75%) refZGP_00067991.1 J COG0088: Ribosomal protein L4 [Microbulbifer degradans 2-40] Length = 204 4434.1 4435.4 3 (some proteins contain HAMP domain) [Nostoc punctiform] Length = 616 Best-BlastP =>> nrprot 41% Identities = 97/469 (20%), Positives = 194 / 469 (41%), Gaps = 60/469 (12%) gbJEAA15516.1 J hypothetical protein [Plasmodium yoelii yoelii] Length = 585 Best-BlastP =>> nrprot 87% Identities = 258/329 (78%), Positive = 290/329 (88%) gbIAAB58447.11 spectinomycin phosphotransferase [Legionella pneumophila] Length = 331 Best-BlastP =>> nrprot 51% Identities = 102/334 (30%), Positives = 174/334 (52%), Gaps = 14/334 (4%) refINP_249522.1 I transcriptional Best-BlastP =>> nrprot 80% Identities = 138/209 (66%), Positives = 175/209 (83%), Gaps = 1/209 (0% ) refINP 403860.11 50S ribosomal protein L3 [Yersinia pestis] refINP_671283. 1d 50S ribosomal subunit protein L3 [Yersinia pestis KIM] pirIIAB0026 50S ribosomal protein L3 [imported] - Yersinia pestis (strain CO92) emblCAC89069.1 150S ribosomal protein L3 [Yersinia pestis CO92] gblAAM87534.1 jAE014002_7 50S ribosomal subunit protein L3 [Yersinia pestis KIM] Length = 209 Best-BlastP =>> nrprot 87% Identities = 86/103 (83%), Positives = 93/103 (90%) refINP_778069.1 130S ribosomal protein S10 [Buchnera aphidicola (Baizongia pistaciae)] spIQ89A67JRS10_BUCBP 30S ribosomal protein S10 gblAAO27174.11 30S ribosomal protein S10 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] Length = 104 Best-BlastP =>> nrprot 37% Identities = 43/118 (36%), Positives = 61/118 (51%), Gaps = 10/118 (8%) hypothetical H71023 pin protein PH1485 - Pyrococcus horikoshii dbj1BAA30592.1 1 156aa long hypothetical protein [Pyrococcus horikoshii] Length = 156 Best-BlastP =>> nrprot 93% Identities = 338/397 (85%), Positives = 370/397 (93%), Gaps COG0050: GTPases translation elongation factors [Azotobacter vinelandii] Length = 397 Best-BlastP =>> nrprot 89% Identities = 527/691 (76%), Positives = 621/691 (%) 89%) refINP_819279.1 I translation elongation factor G [Coxiella burnetii RSA 493] spIQ83ES7JEFG_COXBU Elongation factor G (EF-G) gblAAO89793.1 I translation elongation factor G [Coxiella burnetii RSA 493] Length = 699 Best-BlastP =>> nrprot 48% Identities = 86/277 (31%), Positives = 138/277 (49%), Gaps = 23/277 (8%) refINP_519890.11 PROBABLE OXIDOREDUCTASE DEHYDROGENASE SIGNAL PEPTIDE PROTEIN [Ralstonia solanacearum] EmbICAD15471 .11 PROBABLE OXIDOREDUCTASE DEHYDROGENASE SIGNAL PROTEIN PEPTIDE [Ralstonia solanacearum] Length = 300 Best-BlastP =>> nrprot 99% Identities = 114/114 (100%), Positives = 114/114 (100%) pir1IT18325 icmS protein - Legionella pneumophila emblCAA73237 .1 I SMI protein [Legionella pneumophila] embICAA75322.1 J IcsS protein [Legionella pneumophila] Length = 114 Best-BlastP =>> nrprot 64% Identities = 156/329 (47%), Positives = 223/329 (67%) , Gaps = 6/329 (1%) refINP_742587.1 I anthranilate phosphoribosyltransferase [Pseudomonas putida KT2440] spIQ88QR7ITRPD_PSEPK Anthranilate phosphoribosyltransferase gbJAAN66051.1 JAE016234_4 anthranilate phosphoribosyltransferase [Pseudomonas putida KT2440] Length = 349 Best-BlastP =>> nrprot 43% Identities = 47 / 160 (29%), Positives = 83/160 (51%), Gaps = 2/160 (1%) refINP_819774.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90288.1 conserved hypothetical protein [Coxiella burnetii RSA 493] ] Length = 4472.2 Best-BlastP =>> nrprot 59% I dentities = 116/247 (46%), Positives = 155/247 (62%), Gaps = 1/247 (0%) refINP_902024.1 I probable hydrolase [Chromobacterium violaceum ATCC 12472] gbjAAQ60026.11 probable hydrolase [Chromobacterium violaceum ATCC 12472] Length = 267 4473.4 Best-BlastP =>> nrprot 59% Identities = 89/180 (49%), Positives = 122/180 (67%), Gaps = 1/180 (0%) reflZP_00092748.1I hypothetical protein [ Azotobacter vinelandii] Length = 397 4474.1 Best-BlastP =>> nrprot 52% Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 4/114 (3%) refIZP_00092749.1 hypothetical protein [Azotobacter vinelandii] Length = 135 4463.2 4464.1 4465.3 4466.3 4468.2 4469.2 447.2 4470.1 4471.3 Best-BlastP =>> nrprot 42% Identities = 51/183 (27%), Positives = 96/183 (52%), Gaps = 14/183 (7%) COG4123: Predicted O-methyltransferase [Lactobacillus gasseri] Length = 338 Best-BlastP =>> nrprot 46% Identities = 204/834 (24%), Positives = 357/834 (42%), Gaps = 142/834 (17%) refINP_907987.1 PHOSPHOENOLPYRUVATE CARBOX YLASE PEPCASE PEPC [Wolinella succinogenes] embICAE10887.1 PHOSPHOENOLPYRUVATE CARBOXYLASE PEPCASE PEPC [Wolinella succinogenes] Length = 885 Best-BlastP =>> nrprot 60% Identities = 46/119 (38%), Positives = 71/119 (59%), Gaps = 3/119 (2%) refINP_769098.11 bIr2458 [Bradyrhizobium japonicum] dbjIBAC47723.11 bIr2458 [Bradyrhizobium japonicum USDA 110] Length = 163 448.1 Best-BlastP =>> nrprot 98% Identities = 86/86 (100%), Positive = 86/86 (100%) pirllT18324 icmT protein - Legionella pneumophila embICAA73236.1 I IcmT protein [Legionella pneumophila] embICAA75321.1 J lcmT protein [Legionella pneumophila] Length = 86 4480.4 Best-BlastP =>> nrprot 69% Identities = 234/416 (56%), Positives = 291/416 (69%) refInP812629.1 gamma-glutamyl phosphate reductase [Bacteroides thetaiotaomicron VPI-5482] gbJAAO78823.1 gamma-glutamyl phosphate reductase [Bacteroides thetaiotaomicron VPI-5482] Length = 417 4481.1 Best-BlastP =>> nrprot 70% Identities = 91/172 (52%), Positives = 124/172 (72%), Gaps = 3 / 172 (1%) refINP_177142.1e expressed protein [Arabidopsis thaliana] refINP_849870.1 expressed protein [Arabidopsis thaliana] pirIIF96720 unknown protein, 58197-59415 [imported] Arabidopsis thaliana gblAAG52556.11AC010675_4 unknown protein; 58197- 59415 [Arabidopsis thaliana] gblAAM20691.11 unknown protein [Arabidopsis thaliana] gbIAAN15655.11 unknown protein [Arabidopsis thaliana] Length = 286 4482.1 Best-BlastP =>> nprot 56% Identities = 119/320 (37%), Positive = 168/320 (52%), Gaps = 33/320 (10%) refJZP_00119712.1 J COG4823: Abortive bacteriophage resistance protein infection [Cytophaga hutchinsonii] Length = 331 4483.2 Best-BlastP =>> nrprot No Hits found 4484.1 Best-BlastP =>> nrprot No Hits found 4485.2 Best-BlastP =>> nrprot 98% Identities = 252/254 (99%), Positives = 252/254 (99%) gbIAAM73853.1 IAF454864_1 putative lipase LipB [Legionella pneumophila] Length = 254 4487.1 Best-BlastP =>> nrprot 70% Identities = 133/223 (59%), Positives = 163/223 (73%) refINP_231545.1 Orotidine5'-phosphate decarboxylase [Vibrio cholerae 01 biovar eltor str. N16961] spIQ9KQT7IPYRF_VIBCH Orotidine 5'-phosphate decarboxylase (OMP decarboxylase) (OMPDCase) (OMPdecase) pirl1A82143 orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) VC1911 [similarity] - Vibrio cholerae (strain N16961 serogroup 01) gbjAAF95059.1 I orotidine 5'-phosphate decarboxylase [Vibrio cholerae 01 biovar eltor str. N16961] Length = 231 4488.1 Best-BlastP =>> nrprot 72% Identities = 213/362 (58%), Positives = 270/362 (74%) refINP_903794.1 I probable aminotransferase [Chromobacterium violaceum ATCC 12472] gbIAAQ61785.1 I probable aminotransferase [Chromobacterium violaceum ATCC 12472] Length = 365 4489.3 Best-BlastP =>> nrprot 67% Identities = 195/383 (50%), Positives = 263/383 (68%), Gaps = 2/383 (0%) refInP_819562.1 TPR domain protein [Coxiella burnetii RSA 493] gblAAO90076.1 TPR domain protein [Coxiella burnetii RSA 493] Length = 388 4490.2 Best-BlastP =>> nrprot 38% Identities = 65/177 (36%), Positives = 109/177 (61%), Gaps = 12/177 (6%) refINP.RTM. 11 conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] Length = 288 4475.1 4477.2 4479.2 4491.3 Best-BlastP =>> nrprot No Hits found 4492.3 Best-BlastP =>> nrprot No Hits found 4493.1 Best-BlastP =>> nrprot No Hits found 4496.2 Best-BlastP =>> nrprot 51% Identities = 106/240 (44%), Positives = 141/240 (58%), Gaps = 3/240 (1%) emblCAB60048.1 I IvrA [Legionella pneumophila] Length = 288 4497.4 Best-BlastP =>> nrprot No Hits found 4498. 1 Best-BlastP =>> nrprot No Hits found 45.1 Best-BlastP =>> nrprot 94% Identities = 115/131 (87%), Positives = 125/131 (95%) gbIAAM08243.1 I LvrD [Legionella pneumophila] Length = 1450.1 Best-BlastP =>> nrprot 39% Identities = 22/50 (44%), Positives = 28/50 (56%) gb1AAF87782.1 jAF279293_I p76 membrane protein precursor [Mycoplasma hyopneumoniae] Length = 1427 4500.1 Best-BlastP =>> nrprot 82% Identities = 69/116 (59%), Positive = 97/116 (83%) refJZP_00067079.1 I hypothetical protein [Microbulbifer degradans 2- 40] Length = 117 4503.1 Best-BlastP = >> nrprot 77% Identities = 209/334 (62%), Positives = 266/334 (79%) phenylalanyl-tRNA synthetase, alpha subunit [Pseudomonas putida KT2440] gblAAN68081.1 IAE016440_1 phenylalanyl-tRNA synthetase, alpha subunit [Pseudomonas putida KT2440] Length = 338 4505.3 Best-BlastP =>> nrprot 88% Identities = 98/118 (83%), Positive = 106/118 (89%) refINP_929901.11 50S ribosomal protein L20 [Photorhabdus luminescens subsp. laumondii TTO1] emblCAE15040.1 150S ribosomal protein L20 [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 118 4508.4 Best-BlastP =>> nrprot 77% Identities = 90/161 (55%), Positives = 126/161 (78%) ReflNP_719351.1 I conserved hypothetical protein [Shewanella oneidensis MR-1] spJQ8EAS7IY2B5_SHEON Hypothetical UPF0234 protein S03815 gblAAN56795.11AE015815_1 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 161 451.3 Best-BlastP =>> nrprot No Hits found 4510.1 Best-BlastP =>> nrprot 83% Identities = 545/812 (67%) , Positives = 672/812 (82%), Gaps = 10/812 (1%) reflNP_819766.1 ATP-dependent protease The [Coxiella burnetii RSA 493] gblAAO90280.11 ATP-dependent protease The [Coxiella burnetii RSA 493] Length = 817 4511.1 4512.4 Parvulin-like peptidyl-prolyl isomerase [Pseudomonas aeruginosa UCBPP-PA14] Length = 621 4516.3 Best-BlastP =>> nrprot 56% Identities = 157/337 (46%), Positives = 214/337 (63%) , Gaps = 3/337 (0%) reflZP_00030194.1 I COG0845: Membrane fusion protein [Burkholderia fungorum] Length = 513 4517.2 Best-BlastP =>> nrprot 51% Identities = 97 / 274 (35%), Positives = 145/274 (52%), Gaps = 21/274 (7%) gblAAK81664.1 j MdcB [Burkholderia cepacia] Length = 290 Best-BlastP =>> nrprot 70% Identities = 53 / 90 (58%), Positives = 66/90 (73%) refIZP_00119213.11 COG0776: Bacterial nucleotide DNA-binding protein [Cytophaga hutchinsonii] Length = 90 Best-BlastP =>> nrprot 49% Identities = 181/604 (29% ), Positives = 311/604 (51%), Gaps = 28/604 (4%) refgP 00139461.11 COG0760: Best-BlastP =>> nrprot 78% Identities = 341/546 (62%), Positives = 431/546 ( 78%), Gaps = 2/546 (0%) refINP_640913.1 i alpha subunit of malonate decarboxylase [Xanthomonas axonopodis pv. citri str. 306] gbjAAM35449.1I alpha subunit of malonate decarboxylase [Xanthomonas axonopodis pv. citri str. 306] Length = 548 Best-BlastP =>> nrprot 73% Identities = 225/396 (56%), Positives = 299/396 (75%), Gaps = 2/396 (0%) spTQ8GDU21ASSY_HELMO Argininosuccinate synthase (Citrulline-- Aspartate ligase) gbjAAN87486.1I Argininosuccinate synthase [Heliobacillus mobilis] Length = 4521.1 Best-BlastP =>> nrprot 60% Identities = 96/207 (46%), Positives = 135/207 (65%), Gaps = 15/207 ( 7%) refINP_465264.1 j similar to amino acid (glutamine) ABC transporter (ATP-binding protein) [Listeria monocytogenes EGD-e] pirjjAC1292 amino acid (glutamine) ABC transporter (ATP-binding protein) homolog lmo1739 [imported] - Listeria monocytogenes (strain EGD-e) embJCAC99817.1 Imol 739 [Listeria monocytogenes] Length = 215 4522.4 Best-BlastP =>> nrprot 66% Identities = 94/203 (46%), Positives = 144/203 (70%), Gaps = 2/203 (0%) amino acid ABC carry protein [Rickettsia conorii] refjZP_00142355.1 amino acid ABC transport protein permease [Rickettsia sibirica] pirjIC97721 amino acid d ABC carry the protein mixture yqiY [imported] Rickettsia conorii (Malish strain 7) gbJAAL02709.1I amino acid ABC carry permease protein [Rickettsia conorii] gbjEAA25764.1 amino acid ABC transport permease protein [Rickettsia sibirica] Length = 218 4523.1 Best-BlastP =>> nrprot 49% Identities = 56/159 (35%), Positives = 89/159 (55%), Gaps = 4/159 (2%) refINP_714273.1 MutT / nudix family protein [Leptospira interrogans serovar lai str . 56601] gbIAAN51291.1 jAE011563_7 MutT / nudix family protein [Leptospira interrogans serovar lai str. 56601] Length = 223 4524.1 Best-BlastP =>> nrprot 52% Identities = 79/246 (32%), Positives = 125/246 (50%), Gaps = 11/246 (4%) refINP_670144.1I arginine 3rd transport periplasmic binding protein [Yersinia pestis KIM] gbjAAM86395.1 jAE013887_2 arginine 3rd transport system periplasmic binding protein [Yersinia pestis KIM] Length = 252 4525.2 Best-BlastP =>> nrprot 73% Identities = 317/556 (57%), Positive = 418/556 (75%), Gaps = 2/556 (0%) refINP_718167.1 I long-chain-fattyacid-CoA ligase [Shewanella oneidensis MR-1] gbjAAN55611.11AE015699_9 longchain-fatty-acid - CoA ligase [Shewanella oneidensis MR-1] Length = 557 4526.3 Best-BlastP =>> nrprot 83% Identities = 64/111 (57%), Positives = 93/111 (83%), Gaps = 2/111 (1%) refJZP_00065090.1 I COG1886: Flagellar motor switch / type III secretory pathway protein [Microbulbifer degradans 2-40] Length = 141 4528.2 Best-BlastP =>> nrprot 21% Identities = 42/73 (57%), Positives = 56/73 (76% ) gbjAAN34372.1 j ORF2 transposase [Acinetobacter baumann ii] Length = 76 453.3 Best-BlastP =>> nrprot 87% Identities = 181/244 (74%), Positives = 220/244 (90%), Gaps = 6/244 (2%) refJZP_00023826.1I COG0330: Membrane protease subunits, stomatin / prohibitin homologs [Raistonia metallidurans] Length = 251 4530.1 Best-BlastP =>> nrprot 69% Identities = 49/91 (53%), Positives = 68/91 (74%) gbIAAP83334.1 IAF469614 2 unknown [ Francisella tularensis subsp. tularensis] Length = 94 4531.2 Best-BlastP =>> nrprot 53% Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 5/77 (6%) gbjAAG53985.1 JAF327444_1 putative transposase A [Pantoea agglomerans] Length = 149 4532.2 Best-BlastP =>> nrprot 30% Identities = 127/185 (68%), Positives = 148/185 (80%), Gaps = 11/185 (5%) EmbjCAC33489.1I hypothetical protein [Legionella pneumophila] Length = 189 4519.3 4520.1 Best-BlastP =>> nrprot 50% Identifies = 643/2158 (29%), Positives = 955/2158 (44%), Gaps = 397/2158 (18%) refINP_758987 .1 J unknown [Zymomonas mobilis] gbIAAL36122.1 I unknown [Zymomonas mobilis] Length = 2201 Best-BlastP =>> nrprot 69% Identities = 226/438 (51%), Positives = 312/438 (71%), Gaps = 18/438 (4%) ref1ZP_00089764.1 I COG0793: Periplasmic protease [Azotobacter vinelandii] Length = 456 Best-BlastP =>> nrprot 49% Identities = 114/349 (32%), Positives = 189/349 (54%) ), Gaps = 12/349 (3%) reflZ_00065627.1 COG4942: Membrane-bound metallopeptidase [Microbulbifer degradans 2-40] Length = 402 Best-BlastP =>> nrprot 68% Identities = 273/506 (53%), Positives = 353/506 (69%), Gaps = 4/506 (0%) reflZP_00141602.1 I COG0696: Phosphoglyceromutase [Pseudomonas aeruginosa UCBPP-PA14] Length = 515 Best-BlastP =>> nrprot 59% Identities = 215/454 (47%), Positives = 301/454 (66%), Gaps = 31/454 (6%) refjNP_820466.11 membrane protein , putative [Coxiella burnetii RSA 493] gblAAO90980.11 protein membrane, putative [Coxiella burnetii RSA 493] Length = 458 4540.2 Best-BlastP =>> nrprot No Hits found 4542.4 Best-BlastP =>> nrprot 35% Identities = 136/313 (43%), Positives = 191/313 (61%), Gaps = 22/313 (7%) refZG_00033133.11 COG2010: Cytochrome c, mono- and diheme variants [Burkholderia fungorum] Length = 432 4546.3 Best-BlastP => > nrprot 21% Identities = 47/163 (28%), Positives = 74/163 (45%), Gaps = 18/163 (11%) refZD_00011332.1 J COG0183: AcetylCoA acetyltransferase [Rhodopseudomonas palustris] Length = 504 4547.4 Best -BlastP =>> nrprot 76% Identities = 206/337 (61%), Positives = 260/33 7 (77%), Gaps = 3/337 (0%) REFIZP_00125317.11 COG0604: NADPH: Quinone reductase and related Zn-dependent oxidoreductases [Pseudomonas syringae pv. syringae B728a] Length = 337 4549.2 Best-BlastP =>> nrprot 21% Identities = 73/109 (66%), Positive = 94/109 (86%) refINP_820449.1 The hypothetical protein [Coxiella burnetii RSA 493] gblAAO90963.1 I = [Coxiella burnetii RSA 493] Length = 113 4551.2 Best-BlastP =>> nrprot 55% Identities = 31/78 (39%), Positive = 49/78 (62%) refINP875585.1 I Uncharacterized conserved membrane protein [ Prochiorococcus marinus subsp. marinus str. CCMP1375] gblAAQ00238.11 Uncharacterized membrane protein [Prochiorococcus marinus subsp. marinus str. CCMP1375] Length = 91 4552.4 Best-BlastP =>> nrprot No Hits found 4553.2 Best-BlastP =>> nrprot 66% Identities = 107/240 (44%), Positives = 156/240 (65%), Gaps = 14 / 240 (5%) refINP_867184.1 l short chain alcohol dehydrogenase-like [Pirellula sp.] EmbICAD74729.1 short chain dehydrogenase-like alcohol [Pirellula sp.] Length = 247 4554.2 Best-BlastP =>> nrprot 35% Identities = 27 / 49 (55%), Positives = 31/49 (63%), Gaps = 1/49 (2%) COG1051: ADP-ribose pyrophosphatase [Burkholderia fungorum] Length = 181 4558.1 Best-BlastP =>> nrprot 29% Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 9/182 (4%) gbJAAK27486.1 JAF343323_1 DNA gyrase B [Cycloclasticus sp. NOP-122A] gblAAK27491.1 1AF343328_1 DNA gyrase B [Cycloclasticus sp. N-221A] gblAAK27492.11AF343329_1 DNA gyrase B [Cycloclasticus sp. N-231 B] gblAAK27493.11AF343330_1 DNA gyrase B [Cycloclasticus sp. P-211 A2] Length = 362 4533.2 4535.2 4536.1 4538.2 454.1 Best-BlastP =>> nrprot 59% Identities = 206/502 (41%), Positives = 308/502 (61%), Gaps = 6/502 (1% ) refINP_819464. 11 amino acid permease family protein [Coxiella burnetii RSA 493] gbIAAO89978.1 amino acid permease family protein [Coxiella burnetii RSA 493] Length = 531 Best-BlastP =>> nrprot 26% Identities = 49/217 (22%), Positive = 98/217 (45%), Gaps = 30/217 (13%) refINP_702678.1 J hypothetical protein [Plasmodium falciparum 3D7] embICAD49112.1 j hypothetical protein [Plasmodium falciparum 3D7] Length = 1248 4561.2 Best-BlastP =>> nrprot 48% Identities = 140/428 (32%), Positive = 222/428 (51%), Gaps = 3/428 (0%) refINP_636850.11 outer membrane component of multidrug efflux pump [Xanthomonas campestris pv. campestris str. ATCC 33913] gblAAM40774.1 1 outer membrane component of multidrug efflux pump [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 467 Best-BlastP =>> nrprot 99% Identities = 198/200 (99%), Positives = 199/200 (99%) gbIAAM00391.11AF386079_1 CcmA [Legionella pneumophila] Length = 200 Best- BlastP => > nrprot 62% Identities = 93/192 (48%), Positives = 124/192 (64%), Gaps = 5/192 (2%) refJZP_00071947.11 COG0693: Putative intracellular protease / amidase [Trichodesmium erythraeum IMS101] Length = 191 Best-BlastP =>> nrprot 10% Identities = 44/175 (25%), Positives = 69/175 (39%), Gaps = 36/175 (20%) gbJAAK20704.1 jAF316641_10 WciT [Streptococcus pneumoniae] Length = 242 Best-BlastP =>> nrprot 50% Identities = 180/528 (34%), Positives = 271/528 (51%), Gaps = 58/528 (10%) ReflNP_820680.1 J conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91194.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 518 4571.2 Best-BlastP =>> nrprot 34% Identities = 29/58 (50%), Positive = 38/58 (65%) refINP_819567.1 lipoprotein , putative [Coxiella burnetii RSA 493] gblAAO90081.11 lipoprotein, putative [Coxiella burnetii RSA 493] Length = 323 4572.2 Best-BlastP =>> nrprot 63% Identities = 175/348 (50%), Positives = 227/348 (65%), Gaps = 2/348 (0%) refIZP_00068140 .1 COG1194: A / G-specific DNA glycosylase [Microbulbifer degradans 2-40] Length = 355 4573.4 Best-BlastP =>> nrprot 43% Identities = 123/542 (22%), Positives = 226/542 (41%) , Gaps = 78/542 (14%) ref (NP_819951.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90465.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 502 4574.2 Best-BlastP =>> nrprot 44 % Identities = 95/367 (25%), Positives = 164/367 (44%), Gaps = 55/367 (14%) reflZP_00089878.1 I COG1562: Phytoene / squalene synthetase [Azotobacter vinelandii] Length = 377 4577.2 Best- BlastP =>> nrprot 48% Identities = 101/231 (43%), Positives = 135/231 (58%), Gaps = 19/231 (8%) ref1NP_819994.1 I rare lipoprotein A family protein [Coxiella burnetii RSA 493 ] gbjAAO90508.1 J rare lipoprotein A family protein [Coxiella burnetii RSA 493] ngth = 261 4578.1 Best-BlastP =>> nrprot 80% Identities = 224/390 (57%), Positives = 314/390 (80%), Gaps = 1/390 (0%) ref1NP_819495.1I sodium / hydrogen antiporter family protein [Coxiella burnetii RSA 493] gbIAAO90009.1 I sodium / hydrogen antiporter family protein [Coxiella burnetii RSA 493] Length = 389 4559.1 4560.2 4564.2 4566.1 4567.2 457.2 Best-BlastP =>> nrprot 47% Identities = 93/334 (27%) , Positives = 164/334 (49%), Gaps = 18/334 (5%) refINP_819588: 1 DNA polymerase III, delta subunit [Coxiella burnetii RSA 493] gbjAA090102. 1 DNA polymerase III, delta subunit [Coxiella burnetii RSA 493] Length = Best-BlastP =>> nrprot 34% Identities = 41/110 (37%), Positives = 58/110 (52%), Gaps = 3/110 ( 2%) refINP_742951.11 inner membrane protein AmpE [Pseudomonas putida KT2440] gbJAAN66415.1 JAE016269_2 inner membrane protein AmpE [Pseudomonas putida KT2440] Length = 276 4581.2 Best-BlastP =>> nrprot 29% Identities = 22/97 (22%) , Positives = 39/97 (40%), Gaps = 1/97 (1%) refINP_820299.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAA090813.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 155 4584.3 Best -BlastP =>> nrprot No Hits found 4587.2 Best-BlastP =>> nrprot No Hits found 4588.2 Best-BlastP =>> nrprot No Hits found 4589.1 BestBlastP =>> nrprot No Hits found 459.3 Best-BlastP =>> nrprot 56% Identities = 76/212 (35%), Positives = 119/212 (56%), Gaps = 2/212 (0%) refINP_406133.1 J putative nicotinatenucleotide adenylyltransferase [Yersinia pestis] spIQ8ZDG1 JNADD_YERPE Probable nicot inate-nucleotide adenylyltransferase (Deamido-NAD (+) pyrophosphorylase) (Deamido-NAD (+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) pirIIACO318 probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) [imported] - Yersinia pestis ( strain C092) putative nicotinate-nucleotide adenylyltransferase [Yersinia pestis C092] Length = 220 Best-BlastP =>> nrprot 56% Identities = 57/130 (43%), Positives = 77/130 (59%), Gaps = 6/130 (4%) COG2764: Uncharacterized protein stored in bacteria [Pseudomonas fluorescens PfO-1] Length = 137 Best-BlastP =>> nrprot 71% Identities = 86/155 (55%), Positive = 113/155 (72%), Gaps = 4/155 (2%) refJZP_00109160.11 COG3865: Uncharacterized protein stored in bacteria [Nostoc punctiform] Length = 165 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 71% Identities = 132/248 (53%), Positives = 176/248 (70%), Gaps = 5/248 (2%) refINP_902034.1 J acetoacetyl-CoA redu ctase [Chromobacterium violaceum ATCC 12472] gbJAAQ60036.1 1 acetoacetyl-CoA reductase [Chromobacterium violaceum ATCC 12472] Length = 246 Best-BlastP =>> nrprot 78% Identities = 135/206 (65%), Positives = 169/206 (82%) %) refGZP_00024696.1 COG1484: DNA replication protein [Ralstonia metallidurans] Length = 268 Best-BlastP =>> nrprot 97% Identities = 220/236 (93%), Positive = 230/236 (97%) gblAAM08241.11 putative TraC protein [Legionella pneumophila] Length = 236 Best-BlastP =>> nrprot 53% Identities = 59/158 (37%), Positive = 95/158 (60%) refINP_819911.1 J colicin V production protein [Coxiella burnetii RSA 493] gbIAAO90425.1 colicin V production protein [Coxiella burnetii RSA 493] Length = 184 Best-BlastP =>> nrprot 52% Identities = 83/238 (34%), Positives = 128/238 (53%), Gaps = 27 / 238 (11%) refINP_932037.1 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTOI] emblCAE17256.1l unnamed protein product [Photorhabdus luminescens subsp. laumondii TTOI] Length = 255 458.3 4580.1 4590.1 4591.2 4597.1 4598.2 4599.2 46.1 460.2 4600.2 4601.1 Best-BlastP =>> nrprot No Hits found 4602.3 Best-BlastP =>> nrprot 99% Identities = 300/302 (99%), Positives = 302 / 302 (100%) embJCAC14311.1! putative transcriptional regulator [Legionella pneumophila] Length = 302 4604.3 Best-BlastP =>> nrprot 48% Identities = 48/182 (26%), Positives = 91/182 (50%), Gaps = 12/182 (6%) refINP_251679 .1 I hypothetical protein [Pseudomonas aeruginosa PA0I] pir11F83271 hypothetical protein PA2989 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG06377.11AE004724_6 hypothetical protein PA2989 [Pseudomonas aeruginosa PAOI] Length = 254 4607.2 Best-BlastP =>> nrprot 79% Identities = 265/421 (62%), Positive = 335/421 (79%) refIZP_00092427.11 hypothetical protein [Azotobacter vinelandii] Length = 838 4608.1 Best-BlastP =>> nrprot 33% Identities = 34/111 (30%), Positive = 60/111 (54%), Gaps = 3/111 (2%) refINP_700535. 11 hypothetical protein [Plasmodium falciparum 307] gbjAAN35259.1 1AE014830_3 hypothetical protein [Plasmodium falciparum 3D7] Length = 426 4609.2 Best-BlastP =>> nrprot No Hits found 4613.3 Best-BlastP =>> nrprot 48% Identities = 121/487 (24 %), Positives = 240/487 (49%), Gaps = 29/487 (5%) refJNP_753921.11 Hypothetical transporter ydgR [Escherichia coli CFT073] gbIAAN80486.11AE016761_61 Hypothetical transporter ydgR [Escherichia coli CFT073] Length = 500 4615.3 Best- BlastP =>> nrprot No Hits found 4616.2 Best-BlastP =>> nrprot 48% Identities = 93/315 (29%), Positives = 150/315 (47%), Gaps = 35/315 (11%) refINP_820641.1 I hypothetical protein [Coxiella burnetii RSA 493] gblAAO91155.11 hypothetical protein [Coxiella burnetii RSA 493] Length = 429 4618.1 Best-BlastP =>> nrprot 58% Identities = 110/250 (44%), Positives = 151/250 (60 %), Gaps = 7/250 (2%) dibjlBAB72031.1 Iipopolysaccharide biosynthesis glycosyltransferase [Photobacterium damselae subsp. piscicida] Length = 255 462.2 Best-BlastP =>> nrprot 44% Identities = 71/278 (25%), Positives = 116/278 (41%), Gaps = 35/278 (12%) refINP_718631.1 J conserved hypothetical protein [Shewanella oneidensis MR-1] gblAAN56075. 11AE015743_3 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 281 4620.1 Best-BlastP =>> nrprot 69% Identities = 49/91 (53%), Positives = 68/91 (74%) gb1AAP83334.1 1AF469614_2 unknown [Francisella tularensis subsp. tularensis] Length = 94 4623.2 Best-BlastP =>> nrprot 52% Identities = 66/169 (39%), Positives = 93/169 (55%), Gaps = 5/169 (2%) refINP_814807.1 I acetyltransferase, GNAT family [Enterococcus faecalis V583] gbIAAO80877.1 I acetyltransferase, GNAT family [Enterococcus faecalis V583] Length = 168 4625.2 Best-BlastP =>> nrprot 68% Identities = 162/307 (52%), Positives = 215/307 (70%) %), Gaps = 1/307 (0%) ref S_malonyltransferase [Vibrio vulnificus CMCP6] gb (AAO11337.11AE016807_56S-malonyltransferase [Vibrio vuinificus CMCP6] Length = 307 4626.1 Best-BlastP =>> nrprot 72% Identities = 172/314 (54%), Positives = 231/314 (73%), Gaps = 3/314 (0%) refINP_930069.11 3-oxoacyl- [acyl carrierprotein] synthase III (beta-ketoacyl-ACP synthase III (KAS III) [Photorhabdus luminescens subsp. Laumondii TTO1] EmbICAE15209.11 3oxoacyl- [acyl carrier-protein] synthase III (beta-ketoacyl-ACP synthase III) (KAS III) [Photorhabdus luminescens subsp. Laumondii TTOI] Length = 317 4627.2 Best-BlastP =>> n rprot 72% Identities = 183/330 (55%), Positives = 241/330 (73%), Gaps = 2/330 (0%) refINP 819526.1 J fatty acid / phospholipid synthesis PIsX protein [Coxiella burnetii RSA 493] spIQ83E401PLSX_COXBU Fatty acid / phospholipid synthesis protein plsX gbIAAO90040.11 fatty acid / phospholipid synthesis protein PIsX [Coxiella burnetii RSA 493] Length = 343 4628.2 Best-BlastP =>> nrprot 78% Identities = 45/55 (81%), Positive = 50/55 (90%) reflZP_00135404.1! COG0333: Ribosomal protein L32 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] refINP_873288.1 150S ribosomal protein L32 [Haemophilus ducreyi 35000HP] gbIAAP95677.1 J 50S ribosomal protein L32 [Haemophilus ducreyi 35000HP] Length = 56 4629.2 Best-BlastP =>> nrprot 33% Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 1/98 (1%) refJZP_00136314.1 J COG1399: Predicted metal-binding, possibly nucleic acid-binding protein [Pseudomonas aeruginosa UCBPP-PA14] Length = 148 463.2 Best-BlastP =>> nrprot No Hits found 4632.1 Best-BlastP =>> nrprot No Hits found 4633.2 Best-BlastP =>> nrprot 82% Identities = 121/184 (65%), Positives = 154/184 (83%) refINP_842482.1 J Uncharacterized protein family UPF0016 [Nitrosomonas europaea ATCC 19718] EmbJCAD86405.1 Uncharacterized protein family UPF0016 [Nitrosomonas europaea ATCC 19718] Length = 192 4634.2 Best-BlastP =>> nrprot 52% Identities = 222/716 (31%), Positives = 348/716 (48%), Gaps = 80/716 (11%) refINP924649.1 J probable peptidase [Gloeobacter violaceus] dbjIBAC89644.1 J gII1703 [Gloeobacter violaceus] Length = 7 4636.4 Best-BlastP =>> nrprot 4% Identities = 49/164 (29%), Positives = 74/164 (45%), Gaps = 12/164 (7%) refJZP_00009072.1 J hypothetical protein [Rhodopseudomonas palustris] Length = 275 464.2 Best-BlastP =>> nrprot 60% Identities = 167/405 (41%), Positives = 258/405 (63%), Gaps = 4/405 (0%) refINP_819909.1 J FoIC bifunctional protein [ Coxiella burnetii RSA 493] gbJAAO90423.1 I FoIC bifunctional protein [Coxiella burnetii RSA 493] Length = 416 4640.2 Best-BlastP =>> nrprot 74% Identities = 466/845 (55%), Positives = 627/845 (74%) , Gaps = 12/845 (1%) refINP_820057.1 MutS DNA mismatch repair protein [Coxiella burnetii RSA 493] gbJAAO90571.11 DNA mismatch repair MutS protein [Coxiella burnetii RSA 493] Length 4642.1 Best-BlastP =>> nrprot 63% Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 1/154 (0%) refJZP_00025457.11 COG1546: Uncharacterized protein (competence and mitomycin-induced) [Ralstonia metallidurans] Length = 200 4643.2 Best-BlastP =>> nrprot 56% Identities = 176/17 6 (100%), Positives = 176/176 (100%) emblCAC33483.1 hypothetical protein [Legionella pneumophila] Length = 176 4644.3 Best-BlastP =>> nrprot 41% Identities = 95/419 (22%), Positive = 174 / 419 (41%), Gaps = 31/419 (7%) refJZP_00071833.1 J hypothetical protein [Trichodesmium erythraeum IMS101] Length = 424 4645.2 Best-BlastP =>> nrprot 44% Identities = 96/328 (29%), Positive = 162/328 (49%), Gaps = 10/328 (3%) refJZP_00056223.1 COG0477: Permeases of the major superfamily facilitator [Magnetospirillum magnetotacticum] Length = 407 4647.2 Best-BlastP =>> nrprot 25% Identities = 54 / 234 (23%), Positives = 94/234 (40%), Gaps = 8/234 (3%) reflZ_00034418.1 I C0G0683: ABC-type branched-chain amino acid transport systems, periplasmic component [Burkholderia fungorum] Length = 451 4649.1 Best-BlastP =>> nrprot No Hits found 465.2 Best-BlastP =>> nrprot 75% Identities = 186/283 (65%), Positives = 222/283 (78%), Gaps = 3/283 (1 %) refINP_819908.1 I acetyl-CoA carboxylase, carboxyl transferase, beta sub nit [Coxiella burnetii RSA 493] gbIAAO90422.1 I acetyl-CoA carboxylase, carboxyl transferase, beta subunit [Coxiella burnetii RSA 493] Length = 291 4650.3 Best-BlastP =>> nrprot 45% Identities = 301/1302 (23%), Positive = 574/1302 (44%), Gaps = 91/1302 (6%) refINP_901766.1 Probable transmembrane protein [Chromobacterium violaceum ATCC 12472] gblAAQ59768. Probably transmembrane protein [Chromobacterium violaceum ATCC 12472] Length = 1272 4652.2 Best-BlastP =>> nrprot 62% Identities = 51/115 (44%), Positives = 79/115 (68%) refINP_353968.11 AGR_C_1731p [Agrobacterium tumefaciens] [Agrobacterium tumefaciens (strain C58, Cereon) gbIAAK86753.1I [AG] Agrobacterium tumefaciens str. C58 (Cereon)] Length = 190 4653.2 Best-BlastP =>> nrprot 26% Identities = 50/154 (32%), Positives = 79/154 (51%), Gaps = 17/154 (11%) refINP 440166.11 hypothetical protein [Synechocystis sp. PCC 6803] splP72831 lYC98 SYNY3 Hypothetical protein s1r1298 pir1IS74695 hypothetical protein s1r1298 - Synechocysti: sp. (strain PCC 6803) dbjjBAA16846.1I ORF_ID: slr1298 hypothetical protein [Synechocystis sp. PCC 6803] Length = 755 4655.3 Best-BlastP =>> nrprot 47% Identities = 130/460 (28%), Positives = 216/460 (46%), Gaps = 31/460 (6%) refINP_840264.1 j Outer efflux membrane protein [Nitrosomonas europaea ATCC 19718] embICAD84081.11 Outer efflux membrane protein [Nitrosomonas europaea ATCC 19718] Length = 516 4656.2 Best-BlastP =>> nrprot 26% Identities = 69/366 (18%), Positives = 161/366 (43%), Gaps = 26/366 (7%) refIXP_230851.21 similar to hypothetical protein [Rattus norvegicus] Length = 396 4657.1 Best-BlastP =>> nrprot 62% Identities = 94/202 (46%), Positives = 131/202 (64%), Gaps = 7/202 (3%) refINP_520142.11 PUTATIVE GSTRELATED PROTEIN [Ralstonia solanacearum] emblCAD15723.1 PUTATIVE GST-RELATED PROTEIN [Ralstonia solanacearum] Length = 230 4658.2 Best-BlastP =>> nrprot 75% Identities = 94/134 (70%), Positives = 105/134 (78%), Gaps = 1/134 (0%) refINP_105189.1 I organic hydroperoxide resistance protein [Mesorhizobium loti] dbjIBAB50975.1 I organic hydroperoxide resistance protein [Meso rhizobium loti] Length = 137 4659.2 Best-BlastP =>> nrprot No Hits found 4660.2 Best-BlastP =>> nrprot No Hits found 4662.1 Best-BlastP =>> nrprot No Hits found 4663.3 Best-BlastP =>> nrprot 98% Identities = 288/297 (96%), Positive = 294/297 (98%) pirlIA42596 major outer membrane protein - Legionella pneumophila gbIAAA25300.1 Major outer membrane protein Length = 297 4665.2 Best-BlastP =>> nrprot 45% Identities = 244 / 604 (40%), Positives = 363/604 (60%), Gaps = 38/604 (6%) refINP_715981.1 I sensory box protein [Shewanella oneidensis MR-1] gbIAAN53426.11AE015481_9 sensory box protein [Shewanella oneidensis MR -1] Length = 1515 4666.2 Best-BlastP =>> nrprot 53% Identities = 118/339 (34%), Positives = 174/339 (51%), Gaps = 44/339 (12%) refINP_720115.11 ribonuclease, T2 family [Shewanella oneidensis MR-1] gbjAAN57559.11AE015891_10 ribonuclease, T2 family [Shewanella oneidensis MR-1] Length = 4668.1 Best-BlastP =>> nrprot 25% Identities = 75/198 (37%), Positives = 112/198 (56%), Gaps 1/198 (0%) refIT 00054876.1 I hypothetical protein [Magnetospirillum magnetotacticum] Length = 626 4669.2 Best-BlastP =>> nrprot 76% Identities = 48/71 (67%), Positives = 55/71 (77%), Gaps = 1/71 (1% refINP_232566.1 I cold shock transcriptional regulator CspA [Vibrio cholerae 01 biovar eltor str. N16961] spIQ9KN00ICSPA_VIBCH Cold shock-like protein cspA pirlIG82492 cold shock transcription regulator CspA VCA0166 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF96079.1 j cold shock transcriptional regulator CspA [Vibrio cholerae 01 biovar eltor str. N16961] Length = 70 4671.3 Best-BlastP =>> nrprot 58% Identities = 131/353 (37%), Positives = 208/353 (58%), Gaps = 5/353 (1%) refINP_243998.1 I endo- 1,4-betaglucanase [Bacillus halodurans] pirlID84041 endo-1,4-beta-glucanase BH3132 [imported] - Bacillus halodurans (strain C-125) dbjIBAB06851.1J endo-1,4beta-glucanase [Bacillus halodurans] Length = 361 4672.1 Best-BlastP =>> nrprot 67% Identities = 119/224 (53%), Positives = 161/224 (71%), Gaps = 2/224 (0%) refgP_00131766.1 COG0220: Predicted Sadenosylmethionine-dependent methyltransferase [Haemophilus somnus 2336] Length = 251 4673.1 Best-BlastP =>> nrprot 83% Identities = 59/78 (75%), Positive = 66/78 (84%) refINP 439112.1 I ribosomal protein L28 [Haemophilus influenzae Rd] splP44364IRL28_HAEIN 50S ribosomal protein L28 pirIIE64104 ribosomal protein L28 - Haemophilus influenzae (strain Rd KW20) gbIAAC22612.1 I ribosomal protein L28 (rpL28) [Haemophilus influenzae Rd] Length = 78 4676.2 Best-BlastP =>> nrprot 73% Identities = 262/488 (53% ), Positives = 342/488 (70%), Gaps = 32/488 (6%) dbjIBAC93212.11 DNA-directed RNA polymerase specialized sigma subunit [Vibrio vulnificus YJ016] Length = 487 4678.3 Best-BlastP =>> nrprot No Hits found 468.3 Best-BlastP =>> nrprot 76% Identities = 81/121 (66%), Positives = 99/121 (81%) reflZP_00089152.11 COG0251: Putative translation initiation inhibitor, yjgF family [Azotobacter vinelandii] Length = 234 4680.2 Best-BlastP =>> nrprot 74% Identities = 129/219 (58%), Positive = 169/219 (77%) refINP642403.1 I ABC transporter ATP-binding protein [Xanthomonas axonopodis pv. citri str. 306] ABC transporter ATP-binding protein [Xanthomonas axonopodis pv.

  citri str. 306] Length = 227 4683.3 Best-BlastP =>> nrprot 73% Identities = 215/417 (51%), Positives = 305/417 (73%), Gaps = 5/417 (1%) refiNP_820008.1 I lipoprotein ABC transport, permease protein, putative [Coxiella burnetii RSA 493] gbIAAO90522.1 ABC lipoprotein transporter, permease protein, putative [Coxiella burnetii RSA 493] Length = 414 4688.2 Best-BlastP =>> nrprot 73% Identities = 199/352 (56% ), Positive = 275/352 (78%) refINP_643914.1 Type II secretion system protein-like protein [Xanthomonas axonopodis pv. citri str. The secretion system protein-like protein [Xanthomonas axonopodis pv. citri str. 306] Length = 377 469.3 Best-BlastP =>> nrprot 74% Identities = 411/703 (58%), Positives = 530/703 (75%), Gaps = 5/703 (0%) refINP_819346.11 guanosine-3 5-bis (diphosphate) 3-pyrophosphohydrolase [Coxiella burnetii RSA 493] gbJAAO89860.1 guanosine-3,5-bis (diphosphate) 3-pyrophosphohydrolase [Coxiella burnetii RSA 493] Length = 707 4690.2 Best-BlastP =>> nrprot 4 % Identities = 21/50 (42%), Positives = 31/50 (62%) refINP_055206.1 cardiac ankyrin repeat protein; cytokine inducible nuclear protein [Homo sapiens] pirlIA57291 cytokine inducible nuclear protein C193 - human embjCAA58676.1 nuclear protein [Homo sapiens] Length = 319 4691.2 Best-BlastP =>> nrprot 82% Identities = 279/413 (67%), Positive = 356/413 (86%), Gaps = 3/413 (0%) refINP670162.1 I probable serine carry [Yersinia pestis KIM] gbjAAM86413.1 probable JAE013888_9 serine carry [Yersinia pestis KIM] Length = 440 4692.5 Best-BlastP => > nrprot 71% Identities = 232/427 (54%), Positives = 316/427 (74%), Gaps = 3/427 (0%) refINP_820015.1 J adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coxiella burnetii RSA 493] gblAAO90529.11 adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coxiella burnetii RSA 493] Length = 442 4694.1 Best-BlastP =>> nrprot 59% Identities = 187/507 (36%), Positives = 297/507 (58%), Gaps = 30/507 (5%) refINP_616892.1 I serine-type D-Ala-D-Ala carboxypeptidase [Methanosarcina acetivorans str. C2A] gblAAM05372.1 I serine-type D-Ala-D-Ala carboxypeptidase [Methanosarcina acetivorans str. C2A] Length = 568 4695.1 Best-BlastP =>> nrprot No Nits found 4696.3 Best-BlastP =>> nrprot 31% Identities = 102/309 (33%), Positives = 170/309 (55%), Gaps = 8 / 309 (2%) refINP 461159.1 I putative membrane protein involved in resistance to lambda and N4 phages [Salmonella typhimurium LT2] gblAAL21118.1 putative membrane protein involved in resistance to lambda and N4 phages [Salmonella typhimurium LT2] Length = 518 4699.3 Best-BlastP =>> nrprot 85% Identities = 315/417 (75%), Positives = 364/417 (87%), Gaps = 5/417 (1%) refINP_793499.1 I ATP-dependent Clp protease, ATP-binding subunit CIpX [Pseudomonas syringae pv. tomato str. DC3000] gbJAAO57194.1 ATP-dependent Clp protease, ATP-binding subunit CIpX [Pseudomonas syringae pv. tomato str. DC3000] Length = 427 47.1 Best-BlastP =>> nrprot 97% Identity = 784/826 (94%), Positive = 806/826 (97%) gbIAAM08240.11 putative type IV secretion protein B4 [Legionella pneumophila] Length = 826 470.3 Best-BlastP =>> nrprot 88% Identities = 48/68 (70%), Positives = 60/68 (88%) refJZP_00085276.1 COG1758: DNA-directed RNA polymerase, K / omega subunit [Pseudomonas fluorescens PfO-1 ] Length = 87 4701.2 Best-BlastP =>> nrprot 58% Identities = 118/269 (43%), Positives = 163/269 (60%), Gaps = 14/269 (5%) refINP_819610.1 l conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90124.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 4702.1 Best-BlastP =>> nrprot 65% Identities = 96/188 (51%), Positives = 131/188 (69%) refINP_819608.1 I glycosyl transferase, group 2 family protein [Coxiella burnetii RSA 493] gblAAO90122.11 glycosyl transferase, group 2 family protein [Coxiella burnetii RSA 493] Length = 324 4703.2 Best-BlastP =>> nrprot 48% Identities = 53 / 118 (44%), P ositive = 79/118 (66%) refINP_900830.1 Probable glycosyl transferase [Chromobacterium violaceum ATCC 12472] gblAAQ58835.11 probable glycosyl transferase [Chromobacterium violaceum ATCC 12472] Length = 335 4704.2 Best-BlastP =>> nrprot 56% Identities = 81 / 220 (36%), Positives = 127/220 (57%), Gaps = 3/220 (1%) refGZP_00021591.1 COG3376: Highaffinity nickel permease [Ralstonia metallidurans] Length = 278 Best-BlastP =>> nrprot 31 % Identities = 55/205 (26%), Positives = 94/205 (45%), Gaps = 29/205 (14%) refINP_052786.1 J pXO1-90 [Bacillus anthracis] refINP_652888.1I S-layer protein, ( pXO1-90) [Bacillus anthracis str. A2012] pir1IB59102 hypothetical protein pXO1-90 - Bacillus anthracis virulence plasmid pXO1 gblAAD32394.11 pXO1-90 [Bacillus anthracis] gbJAAM26077.11 S-layer protein, (pXO1-90) [Bacillus anthracis str. A2012] Length = 652 Best-BlastP =>> nrprot 86% Identities = 106/141 (75%), Positive = 123/141 (87%) dbjIBAC55152.1 I nucleoside diphosphate kinase. [Halomonas sp. # 593] Length = 141 Best-BlastP =>> nrprot 73% Identities = 213/358 (59%), Positives = 281/358 (78%), Gaps = 1/358 (0%) refINP_274327. 1 J conserved hypothetical protein [Neisseria meningitidis MC58] pir1IB81098 conserved hypothetical protein NMB1308 [imported] - Neisseria meningitidis (strain MC58 serogroup B) gblAAF41683.11 conserved hypothetical protein [Neisseria meningitidis MC58] Length = 364 Best-BlastP =>> nrprot 40% Identities = 70/205 (34%), Positives = 107/205 (52%) refINP_231252.1 fimbrial biogenesis and twitching motility protein, putative [Vibrio cholerae 01 biovar eltor str. N16961] pirlifl82178 probable fimbrial biogenesis and twitching motility protein VC1612 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbJAAF94766.11 fimbrial biogenesis and twitching motility protein, putative [Vibrio cholerae 01 biovar eltor str. N16961] Length = 237 4711. 1 Best-BlastP =>> nrprot 41% Identities = 42/159 (26%), Positives = 78/159 (49%), Gaps = 21/159 (13%) refINP_820244.1 DNA -binding protein, putative [Coxiella burnetii RSA 493] gbJAAO90758.11 DNA-binding protein, putative [Coxiella burnetii RSA 493] Length = 203 4712.2 Best-BlastP =>> nrprot 71% Identities = 250/418 (59%), Positive = 306/418 (73%), Gaps = 2/418 (0%) COG0124: Histidyl-tRNA synthetase [Azotobacter vinelandii] Length = 428 4713.1 Best-BlastP =>> nrprot No Hits found 4714.1 Best-BlastP =>> nrprot 47% Identities = 102/310 (32%), Positives = 159/310 (51%), Gaps = 5/310 (1%) refINP_800300.1 J putative YhfP protein [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC62133. 1 J putative YhfP protein [Vibrio parahaemolyticus] Length = 334 4715.3 Best-BlastP =>> nrprot 48% Identities = 43/158 (27%), Positives = 80/158 (50%), Gaps = 7/158 (4% ) ref! ZP_00084605.11 hypothetical protein [Pseudomonas fluorescens PfO-1] Length = 171 4716.2 Best-BlastP = >> nrprot 48% Identities = 88/323 (27%), Positive = 162/323 (50%), Gaps = 34/323 (10%) ReflZP 00144869.1 l Magnesium and cobalt transport protein cora [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gbJEAA23536.1 Magnesium and cobalt transport protein cora [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 351 4718.1 Best-BlastP =>> nrprot No Hits found 4719.2 Best-BlastP =>> nrprot 42% Identities = 149/405 (36%), Positives = 217/405 (53%), Gaps = 35/405 (8%) pir1IT03487 potential multicopper oxidase - Rhodobacter capsulatus gblAAC16140.1! potential multicopper oxidase [Rhodobacter capsulatus] Length = 491 472.1 Best-BlastP =>> nrprot 73% Identities = 107/205 (52%), Positives = 155/205 (75%) refINP_819344.11 guanylate kinase [Coxiella burnetii RSA 493] gblAAO89858.1 I guanylate kinase [Coxiella burnetii RSA 493] Length = 206 4705.3 4706.3 4709.1 4710.1 Best-BlastP =>> nrprot 70% Identities = 91/161 (56%), Positives = 125/161 (77%), Gaps = 1/161 (0%) refINP 440118.1! spore ripening protein A [Synechocystis sp. PCC 6803] pir11S74646 spore ripening protein A - Synechocystis sp. (strain PCC 6803) dbjIBAA16798.1 spore ripening protein A [Synechocystis sp. PCC 6803] Length = 182 BestBlastP =>> nrprot 70% Identities = 98/199 (49%), Positives = 142/199 (71%), Gaps = 5/199 (2%) refINP_440119.1 spore maturation protein B [ Synechocystis sp. PCC 6803] IS74647 spore maturing protein B Synechocystis sp. (strain PCC 6803) dbjIBAA16799.1 spore ripening protein B [Synechocystis sp. PCC 6803] Length = 217 4725.2 Best-BlastP =>> nrprot 31% Identities = 73/267 (27%), Positives = 111/267 (41%), Gaps = 62/267 (23%) refINP_230974.1 I hypothetical VC1330 protein [Vibrio cholerae 01 biovar eltor str. N16961] pir! 1B82212 hypothetical protein VC1330 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gb! AAF94488.1 J hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 275 4726.1 Best-BlastP =>> nrprot No Hits found 4727.1 Best-BlastP =>> nrprot 42% Identities = 43/76 (56%), Positives = 57/76 (75%) refiZP_00101887.1 j COG5394 : Uncharacterized protein conserved in bacteria [Desulfitobacterium hafniense] Length = 107 4729.3 Best-BlastP =>> nrprot 64% Identities = 111/246 (45%), Positives = 161/246 (65%), Gaps = 1/246 (0) %) refINP_902034.1 Acetoacetyl-CoA reductase [Chromobacterium violaceum ATCC 12472] Acetacetyl-CoA reductase [Chromobacterium violaceum ATCC 12472] Length = 246 473.2 Best-BlastP =>> nrprot 63% Identities = 122/288 (42%), Positives = 183/288 (63%) refINP_229866.1I conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] pir! IC82350 conserved hypothetical protein VCO209 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gb! AAF93385.11 conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 4732.3 Best-BlastP =>> nrprot 33% Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 17/96 (17%) dbjIBAA89216.1! soluble cytochrome cA [Shewanella violacea] Length = 85 4733.2 Best-BlastP =>> nrprot 71% Identities = 154/296 (52%), Positives = 210/296 (70%), Gaps = 8/296 (2%) refINP820374 .1! translation elongation factor Ts [Coxiella burnetii RSA 493] spIQ9X5U9! EFTS_COXBU Elongation factor Ts (EF-Ts) gblAAD33343. 11AF127534_2 elongation factor Ts [Coxiella burnetii] AAO90888.11 translation elongation factor Ts [Coxiella burnetii RSA 493] Length = 296 4734.2 Best-BlastP =>> nrprot 65% Identities = 134/341 (39%), Positive = 213 / 341 (62%), Gaps = 16/341 (4%) refINP_439856.1 hypothetical protein [Haemophilus influenzae Rd] spIP45339IYJEQ_HAEIN Hypothetical protein HI1714 pir! IB64176 hypothetical protein HI1714 Haemophilus influenzae (strain Rd KW20) gblAAC23359.1! conserved hypothetical protein [Haemophilus influenzae Rd] Length = 346 4736.2 Best-BlastP =>> nrprot 70% Identities = 219/403 (54%), Positives = 289/403 (71%), Gaps = 2/403 (0%) refINP_232075.1! tRNA nucleotidyltransferase [Vibrio cholerae 01 biovar eltor str. N16961] pir! ID82076 tRNA nucleotidyltransferase VC2446 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF95588.1 1 tRNA nucleotidyltransferase [Vibrio cholerae 01 biovar eltor str.

  N16961] Length = 403 4737. 1 Best-BlastP =>> nrprot 79% Identities = 122/178 (68%), Positives = 149/178 (83%) refIZP_00066572. 1! COG1949: Oligoribonuclease (3 '-> 5' exoribonuclease) [Microbulbifer degradans 2-40] Length = 185,421. 2 4724. 2 4739. 1 Best-BlastP =>> nrprot 81% Identifies = 156/208 (75%), Positives = 180/208 (86%) reflNP_841903. 1 I DUF208 [Nitrosomonas europaea ATCC 19718] emblCAD85792. 1 I DUF208 [Nitrosomonas europaea ATCC 19718] Length = 215,474. 2 Best-BlastP =>> nrprot 44% Identities = 24/107 (22%), Positives = 49/107 (45%) refINP_878011. 1 transposase [Staphylococcus aureus] spjQ06238jTNP6_ENTFC Transposase for transposon Tn1546 pirjlA40628 probable transposase - Enterococcus faecium transposon Tn1546 gb! AAA65951.  11 transposase [Enterococcus faecium] gbIAAQ17155. 1 Tn1546 transposase [Staphylococcus aureus] Length = 988 4740. 2 Best-BlastP =>> nrprot 62% Identities = 137/287 (47%), Positives = 193/287 (67%), Gaps = 1/287 (0%) refINP_478257. 11 cation efflux system protein [Nostoc sp.  PCC 7120] pirIIAG2540 cation efflux system protein [imported] - Nostoc sp.  (strain PCC 7120) plasmid pCC7120beta dbjIBAB77253. 1! cation efflux system protein [Nostoc sp.  PCC 7120] Length = 304 to 4742. 3 Best-BlastP =>> nrprot 48% Identities = 85/305 (27%), Positives = 148/305 (48%), Gaps = 14/305 (4%) reflNP 759924. 1! Transcriptional regulator [Vibrio vulnificus CMCP6] gblAAO09451. 11AE016800_56 Transcriptional regulator [Vibrio vulnificus CMCP6] dbjIBAC95964. 1 transcriptional regulator [Vibrio vulnificus YJ016] Length = 313 4744. 3 Best-BlastP =>> nrprot 40% Identities = 66/257 (25%), Positives = 119/257 (46%), Gaps = 35/257 (13%) reflZP_00143092. 1 I hypothetical protein [Rickettsia sibirica] gblEAA26501. 11 unknown [Rickettsia sibirica] Length = 290 4746. 1 Best-BlastP =>> nrprot 52% Identities = 34/80 (42%), Positives = 48/80 (60%), Gaps = 3/80 (3%) reflNP_799393. 1 putative signal peptide protein [Vibrio parahaemolyticus RIMD 2210633] dbj! BAC61277. I putative signal peptide protein [Vibrio parahaemolyticus] Length = 86 4748. 1 Best-BlastP =>> nrprot 71% Identities = 145/246 (58%), Positives = 182/246 (73%), Gaps = 2/246 (0%) refIZP_00028198. COG4689: Acetoacetate decarboxylase [Burkholderia fungorum] Length = 442 4749. 2 Best-BlastP =>> nrprot 39% Identities = 206/416 (49%), Positives = 284/416 (68%), Gaps = 3/416 (0%) refINP_386185. 1 I PUTATIVE NADH DEHYDROGENASE TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] emb1CAC46658.  1 I PUTATIVE NADH DEHYDROGENASE TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] Length = 422,475. 1 Best-BlastP =>> nrprot No Hits found 4751. 2 Best-BlastP =>> nrprot 44% Identities = 161/483 (33%), Positives = 245/483 (50%), Gaps = 72/483 (14%) gbJAAN78225. 1 J class 4 metalloprotease [Chromobacterium violaceum] Length = 489 4752. 2 Best-BlastP =>> nrprot 60% Identities = 120/275 (43%), Positives = 180/275 (65%) refIZP_00029901. COG0697: Permeases of the drug / metabolite transporter (DMT) superfamily [Burkholderia fungorum] Length = 341 4754. 1 Best-BlastP =>> nrprot No Hits found 4755. 2 Best-BlastP =>> nrprot 58% Identities = 74/170 (43%), Positives = 109/170 (64%) refINP_310486. 1 l hypothetical protein [Escherichia coli O157: H7] pir11C90936 hypothetical protein ECs2459 [imported] - Escherichia coli (strain O157: H7, substrate RIMD 0509952) dbjIBAB35882. 1 I hypothetical protein [Escherichia coli O157: H7] Length = 182 4757. 2 Best-BlastP =>> nrprot 53% Identities = 60/192 (31%), Positives = 105/192 (54%), Gaps = 3/192 (1%) refJZP_00111879. COG0259: Pyridoxamine phosphate oxidase [Nostoc punctiform] Length = 214 4758. 2 Best-BlastP =>> nrprot 51% Identities = 44/92 (47%), Positives = 66/92 (71%) ref1NP926536. 11 unknown protein [Gloeobacter violaceus] dbjIBAC91531. 1 I gsI3590 [Gloeobacter violaceus] Length = 98 4759. 2 Best-BlastP =>> nrprot 70% Identities = 142/258 (55%), Positives = 181/258 (70%), Gaps = 5/258 (1%) refINP_863091. 1 I putative oxidoreductase [Pseudomonas putida] gblAAO64293. 1 putative oxidoreductase [Pseudomonas putida] gbiAAP44207. 1 putative dehydrogenase [Pseudomonas sp.  ND6] Length = 257 4760. 2 Best-BlastP =>> nrprot No Hits found 4763. 2 Best-BlastP =>> nrprot 52% Identities = 133/408 (32%), Positives = 219/408 (53%), Gaps = 23/408 (5%) refINP_903521. Probable prophage integrase [Chromobacterium violaceum ATCC 12472] gbJAAQ61513. Probable prophage integrase [Chromobacterium violaceum ATCC 12472] Length = 423 4764. 2 Best-BlastP =>> nrprot No Hits found 4766. 2 Best-BlastP =>> nrprot 74% Identities = 80/144 (55%), Positives = 108/144 (75%), Gaps = 1/144 (0%) refINP_820296. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] gbJAAO90810. 1 J conserved hypothetical protein [Coxiella burnetii RSA 493] Length = Best-BlastP =>> nrprot 62% Identities = 36/93 (38%), Positives = 57/93 (61%), Gaps = 3/93 (3% ) refINP_273838. 11 conserved hypothetical protein [Neisseria meningitidis MC58] refINP_283783. Hypothetic protein NMA1005 [Neisseria meningitidis Z2491] spIQ9JRC2JYA05_NEIMA Hypothetical protein NMA1005 / NMB0796 pirJIC81157 conserved hypothetical protein NMB0796 [imported] - Neisseria meningitidis (strain MC58 serogroup B, strain Z2491 serogroup A) gbJAAF41209. 1 j conserved hypothetical protein [Neisseria meningitidis MC58] embJCAB84274. 1I hypothetical protein NMA1005 [Neisseria meningitidis Z2491] Length = 92 Best-BlastP =>> nrprot 52% Identities = 35/101 (34%), Positives = 62/101 (61%), Gaps = 12/101 (11%) refJZP_00022930. 1 J COG2913: SmaII protein A (tmRNA binding) [Ralstonia metallidurans] Length = 159 Best-BlastP =>> nrprot 99% Identities = 135/136 (99%), Positives = 136/136 (100%) spJQ48835JFUR_LEGPN Ferric uptake regulation protein (Ferric uptake regulator) gblAAA19656. 1 J Fur Length = 136 Best-BlastP =>> nrprot 68% Identities = 25/46 (54%), Positives = 33/46 (71%), Gaps = 3/46 (6%) EmbJCAB87569. 1 J FIdC protein [Sphingomonas sp.  LB126] Length = 533 Best-BlastP =>> nrprot 26% Identities = 65/166 (39%), Positives = 94/166 (56%), Gaps = 7/166 (4%) refINP_907052. 1 COMPONENTS OF SENSORY TRANSDUCTION SYSTEM [Wolinella succinogenes] embJCAE09952. Length = 407 Best-BlastP =>> nrprot 77% Identities = 292/461 (63%), Positives = 362/461 (78%) refJZP 00015785. 1 J hypothetical protein [Rhodospirillum rubrum] spIQ59765IPNTB_RHORU NAD (P) transhydrogenase subunit beta (Pyridine nucleotide transhydrogenase subunit beta) (Nicotinamide nucleotide transhydrogenase subunit beta) (Proton-translocating transhydrogenase NADP (H) -binding component) (called!) GbJAAC43257. 1 nicotinamide nucleotide transhydrogenase, subunit beta gbJAAA62495. 1 J proton-translocating nicotinamide nucleotide transhydrogenase subunit PntB prfIJ2102322C energy-transducing nicotinamide nucleotide transhydrogenase: Length = 464 Best-BlastP =>> nrprot 74% Identities = 61/91 (67%), Positives = 74/91 (81%) refINP_840934 . 1 J likely transmembrane NAD (P) transhydrogenase (alpha subunit part 2) [Nitrosomonas europaea ATCC 19718] embICAD84771. Probably transmembrane NAD (P) transhydrogenase (alpha subunit part 2) [Nitrosomonas europaea ATCC 19718] Length = 102 4767. 2 4768. 1 4769. 1 4770. 1 4771. 2 4773. 3 4774. 1 4775. 2 Best-BlastP =>> nrprot 66% Identities = 179/361 (49%), Positives = 250/361 (69%), Gaps = 9/361 (2%) refJNP_840933. Alanine dehydrogenase and pyridine nucleotide transhydrogenase [Nitrosomonas europaea ATCC 19718] embJCAD84770. Alanine dehydrogenase and pyridine nucleotide transhydrogenase [Nitrosomonas europaea ATCC 19718] Length = 375 4776. 3 Best-BlastP =>> nrprot 51% Identities = 59/146 (40%), Positives = 89/146 (60%), Gaps = 8/146 (5%) refJZP_00111831. COG2340: Uncharacterized Protein with SCP / PR1 domains [Nostoc punctiform] Length = 182 4777. 2 Best-BlastP =>> nrprot No Hits found 4778. 1 Best-BlastP =>> nrprot No Hits found 4779. 1 Best-BlastP =>> nrprot 62% Identities = 68/152 (44%), Positives = 93/152 (61%), Gaps = 4/152 (2%) refJZP_00125177. 1 COG2153: Predicted acyltransferase [Pseudomonas syringae pv.  syringae B728a] Length = 152 4780. 2 Best-BlastP =>> nrprot No Hits found 4782. 3 Best-BlastP =>> nrprot 99% Identities = 359/363 (98%), Positives = 362/363 (99%) embICAB65197. 1 I hypothetical protein [Legionella pneumophila] Length = 363 4785. 1 Best-BlastP =>> nrprot No Hits found 4786. 2 Best-BlastP =>> nrprot 52% Identities = 159/409 (38%), Positives = 250/409 (61%), Gaps = 8/409 (1%) refJNP_819388. 11 d-xylose-proton symporter, putative [Coxiella burnetii RSA 493] gblAAO89902. 1 l d-xylose-proton symporter, putative [Coxiella burnetii RSA 493] Length 4788. 3 Best-BlastP =>> nrprot 98% Identities = 200/204 (98%), Positives = 201/204 (98%) splP50024IDSBA_LEGPN THIOL: DISULFIDE INTERCHANGE PROTEIN DSBA PRECURSOR gb1AAA67725. 1! disulfide bond forming protein Length = 204,490. 3 Best-BlastP =>> nrprot 77% Identities = 278/425 (65%), Positives = 336/425 (79%), Gaps = 1/425 (0%) ref! NP_820750. ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] gbIAAO91264. ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] Length = 432 4791. 3 Best-BlastP =>> nrprot 35% Identities = 37/91 (40%), Positives = 47/91 (51%) pirlJA71007 hypothetical protein PH1351 - Pyrococcus horikoshii dbjIBAA30457. 1 1101aa long hypothetical protein [Pyrococcus horikoshii] Length = 101 4793. 2 Best-BlastP =>> nrprot 75% Identities = 306/545 (56%), Positives = 412/545 (75%) refJNP_820751. 1 J ABC carry, permease protein [Coxiella burnetii RSA 493] gblAAO91265. ABC transporter, permease protein [Coxiella burnetii RSA 493] Length = 581 4795. 1 Best-BlastP =>> nrprot No Hits found 4796. 1 Best-BlastP =>> nrprot 25% Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 12/70 (17%) reflNP_650587. 1 day CG5225-PA [Drosophila melanogaster] gbIAAF55377. CG5225-PA [Drosophila melanogaster] Length = 594 4797. 1 Best-BlastP =>> nrprot 91% Identities = 293/351 (83%), Positives = 324/351 (92%) refJNP_820537. 1! ribonucleoside diphosphate reductase, beta subunit [Coxiella burnetii RSA 493] gbjAAO91051. Ribonucleoside-diphosphate reductase, beta subunit [Coxiella burnetii RSA 493] Length = 401 48. 1 Best-BlastP =>> nrprot 98% Identities = 90/93 (96%), Positives = 93/93 (100%) embICAB60052. 1! IvhB3 [Legionella pneumophila] gbjAAM08239. 1 putative type IV secretion protein B3 [Legionella pneumophila] Length = 93 Best-BlastP =>> nrprot 88% Identities = 373/475 (78%), Positives = 428/475 (90%), Gaps = 1/475 ( 0%) refINP_820349. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAA090863. 1 = conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 480 Best-BlastP =>> nrprot 61% Identities = 102/252 (40%), Positives = 160/252 (63%), Gaps = 1/252 (0% ) refIZP_00110131. 1I COGO300: Shortchain dehydrogenases of various substrate specificities [Nostoc punctiform] Length = 270 Best-BlastP =>> nrprot 33% Identities = 31/122 (25%), Positives = 56/122 (45%), Gaps = 24/122 (19%) reflZP_00026008. 1J COG4970: Tfp pilus assembly protein FimT [Ralstonia metallidurans] Length = 222 Best-BlastP =>> nrprot 31% Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 7/110 ( 6%) refIOT 00030895. 1! COG3161: 4-hydroxybenzoate synthetase (Chorismate lyase) [Burkholderia fungorum] Length = 227 Best-BlastP =>> nrprot 79% Identities = 148/247 (59%), Positives = 197/247 (79%) refINP_793605. 13oxoacyl- (acyl-carrier-protein) reductase [Pseudomonas syringae pv.  tomato str.  DC3000] gbJAA057300. 3-oxoacyl- (acyl-carrier-protein) reductase [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 247 Best-BlastP =>> nrprot 84% Identities = 65/73 (89%), Positive = 70/73 (95%) pirlIT12021 acyl carrier protein - Pseudomonas aeruginosa gblAAB94392. 1 Acyl carrier protein [Pseudomonas aeruginosa] Length = 78,4805. 1 Best-BlastP =>> nrprot 78% Identities = 258/411 (62%), Positives = 325/411 (79%) refINP_251655. 1 beta-ketoacyl-acyl carrier protein synthase II [Pseudomonas aeruginosa PAOI] pirIIT12022 3-oxoacyl- [acyl-carrier-protein] synthase (EC 2. 3. 1. 41) II - Pseudomonas aeruginosa gblAAB94396. 11-oxoacyl-acyl carrier protein synthase II [Pseudomonas aeruginosa] gbIAAGO6353. 1AE004722_9 betaketoacyl-acyl carrier protein synthase II [Pseudomonas aeruginosa PAOI] Length = 414 4806. 4 Best-BlastP =>> nrprot 60% Identifies = 127/330 (38%), Positives = 200/330 (60%), Gaps = 14/330 (4%) refINP_819532. 1 I conserved hypothetical protein TIGR00247 [Coxiella burnetii RSA 493] gblAA090046. 11 = TSCR00247 [Coxiella burnetii RSA 493] Length = 370 4809. 2 Best-BlastP =>> nrprot 46% Identities = 85/287 (29%), Positives = 130/287 (45%), Gaps = 15/287 (5%) ref] ZP_00013543. 11 hypothetical protein [Rhodospirillum rubrum] Length = 352 481. 1 Best-BlastP =>> nrprot 57% Identities = 62/150 (41%), Positives = 88/150 (58%) refI NP 298766. 1 I conserved hypothetical protein [Xylella fastidiosa 9a5c] pir1IH82676 conserved hypothetical protein XF1477 [imported] - Xylella fastidiosa (strain 9a5c) gbIAAF84286. 1 jAE003977_9 conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 153 4810. 1 Best-BlastP =>> nrprot No Nits found 4811. 2 Best-BlastP =>> nrprot 67% Identities = 89/163 (54%), Positives = 110/163 (67%), Gaps = 1/163 (0%) refINP_404518. 1 putative membrane protein [Yersinia pestis] pirlIAE0110 probable membrane protein YPO0899 [imported] - Yersinia pestis (strain C092) embJCAC89744. 1 d putative protein membrane [Yersinia pestis C092] Length = 165 4813. 2 Best-BlastP =>> nrprot 63% Identifies = 161/389 (41%), Positives = 246/389 (63%), Gaps = 4/389 (1%) gbIAAD47247. 1 putative transport protein [Legionella pneumophila] Length = 387 4814. 2 Best-BlastP =>> nrprot 65% Identities = 101/199 (50%), Positives = 138/199 (69%), Gaps = 5/199 (2%) refINP_820137. 11 enhanced entry protein EnhA, putative [Coxiella burnetii RSA 493] gbJAA090651. EnhA, putative [Coxiella burnetii RSA 493] Length = 248,480. 3 4800. 2,481. 1 4802. 2,4803. 2,4804. 1 4815. 2 Best-BlastP =>> nrprot 59% Identities = 56/115 (48%), Positives = 82/115 (71%), Gaps = 1/115 (0%) REFINP 883806. 1 I flagellar protein FUS [Bordetella parapertussis] embICAE36818. 1 l flagellar protein FUS [Bordetella parapertussis] Length = 142 4817. 4 Best-BlastP =>> nrprot No Hits found 4818. 3 Best-BlastP =>> nrprot No Hits found 4819. 2 Best-BlastP =>> nrprot 40% Identities = 70/290 (24%), Positives = 129/290 (44%), Gaps = 13/290 (4%) gblAAF20289. 1 jAFI21266_11 malonyl-CoA; ACP transacylase MdcG [Acinetobacter calcoaceticus] Length = 307482. 2 Best-BlastP =>> nrprot 62% Identities = 257/538 (47%), Positives = 363/538 (67%), Gaps = 9/538 (1%) gb! AAM48100. 1AF353205_1 polybeta-hydroxybutyrate synthase [Azospirillum brasilense] Length = 618 4821. 2 Best-BlastP =>> nrprot 44% Identities = 79/266 (29%), Positives = 125/266 (46%), Gaps = 34/266 (12%) refINP 440042. Alkaline phosphatase [Synechocystis sp.  PCC 6803] pirjjS74570 alkaline phosphatase (EC 3. 1. 3. 1) phoA - Synechocystis sp.  (strain PCC 6803) dbjIBAA16722. Alkaline phosphatase [Synechocystis sp.  PCC 6803] Length = 326 4822. 3 Best-BlastP =>> nrprot 35% Identities = 73/276 (26%), Positives = 119/276 (43%), Gaps = 37/276 (13%) refJZP_00123112. 11 hypothetical protein [Haemophilus somnus 129PT] Length = 308 4826. 2 Best-BlastP =>> nrprot 49% Identities = 64/203 (31%), Positives = 115/203 (56%), Gaps = 11/203 (5%) refINP819961. 11 hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90475. 1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 227 Best-BlastP =>> nrprot 26% Identities = 39/135 (28%), Positives = 80/135 (59%) reflZP_00060561. 11 hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 902 Best-BlastP =>> nrprot 33% Identities = 44/162 (27%), Positives = 85/162 (52%), Gaps = 4/162 (2%) refINP_149698. 1 J 235L [Invertebrate iridescent virus 6] gbIAAK82096.  11AF303741_235 235L [Chilo iridescent virus] Length = 265 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 67% Identities = 101/174 (58%), Positives = 135/174 (77%) refZeP 00126146 . COG1187: 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Pseudomonas syringae pv.  syringae B728a] Length = 210 4836. 1 Best-BlastP =>> nrprot 48% Identities = 45/135 (33%), Positives = 79/135 (58%) refINP_743096. 1 rod shape-determination protein MreD [Pseudomonas putida KT2440] gbJAAN66560. 1 JAE016284_8 rod shape-determining protein MreD [Pseudomonas putida KT2440] Length = 163 4837. 1 Best-BlastP =>> nrprot 63% Identities = 116/273 (42%), Positives = 178/273 (65%), Gaps = 3/273 (1%) refINP 820453. 1 (rod shaped determination protein MreC [Coxiella burnetii RSA 493] gbJAAO90967. MreC [Coxiella burnetii RSA 493] Length = 292 4841. 2 Best-BlastP =>> nrprot 92% Identities = 287/348 (82%), Positives = 320/348 (91%), Gaps = 3/348 (0%) refINP_820454. MreB [Coxiella burnetii RSA 493] 1 g rod shapedetermining protein gblAAO90968. 1 rod shaped determining protein MreB [Coxiella burnetii RSA 493] Length = 352 4844. 2 Best-BlastP =>> nrprot No Hits found 4845. 4 Best-BlastP =>> nrprot 22% Identities = 67/290 (23%), Positives = 129/290 (44%), Gaps = 34/290 (11%) refJZP_00036809. COG0419: ATPase involved in DNA repair [Enterococcus faecium] Length = 1042 4830. 2 4833. 2 4834. 4835. 4847. 2 Best-BlastP =>> nrprot No Hits found 4848. 3 Best-BlastP =>> nrprot 52% Identities = 116/301 (38%), Positives = 178/301 (59%), Gaps = 1/301 (0%) reflZP_00053871. COG0845: Membrane fusion protein [Magnetospirillum magnetotacticum] Length = 335,485. 3 Best-BlastP =>> nrprot 41% Identities = 106/439 (24%), Positives = 199/439 (45%), Gaps = 41/439 (9%) refINP_932208. I putative conjugative transfer protein TraB [Vibrio vulnificus YJ016] dbj (BAC97731. 11 putative conjugative transfer protein TraB [Vibrio vulnificus YJ016] Length = 603 4850. 2 Best-BlastP =>> nrprot No Hits found 4851. 2 Best-BlastP =>> nrprot 67% Identities = 89/161 (55%), Positives = 109/161 (67%), Gaps = 2/161 (1%) refIZP_00054128. COG3837: Uncharacterized conserved protein, contains double-stranded beta-helix domain [Magnetospirillum magnetotacticum] Length = 180 4855. 2 Best-BlastP =>> nrprot 80% Identities = 67/91 (73%), Positives = 79/91 (86%) refINP_717690. 1 integration host factor, alpha subunit [Shewanella oneidensis MR-1] gblAAN55134. 11AE015650_4 integration host factor, subunit alpha [Shewanella oneidensis MR-1] Length = 98 4856. 2 Best-BlastP =>> nrprot 67% Identities = 51/100 (51%), Positives = 72/100 (72%) refINP_841896. 1! putative ferredoxin 2fe-2s protein [Nitrosomonas europaea ATCC 19718] embJCAD85785. 1 putative ferredoxin 2fe-2s protein [Nitrosomonas europaea ATCC 19718] Length = 102 4859. 2 Best-BlastP =>> nrprot No Hits found 486. 2 Best-BlastP =>> nrprot No Hits found 4860. 1 Best-BlastP =>> nrprot No Hits found 4863. 4 Best-BlastP =>> nrprot 69% Identities = 220/430 (51%), Positives = 294/430 (68%), Gaps = 13/430 (3%) refINP 406861. Poly (A) polymerase [Yersinia pestis] pirIIA10412 polynucleotide adenylyltransferase (EC 2. 7.  7. 19) [imported] - Yersinia pestis (strain CO92) embyCAC92629. Poly (A) polymerase [Yersinia pestis CO92] Length = 440,464. 2 Best-BlastP =>> nrprot 66% Identities = 62/131 (47%), Positives = 88/131 (67%) refINP_735626. I Unknown [Streptococcus agalactiae NEM316] embICAD46839. 1 J Unknown [Streptococcus agalactiae NEM316] Length = 162 4865. 2 Best-BlastP =>> nrprot 58% Identities = 48/146 (32%), Positives = 83/146 (56%), Gaps = 12/146 (8%) refINP_841101. 1 Universal stress protein (Usp) [Nitrosomonas europaea ATCC 19718] embICAD84939. 1! Universal stress protein (Usp) [Nitrosomonas europaea ATCC 19718] Length = 148 4867. 2 Best-BlastP =>> nrprot 62% Identities = 209/445 (46%), Positives = 293/445 (65%), Gaps = 3/445 (0%) ref] ZP_00025176. COG 1012: NAD-dependent aldehyde dehydrogenases [Ralstonia metallidurans] Length = 520 4868. 2 Best-BlastP =>> nrprot 72% Identities = 155/269 (57%), Positives = 197/269 (73%), Gaps = 1/269 (0%) pir! IT34105 hypothetical protein C17G10.  8 - Caenorhabditis elegans Length = 938 4869. 3 Best-BlastP =>> nrprot 75% Identities = 90/139 (64%), Positives = 108/139 (77%) refINP_540374. 1 RIBONUCLEASE HI [Brucella melitensis] refINP_697505. 1 ribonuclease H [Brucella suis 1330] spIQ8YFR3IRNH_BRUME Ribonuclease H (RNase H) pirJIAC3434 calf thymus ribonuclease H (EC 3. 1.  26. 4) [imported] - Brucella melitensis (strain 16M) gbIAAL52638. RIBONUCLEASE HI [Brucella melitensis 16M] gbIAAN29420. 11AE014357_5 ribonuclease H [Brucella suis 1330] Length = 154 4872. 3 Best-BlastP =>> nrprot 98% Identities = 511/520 (98%), Positives = 515/520 (99%) gbIAAM00608. 11 unknown [Legionella pneumophila] Length = 520 4873. 3 Best-BlastP =>> nrprot 99% Identities = 383/387 (98%), Positives = 385/387 (99%) gblAAM00609. 1 I unknown [Legionella pneumophila] Length = 388 4874. 2 Best-BlastP =>> nrprot 41% Identities = 108/445 (24%), Positives = 193/445 (43%), Gaps = 79/445 (17%) refINP_621958. ATPase involved in DNA repair [Thermoanaerobacter tengcongensis] gbIAAM23562. ATPase involved in DNA repair [Thermoanaerobacter tengcongensis] Length = 1177 4875. 1 Best-BlastP =>> nrprot 69% Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 6/119 (5%) reflZP_00033092. 1 COG0316: Uncharacterized preserved protein [Burkholderia fungorum] Length = 121 4877. 2 Best-BlastP =>> nrprot 74% Identities = 202/356 (56%), Positives = 269/356 (75%), Gaps = 1/356 (0%) refINP_746144. 1 tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase [Pseudomonas putida KT2440] gbIAAN69608. 11AE016594_5 tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase [Pseudomonas putida KT2440] Length = 374 4878. 2 Best-BlastP =>> nrprot 54% Identities = 161/418 (38%), Positives = 242/418 (57%), Gaps = 6/418 (1%) reflZP_00086772. COG0739: Membrane proteins related to metalloendopeptidases [Pseudomonas fluorescens PfO-1] Length = 471,488. 2 Best-BlastP =>> nrprot 75% Identities = 181/298 (60%), Positives = 230/298 (77%) refIZP_00068320. 1 I COG1131: ABC-type multidrug transport system, ATPase component [Microbulbifer degradans 2-40] Length = 318 4880. 2 Best-BlastP =>> nrprot 49% Identities = 92/270 (34%), Positives = 136/270 (50%), Gaps = 9/270 (3%) refINP_085189. 1 j IS10 orf [Shigella flexneri] refINP858160. 1 j hypothetical protein [Shigella flexneri 2a] gbIAAK18345. 11AF348706_34 IS10 orf [Shigella flexneri] gbjAAL72480. 1 I hypothetical protein [Shigella flexneri 2a] Length = 407 4881. 4 Best-BlastP =>> nrprot 11% Identities = 72/284 (25%), Positives = 121/284 (42%), Gaps = 19/284 (6%) refIZP_00112010. 1 I hypothetical protein [Nostoc punctiform] Length = 427 4883. 2 Best-BlastP =>> nrprot 50% Identities = 45/105 (42%), Positives = 67/105 (63%), Gaps = 1/105 (0%) refINP819268. I preprotein translocase, SecE subunit [Coxiella burnetii RSA 493] gbjAAO89782. 1 I preprotein translocase, SecE subunit [Coxiella burnetii RSA 493] Length = 1 4884. 1 Best-BlastP =>> nrprot 80% Identities = 125/175 (71%), Positives = 148/175 (84%) refIZP_00123792. COG0250: Antiterminator transcription [Pseudomonas syringae pv.  syringae B728a] refINP_790461. 11 antitermination protein NusG transcription [Pseudomonas syringae pv.  tomato str.  DC3000] gbIAAO54156. Antisermination Protein NusG Protein [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 177 4885. 2 Best-BlastP =>> nrprot 87% Identities = 112/143 (78%), Positives = 127/143 (88%) refINP_282996. 1 50S ribosomal protein L11 [Neisseria meningitidis Z2491] pirlIH82007 50S ribosomal protein L11 NMA0146 [imported] - Neisseria meningitidis (strain Z2491 serogroup A) embICAB83461. 11 50S ribosomal protein L11 [Neisseria meningitidis Z2491] Length = 144 4887. 3 Best-BlastP =>> nrprot 57% Identities = 72/176 (40%), Positives = 102/176 (57%), Gaps = 6/176 (3%) refINP 419908. Acetyltransferase, GNAT family [Caulobacter crescentus CB15] pir11H87384 acetyltransferase, GNAT family [imported] - Caulobacter crescentus gbIAAK23076. 11 acetyltransferase, GNAT family [Caulobacter crescentus CB15] Length = 181 4888. 1 Best-BlastP =>> nrprot 59% Identities = 63/151 (41%), Positives = 103/151 (68%) embICAD31280. 1 PUTATIVE TRANSCRIPTION REGULATOR PROTEIN [Mesorhizobium loti] Length = 151 4889. 1 Best-BlastP =>> nrprot 49% Identities = 44/120 (36%), Positives = 66/120 (55%), Gaps = 3/120 (2%) refINP_819252. 1 J hypothetical protein [Coxiella burnetii RSA 493] gbJAA089766. 1 I hypothetical protein [Coxiella burnetii RSA 493] Length = 130,489. 1 Best-BlastP =>> nrprot No Hits found 4891. 2 Best-BlastP =>> nrprot 26% Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 19/138 (13%) pirJIA59234 slow myosin heavy chain 3 - quail gbIAAC59911. 1 J slow myosin heavy chain 3 gbJAAC59912. 1 I slow myosin heavy chain 3 Length = 1931 4894. 1 Best-BlastP =>> nrprot 69% Identities = 52/121 (42%), Positives = 81/121 (66%), Gaps = 7/121 (5%) refINP_746309. 1 succinate dehydrogenase, hydrophobic membrane anchor protein [Pseudomonas putida KT2440] gbJAAN69773. 1AE016613_8 succinate dehydrogenase, hydrophobic membrane anchor protein [Pseudomonas putida KT2440] Length = 122 4895. 1 BestBlastP =>> nrprot 69% Identities = 60/124 (48%), Positives = 87/124 (70%) refINP_250272. 1 succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa PA01] pirlIC83448 succinate dehydrogenase (C subunit) PA1581 [imported] - Pseudomonas aeruginosa (strain PAO1) gbJAAGO4970. 1JAE004586_8 succinate dehydrogenase (C subunit) [Pseudomonas aeruginosa PAO1] Length = 128 4897. 2 Best-BlastP =>> nrprot 47% Identities = 103/370 (27%), Positives = 179/370 (48%), Gaps = 22/370 (5%) refINP_761717. Predicted signal transduction protein [Vibrio vulnificus CMCP6] gbfAA011244. 1 JAE016806_234 Predicted signal transduction protein [Vibrio vulnificus CMCP6] Length = 404 4900. 3 Best-BlastP =>> nrprot 41% Identities = 205/972 (21%), Positives = 412/972 (42%), Gaps = 110/972 (11%) refINP_245295. 1 J unknown [Pasteurella multocida] gbJAAK02442. 1 I unknown [Pasteurella multocida] Length = 1113 4901. 3 Best-BlastP =>> nrprot 76% Identities = 357/592 (60%), Positives = 454/592 (76%), Gaps = 1/592 (0%) refINP_842254. Aspartyl-tRNA synthetase [Nitrosomonas europaea ATCC 19718] embJCAD86164. Aspartyltrna synthetase [Nitrosomonas europaea ATCC 19718] Length = 593,492. 1 Best-BlastP =>> nrprot 25% Identities 23/43 (53%), Positives = 28/43 (65%) refINP_275122. 11 hypothetical protein [Neisseria meningitidis MC58] pirIIG81001 hypothetical protein NMB2137 [imported] - Neisseria meningitidis (strain MC58 serogroup B) gbJAAF42445. 1 J hypothetical protein [Neisseria meningitidis MC58] Length = 70 4907. 2 Best-BlastP =>> nrprot 72% Identities = 134/257 (52%), Positives = 186/257 (72%), Gaps = 9/257 (3%) reflZP_00067917. COG1054: Predicted sulfurtransferase [Microbulbifer degradans 2-40] Length = 309 4908. 3 Best-BlastP =>> nrprot 58% Identities = 715/1981 (36%), Positives = 1108/1981 (55%), Gaps = 111/1981 (5%) refINP_406102. 11 putative membrane protein [Yersinia pestis] refINP_668470. 1 J conserved hypothetical protein [Yersinia pestis KIM] spIQ8ZDJ21YP73_YERPE Hypothetical UPF0192 protein YP02573 / Y1143 precursor pirJJACO314 probable membrane protein YPO2573 [imported] -Yersinia pestis (strain C092) embJCAC91375. 1 J putative membrane protein [Yersinia pestis C092] gbJAAM84721. 1 JAE013717_3 conserved hypothetical protein [Yersinia pestis KIM] Length = 2004 Best-BlastP =>> nrprot 34% Identities = 62/271 (22%), Positives = 116/271 (42%), Gaps = 20/271 (7%) ) spIO60610IDIA1_HUMAN Diaphanous Protein homolog 1 (Diaphanous-related formin 1) (DRF1) gbIAACO5373. 1 J diaphanous 1 [Homo sapiens] Length = 1248 4913. 2 Best-BlastP =>> nrprot No Hits found 4914. 2 Best-BlastP =>> nrprot No Hits found 491. 1 4916. 2 Best-BlastP =>> nrprot 30% Identities = 53/186 (28%), Positives = 93/186 (50%), Gaps = 11/186 (5%) refINP_179611. 1 I leucine rich repeat protein family [Arabidopsis thaliana] pir1ID84586 hypothetical protein At2g20210 [imported] - Arabidopsis thaliana gblAAD21766. 1 hypothetical protein [Arabidopsis thaliana] Length = 271 4917. 2 Best-BlastP =>> nrprot No Hits found 4918. 2 Best-BlastP =>> nrprot 17% Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 4/114 (3%) refINP281741. 1 putative integral membrane protein [Campylobacterjejuni] pirjIE81402 probable integral membrane protein Cj0557c [imported] Campylobacterjejuni (strain NCTC 11168) embICAB75193. 1j putative integral membrane protein [Campylobacterjejuni subsp.  jejuni NCTC 11168] Length = 361 4919. 1 Best-BlastP =>> nrprot 44% Identities = 109/421 (25%), Positives = 192/421 (45%), Gaps = 24/421 (5%) refINP_900103. 1 membrane efflux membrane [Chromobacterium violaceum ATCC 12472] gblAAQ58111. Outer membrane efflux protein [Chromobacterium violaceum ATCC 12472] Length = 466,492. 4 Best-BlastP =>> nrprot 59% Identities = 48/101 (47%), Positives = 70/101 (69%), Gaps = 1/101 (0%) refINP_761137. 11 SM-20-related protein [Vibrio vuinificus CMCP6] gblAAO10664. 11AE016804_174 SM-20-related protein [Vibrio vuinificus CMCP6] dbj1BAC94823. 1 SM-20-related protein [Vibrio vuinificus YJ016] Length = 200 4920. 4 Best-BlastP =>> nrprot 56% Identities = 88/284 (30%), Positives = 143/284 (50%), Gaps = 38/284 (13%) refINP_791175. 11 sensory box / GGDEF domain / EAL domain protein [Pseudomonas syringae pv.  tomato str.  DC3000] gbjAAO54870. I sensory box / GGDEF domain / EAL domain protein [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 763 4923. 2 Best-BlastP =>> nrprot 79% Identities = 433/634 (68%), Positives = 507/634 (79%) refJZP_00066531. COG0441: Threonyl-tRNA synthetase [Microbulbifer degradans 2-40] Length = 636 4927. 1 Best-BlastP =>> nrprot No Hits found 4929. 2 Best-BlastP =>> nrprot 72% Identities = 164/298 (55%), Positives = 223/298 (74%), Gaps = 2/298 (0%) refINP_622015. 1 J uncharacterized enzyme involved in pigment biosynthesis [Thermoanaerobacter tengcongensis] gbIAAM23619. 1 I uncharacterized enzyme involved in pigment biosynthesis [Thermoanaerobacter tengcongensis] Length = 307 493. 4 Best-BlastP =>> nrprot 55% Identities = 83/216 (38%), Positives = 131/216 (60%) refINP 634315. Zinc metalloprotease [Methanosarcina mazei Goel] gbJAAM31987. Zinc metalloprotease [Methanosarcina mazei Goel] Length = 238 4930. 2 Best-BlastP =>> nrprot 78% Identities = 51/90 (56%), Positives = 71/90 (78%) refINP_819953. 11 conserved hypothetical protein [Coxiella burnetii RSA 493] spIQ83D06IY941_COXBU Hypothetical UPF0269 protein CBU0941 gbIAAO90467. 1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 90 4934. 3 Best-BlastP =>> nrprot 26% Identities = 59/198 (29%), Positives = 101/198 (51%), Gaps = 27/198 (13%) refINP628263. 1 possible secreted peptidase [Streptomyces coelicolor A3 (2)] emblCAB56362.  1 possible secreted peptidase [Streptomyces coelicolor A3 (2)] Length = 279 4935. 2 Best-BlastP =>> nrprot 63% Identities = 168/345 (48%), Positives = 225/345 (65%) refINP_216774. 1 J hypothetical protein Rv2258c [Mycobacterium tuberculosis H37Rv] refINP_336787. 11 methyltransferase-related protein [Mycobacterium tuberculosis CDC1551] refINP_855931. 11 Possible transcriptional regulatory protein [Mycobacterium bovis subsp.  bovis AF2122 / 97] pirjIF70862 probable helixturn helixturn motif at aa 47-68 - Mycobacterium tuberculosis (strain H37RV) emblCAA17295. 11 hypothetical protein Rv2258c [Mycobacterium tuberculosis H37Rv] gbIAAK46601. 11 methyltransferase-related protein [Mycobacterium tuberculosis CDC1551] embICAD97135. 11 Possible transcriptional regulatory protein [Mycobacterium bovis subsp.  bovis AF2122 / 97] Length = 353,494. 2 Best-BlastP =>> nrprot 75% Identities = 160/283 (56%), Positives = 212/283 (74%), Gaps = 5/283 (1%) refINP_518195. 11 PROBABLE METALLOPROTEASE ZINC TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] spIQ8Y3A6IHTPX_RALSO Probable protease htpX homolog embjCAD13602. 1 I PROBABLE METALLOPROTEASE ZINC TRANSMEMBRANE PROTEIN [Raistonia solanacearum] Length = 286 4941. 2 Best-BlastP =>> nrprot No Hits found 4942. 1 Best-BlastP =>> nrprot No Hits found 4943. 2 Best-BlastP =>> nrprot No Hits found 4945. 2 Best-BlastP =>> nrprot 79% Identities = 214/340 (62%), Positives = 268/340 (78%), Gaps = 11/340 (3%) refINP_052843. 1 I hypothetical protein [Coxiella burnetii] refINP_819053. 1 repB protein, putative [Coxiella burnetii RSA 493] pirjIS52723 qsopB protein - Coxiella burnetii plasmid QpH1 gbjAAA69865. 1 I qsopB gene product embICAA59788. 1 I orf 334 [Coxiella burnetii] emblCAA75818. 1I hypothetical protein [Coxiella burnetii] gblAAD33475. 1 jAF131076_1 hypothetical protein [Coxiella burnetii] gbIAAO91613. 1 RepB protein, putative [Coxiella burnetii RSA 493] prfII2117254B trans-acting factor Length = 334 4947. 2 Best-BlastP =>> nrprot 93% Identities = 340/402 (84%), Positives = 377/402 (93%) refINP_052336. 1 unnamed protein product [Coxiella burnetii] refINP_052844. 1 I hypothetical protein [Coxiella burnetii] refINP_819052. 1AA protein, putative [Coxiella burnetii RSA 493] pir1IS68866 qsopA protein - Coxiella burnetii plasmid QpH1 embjCAA53106. I unnamed protein product [Coxiella burnetii] gbIAAA69864. 1 qsopA gene product embICAA59789. 1 J orf 406 [Coxiella burnetii] embICAA75819. I putative SopA protein (protein a) [Coxiella burnetii] gblAAD33476.  11AF131076_2 hypothetical protein [Coxiella burnetii] gblAAO91612. 1A protein, putative [Coxiella burnetii RSA 493] prfII2117254A trans- action factor length = 406 4948. 4 Best-BlastP =>> nrprot No Hits found 4951. 2 Best-BlastP =>> nrprot 24% Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 4/79 (5%) reflZP_00103190. 1 COG1396: Predicted transcriptional regulators [Desulfitobacterium hafniense] Length = 123 4952. 1 Best-BlastP =>> nrprot No Hits found 4954. 2 Best-BlastP =>> nrprot 53% Identities = 62/155 (40%), Positives = 92/155 (59%) refINP_746668. 1 deformylase polypeptide [Pseudomonas putida KT2440] spIQ88EA7IDEF2_PSEPK Peptide deformylase 2 (PDF 2) (deformylase 2 polypeptide) gblAAN70132. 1 JAE016653_3 deformylase polypeptide [Pseudomonas putida KT2440] Length = 178 4955. 4 Best-BlastP =>> nrprot 50% Identities = 132/417 (31%), Positives = 218/417 (52%), Gaps = 9/417 (2%) refINP_221200. 1 PROLINE / BETAINE TRANSPORTER (proP6) [Rickettsia prowazekii] pine ID71647 proline / betaine transporter (proP6) RP852 Rickettsia prowazekii embICAA15276. 11 PROLINE / BETAINE TRANSPORTER (proP6) [Rickettsia prowazekii] Length = 415 4957. 2 Best-BlastP =>> nrprot 62% Identities = 53/108 (49%), Positives = 74/108 (68%), Gaps = 3/108 (2%) REFINP 251650. 1 j type 4 fimbrial biogenesis protein PiIZ [Pseudomonas aeruginosa PA01] pir11B59241 type 4 fimbriae biogenesis protein [imported] - Pseudomonas aeruginosa gbjAAA93519. 1 involved in biogenesis of type 4 fimbriae gblAAG06348.  11AE004722 4 type 4 fimbrial biogenesis protein PiIZ [Pseudomonas aeruginosa PAO1] Length = 118 4958. 3 Best-BlastP =>> nrprot 47% Identities = 90/313 (28%), Positives = 142/313 (45%), Gaps = 20/313 (6%) ref1NP_819534. 11 DNA polymerase III, delta prime subunit [Coxiella burnetii RSA 493] gblAAO90048. 1 DNA polymerase III, delta prime subunit [Coxiella burnetii RSA 493] Length = 319,496. 1 Best-BlastP =>> nrprot No Hits found 4960. 2 Best-BlastP =>> nrprot No Hits found 4961. 1 Best-BlastP =>> nrprot 77% Identities = 70/127 (55%), Positives = 99/127 (77%), Gaps = 4/127 (3%) refINP_391517. 1 Large-conductance mechanosensitive channel [pbrIE70065] Large-conductance mechanosensitive channel pirlIE70065 broad conductance mechanosensitive channel homolog ywpC - Bacillus subtilis emblCAB05944 1 ywpC [Bacillus subtilis] embjCAB15653.  1 d large conductance mechanosensitive channel protein [Bacillus subtilis subsp.  subtilis str.  168] Length = 130 4962. 2 Best-BlastP =>> nrprot No Hits found 4965. 2 Best-BlastP =>> nrprot 61% Identities = 99/105 (94%), Positives = 102/105 (97%) emblCAB65201. 11 hypothetical protein [Legionella pneumophila] Length = 356 4966. 2 Best-BlastP =>> nrprot 98% Identities = 586/598 (97%), Positive = 590/598 (98%) embICAB65200. 1 I hypothetical protein [Legionella pneumophila] Length = 598 4968. 2 Best-BlastP =>> nrprot 63% Identities = 60/128 (46%), Positives = 83/128 (64%) reflNP_439721. 1 Alanine racemase biosynthetic [Haemophilus influenzae Rd] splP452571ALR_HAEIN Alanine racemase pirl1E64130 alanine racemase (EC 5. 1. 1. 1), biosynthetic - Haemophilus influenzae (strain Rd KW20) gblAAC23218. 11 alanine racemase, biosynthetic (air) [Haemophilus influenzae Rd] Length = 360 4969. 3 Best-BlastP =>> nrprot 81% Identities = 117/163 (71%), Positives = 141/163 (86%), Gaps = 1/163 (0%) refINP_719448. 1 replicative DNA helicase [Shewanella oneidensis MR-1] gblAAN56892. 11AE015824_3 replicative DNA helicase [Shewanella oneidensis MR-1] Length = 497. 1 Best-BlastP =>> nrprot No Hits found 4972. 3 Best-BlastP =>> nrprot 68% Identities = 111/195 (56%), Positives = 146/195 (74%) refJZP_00091033. COG0305: Replicative DNA helicase [Azotobacter vinelandii] Length = 463 4974. 1 Best-BlastP =>> nrprot 40% Identities = 43/138 (31%), Positives = 71/138 (51%), Gaps = 6/138 (4%) pirl lT18332 icmL protein - Legionella pneumophila gblAAC38190. 1 1 Dot! [Legionella pneumophila] emblCAA75329. 1 lcmL protein [Legionella pneumophila] embjCAD43145. Dotl protein [Legionella pneumophila serogroup 6] Length = 212 4977. 3 Best-BlastP =>> nrprot No Hits found 4979. 1 Best-BlastP =>> nrprot 71% Identities = 115/192 (59%), Positives = 144/192 (75%) reflNP_246450. 1 I unknown [Pasteurella multocida] spjP579471ENGB_PASMU Probable GTP-binding protein engB gblAAK03595. 1 I unknown [Pasteurella multocida] Length = 205 498. 4 Best-BlastP =>> nrprot 37% dentities = 78/305 (25%), Positives = 125/305 (40%), Gaps = 56/305 (18%) refINP_421401. 1 amine oxidase, flavin-containing [Caulobacter crescentus CB15] 011E87571 amine oxidase, fiavin-containing [imported] - Caulobacter crescentus gbIAAK24569. 1 amine oxidase, flavin-containing [Caulobacter crescentus CB15] Length = 454 4980. 3 Best-BlastP =>> nrprot 69% dentities = 102/206 (49%), Positives = 139/206 (67%), Gaps = 7/206 (3%) refINP_759874. Cytochrome c4 [Vibrio vulnificus CMCP6] gbIAAO09401. 11AE016800_6 Cytochrome c4 [Vibrio vulnificus CMCP6] Length = 205 4984. 2 Best-BlastP =>> nrprot 73% Identities = 109/166 (65%), Positives = 126/166 (75%), Gaps = 1/166 (0%) gbIAAO38281. Lfe115pl [Leptospirillum ferrooxidans] Length = 178 4987. 2 Best-BlastP =>> nrprot 77% dentities = 274/490 (55%), Positives = 360/490 (73%), Gaps = 28/490 (5%) refINP 457051. 11 putative GTP-binding protein [Salmonella enterica subsp.  enterica serovar Typhi] refINP_804211.  11 putative GTP-binding protein [Salmonella enterica subsp.  enterica serovar Typhi Ty2] spIQ8Z4P6JENGA_SALTI Probable GTP-binding protein engA pirIIAF0821 probable GTP- binding protein STY2764 [imported] - Salmonella enterica subsp.  enterica serovar Typhi (CT18 strain) embICAD02722. I putative GTP-binding protein [Salmonella enterica subsp.  enterica serovar Typhi] gbIAAO68060. 1 putative GTP-binding protein [Salmonella enterica subsp.  enterica serovar Typhi Ty2] Length = 490 499. 2 Best-BlastP =>> nrprot 51% Identities = 129/343 (37%), Positives = 196/343 (57%), Gaps = 10/343 (2%) refIZP_00106589. COG1680: Beta- lactamase class C and other penicillin binding proteins [Nostoc punctiform] Length = 393 4990. 3 Best-BlastP =>> nrprot No Hits found 4992. 2 Best-BlastP =>> nrprot No Hits found 4993. 2 Best-BlastP =>> nrprot 36% Identities = 44/89 (49%), Positives = 63/89 (70%) refIZP_00102874. 1 I hypothetical protein [Desulfitobacterium hafniense] Length = 106 4995. 1 Best-BlastP =>> nrprot 33% Identities = 42/179 (23%), Positives = 73/179 (40%), Gaps = 36/179 (20%) refINP_229450. 1 I alpha-amylase, putative [Thermotoga maritima] pir11G72227 hypothetical protein TM1650 - Thermotoga maritima (strain MSB8) gbIAAD36717. 1 jAE001807_8 alpha-amylase, putative [Thermotoga maritima] Length = 422 4998. 2 Best-BlastP =>> nrprot 16% Identities = 47/200 (23%), Positives = 87/200 (43%), Gaps = 16/200 (8%) refINP_036450. 1 leucine zipper-EF-hand containing transmembrane protein 1 [Homo sapiens] gbIAAD13138. Leucine zipper-EF-hand containing

  Transmembrane protein 1 Homo sapiens gbIAAH14500.1 Leucine zipper-EF-hand containing transmembrane protein 1 Homo sapiens gbIAAH21208.1 Leucine zipper-EF- hand containing transmembrane protein 1 Homo sapiens Length = 739 4999.2 Best-BlastP =>> nrprot 77% Identities = 157/241 (65%), Positives = 197/241 (81%), Gaps = 4/241 (1%) refINP_252346.1 130S ribosomal protein S2 [Pseudomonas aeruginosa PA01] spIO82850IRS2_PSEAE 30S ribosomal protein S2 pirIIC83189 30S ribosomal protein S2 PA3656 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG07044.11AE004785_8 30S ribosomal protein S2 [Pseudomonas aeruginosa PAO1] Length = 246 50.1 Best-BlastP =>> nrprot 84% Identities = 76/92 (82 %), Positive = 80/92 (86%). [Legionella pneumophila] gbIAAM08238.1 j putative pilin subunit [Legionella pneumophila] Length = 96 500.2 Best-BlastP =>> nrprot 97% dentities = 341/352 96%), Positives = 346/352 (98%) gbIAAG59860.11AF299349_1 major acid phosphatase [Legionella pneumophil a] Length = 352 5000.3 Best-BlastP =>> nrprot 97% Identifies = 131/136 (96%), Positives = 134/136 (98%) emblCAB09802.1 16 kD immunogenic protein [Legionella pneumophila] Length = 136 5001.1 Best -BlastP =>> nrprot No Hits found 5003. 2 Best-BlastP =>> nrprot No Hits found 5005.3 Best-BlastP =>> nrprot 99% Identities = 454/455 (99%), Positives = 455/455 (100% ) gblAAQ18124.11 CpxA [Legionella pneumophila] Length = 455 501.2 Best-BlastP =>> nrprot 30% Identities = 40/167 (23%), Positives = 75/167 (44%), Gaps = 13/167 (7%) ) dbjIBAC45194.1 kinesin-like protein [Oryza sativa (japonica cultivar-group)] Length = 1967 5010.2 Best-BlastP =>> nrprot 18% Identities = 34/117 (29%), Positive = 54/117 (46%) ), Gaps = 12/117 (10%) embJCAD90592.1 C3L protein [Cowpox virus] Length = 833 5015.2 Best-BlastP =>> nrprot 58% Identities = 43/110 (39%), Positives = 66/110 (60%) %), Gaps = 3/110 (2%) ReflZP_00056081.1 I hypothetical protein [Magnetospirillum magnetotacticum] Length = 164 5018.2 Best-BlastP =>> nrprot No Hi ts found 5019.1 Best-BlastP =>> nrprot 61% Identities = 87/190 (45%), Positives = 125/190 (65%) gbJAAG 10504.1 JAF279106_66 predicted YacE family of P-loop kinases [uncultured marine gamma proteobacterium EBAC31A08] Length = 197 502.3 Best-BlastP =>> nrprot No Hits found 5021.3 Best-BlastP =>> nrprot 48% Identities = 64/247 (25%), Positives = 120/247 (48%), Gaps = 8/247 (3) %) refINP_903494.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbIAAQ61486.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 252 5022.2 Best-BlastP =>> nrprot 58% Identities = 124/336 (36%), Positive = 204/336 (60%), Gaps = 5/336 (1%) refINP_742592.1 J protein membrane, putative [Pseudomonas putida KT2440] gblAAN66056.1 IAE016234_9 protein membrane, putative [Pseudomonas putida KT2440] Length = 346 5026.1 BestBlastP = >> nrprot 77% Identities = 49/89 (55%), Positives = 70/89 (78%) refINP_250138.1 l flagellar biosynthetic protein FIiQ [Pseudomonas aeruginosa PA01] r COG1987: Flagellar biosynthesis pathway, component FIiQ [Pseudomonas aeruginosa UCBPP-PA14] pir1IA83465 flagellar biosynthetic protein FI1Q PA1447 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG04836.1 1AE004574_7 flagellar biosynthetic protein FIiQ [Pseudomonas aeruginosa PAOI] Length = 89 Best-BlastP =>> nrprot 70% Identities = 270/528 (51%), Positives = 367/528 (69%), Gaps = 5/528 (0%) refINP_820198.11 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO90712.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = Best-BlastP =>> nrprot 55% Identities = 162/399 (40%), Positives = 247/399 (61%), Gaps = 3/399 (0 %) refGZP_00065233.1 I COG0741: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM / invasin domains) [Microbulbifer degradans 240] Length = 543 Best-BlastP =>> nrprot 84% Identities = 225/326 (69%) , Positive = 276/326 (84%) refINP_820836.1 I ABC peptide carry, permease protein [Coxi ella burnetii RSA 493] gbIAAO91350.1 J peptide ABC carry, permease protein [Coxiella burnetii RSA 493] Length = 327 5028.2 503.3 5030.2 5031.2 Best-BlastP =>> nrprot 40% Identities = 42/173 (24%), Positive = 75 / 173 (43%), Gaps = 12/173 (6%) refINP_542876.1 hypothetical protein [Pseudomonas putida] promICAC86816.11 hypothetical protein [Pseudomonas putida] Length = 267 5032.1 Best-BlastP =>> nrprot No Hits found 5033.1 Best -BlastP =>> nrprot No Hits found 5037.1 Best-BlastP =>> nrprot 84% Identities = 35/43 (81%), Positive = 38/43 (88%) refINP_300059.1 150S ribosomal protein L34 [Xylella fastidiosa 9a5c] 50S ribosomal protein L34 [Xylella fastidiosa Temeculal] ribosomal protein L34 pir1IB82517 50S ribosomal protein L34 XF2782 [imported] - Xylella fastidiosa (strain 9a5c) gbIAAF85567.1 JAE004083_6 50S ribosomal protein L34 [Xylella fastidiosa 9a5c] gblAAO29942.1 50S ribosomal protein L34 [Xylella fastidiosa Temeculal] Length = 46 5038.1 Best- BlastP =>> nrprot 57% Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%) refINP_290337.1 I. RNase P, protein component; protein C5; tRNA, 4.5S RNA [Escherichia coli O157: H7 EDL933] refINP_312666.1 I ribonuclease P protein component [Escherichia coli O157: H7] spIQ8XB43IRNPA_ECO57Ribonuclease P protein component (RNaseP protein) (RNase P protein) (Protein C5) pirIIG91208 ribonuclease P protein Escherichia coli (strain O157: H7, substrain RIMD 0509952) pir1IA86055 hypothetical protein rnpA [imported] - Escherichia coli (strain O157: H7, substrain EDL933) gblAAG58901.1 IAE005601_7 RNase P, protein component; protein C5; tRNA, 4.5S RNA [Escherichia coli O157: H7 EDL933] dbjIBAB38062.1 J ribonuclease P protein component [Escherichia coli O157: H7] Length = 119 5039.2 Best-BlastP =>> nrprot 62% Identities = 38/68 (55% ), Positive = 51/68 (75%) COG0759: Uncharacterized conserved protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 100 5040.2 Best-BlastP =>> nrprot 68% Identities = 268/565 (47%), Positives = 381/565 (67%), Gaps = 23/565 (4%) refINP_820897.1 I inner- membrane protein, 60kDa [Coxiella burnetii RSA 493] spIP456501601M_COXBU 60 kDa inner-membrane protein homolog gbIAAO91411.11 innermembrane protein, 60kDa [Coxiella burnetii RSA 493] Length = 566 5041.2 Best-BlastP =>> nrprot 98% Identities = 176/178 ( 98%), Positives = 176/178 (98%) sp1034955IIPYR_LEGPN Inorganic pyrophosphatase (Pyrophosphate phospho-hydrolase) (PPase) gblAAB84257.1I inorganic pyrophosphatase [Legionella pneumophila] gblAACO2428.11 inorganic pyrophosphatase [Legionella pneumophila] Length = 178 5042.1 Best-BlastP =>> nrprot No Hits found 5043.3 Best-BlastP =>> nrprot 70% Identities = 210/415 (50%), Positives = 298/415 (71%), Gaps = 2/415 (0%) refINP_760503.1 I Putative Mg2 + and Co2 + transport CorB [Vibrio vulnificus CMCP6] gbIAAO10030.11AE016802_73 Putative Mg2 + and Co2 + transport CorB [Vibrio vulnificus CMCP6] Length = 425 5044.2 Best-BlastP =>> nrprot 73% Identities = 166/299 (55%), Positives = 217/299 (72%), Gaps = 13/299 (4%) refINP_763465.1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gblAAO08455.11AE016813_207 Conserved hypothetical protein [Vibrio vulnificus CMCP6] Length = 304 5046.2 Best-BlastP =>> nrprot 53% Identities = 45/118 (38%), Positives = 73/118 (61%), Gaps = 5 / 118 (4%) refIXP_132330.11 RIKEN cDNA 2810006K23 [Mus musculus] gbIAAH46909.11 Similar to RIKEN cDNA 2810006K23 gene [Mus musculus] Length = 184 5047.3 505.3 5050.2 5052.4 5054.2 5056.2 5058.2 5059.3 506.3 5060.2 5061.4 5062.3 5064.2 5065.2 5066.2 5068.3 5069.3 Best- BlastP =>> nrprot 41% Identities = 43/167 (25%), Positives = 80/167 (47%), Gaps = 6/167 (3%) reflZP_00067126.1 J COG3009: [Microbulbifer degradans 2-40] Length = 217 Identities = 241/243 (99%), Positives = 242/243 (99%) emblCAD90952.11 LssA protein [Legionella pneumophila] Identities = 194/201 (96%), Positives = 197/201 (98%) embjCAD90953 .1 j LssZ protei [Legionella pneumophila] Identities = 77/161 (47%), Positives = 108/161 (67%) refINP_390248.1 J yqkA [Bacillus subtilis] spIP545641YQKA_BACSU Hypothetical protein yqkA pirlIC69966 hypothetical protein yqkA - Bacillus subtilis dbjlBAAl2633.1! YqkA [Bacillus subtilis] embJCAB14299.1 J yqkA [Bacillus subtilis subsp. subtilis str. 168] Length = 343 Best-BlastP =>> nrprot 59% Identities = 57/101 (56%), Positives = 67/101 (66%), Gaps = 1/101 (0%) refIZP_00091135. 1 l COG2852: Uncharacterized protein stored in bacteria [Azotobacter vinelandii] Length = 150 Best-BlastP =>> nrprot 57% Identities = 29/66 (43%), Positives = 46/66 (69%), Gaps = 1/66 (1%) dbjlBAA75251.11 Similar to IS1301 of Neisseria meningitidis [Actinobacillus actinomycetemcomitans] Length = 255 Best-BlastP =>> nrprot 44% Identities = 33/70 (47%), Positives = 46/70 (65%) pirIIS61903 Hypothetical protein 1 - Neisseria meningitidis embJCAA88914.1 I orf1 [Neisseria meningitidis] Length = 151 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 99% Identities = 504/505 (99%), Positive pneumophila] Length = 505 Best-BlastP =>> nrprot 87% Identities = 468/562 (83%), Positive protein [Legionella pneumophila] Length = 548 Best-BlastP =>> nrprot 18% Identities = 24/71 (33%), Positive = 39/71 (54%) gbIAAA21525.1 meiotin-1 Length = 259 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 34% Identities = 30/100 (30%), Positive = 54 / 100 (54%), Gaps = 11/100 (11%) refINP_593310. 1 l F-box protein [Schizosaccharomyces pombe] spIP87053IPOF1_SCHPO F-box / WD-repeat protein pof1 (Skpl-binding protein 1) pirlIT38932 probable sulfur metabolite control protein - fission yeast (Schizosaccharomyces pombe) emblCAB08168. 11 SPAC57A10.05c [Schizosaccharomyces pombe] dbjlBAA84528.1 Pof1 [Schizosaccharomyces pombe] Length = 605 Best-BlastP =>> nrprot 57% Identities = 50/121 (41%), Positives = 80/121 (66%), Gaps = 5/121 (4%) refINP 487806.1 I two-component response regulator [Nostoc sp. PCC 7120] pirlIAG2276 two-component response regulator aII3766 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB75465.1 two-component response regulator [Nostoc sp. PCC 7120] Length = 143 Best-BlastP =>> nrprot 51% Identities = 52/194 (26%), Positives = 98/194 (50%), Gaps = 8/194 (4%) refIZP_00110196.1 l hypothetical protein [Nostoc punctiform] Length = 223 Best-BlastP =>> nrprot 53% Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 25/149 (16%) refINP_812673.1 arginine [Bacteroides thetaiotaomicron VPI-5482] gbIAAO78867.11 arginine repressor, transcriptional regulator of arginine metabolism [Bacteroides thetaiotaomicron VPI-5482] Length = 157 Uncharacterized protein conserved in bacteria Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 99% Length = 243 Best-BlastP =>> nrprot 97% Length = 204 Best-BlastP =>> nrprot 33% = 504/505 (99%) emblCAB65195.1 I hypothetical protein [Legionella = 492/562 (87%), Gaps = 16/562 (2%) emblCAB65194.11 hypothetical 507.3 Best-BlastP =>> nrprot 46% Identities = 18/32 (56%), Positives = 22/32 (68%) gblAAN04217.11 putative transposase Tnp [A eromonas salmonicida] Length = 383 5071.2 Best-BlastP =>> nrprot No Hits found 5072.2 Best-BlastP =>> nrprot 26% Identities = 30/85 (35%), Positives = 41/85 (48%) refNP 473229.21 putative protein [Plasmodium falciparum 3D7] kinase embICAA15620.31 putative protein kinase [Plasmodium falciparum 3D7] Length = 2515 5075.4 Best-BlastP =>> nrprot 11% Identities = 62/172 (36%), Positives = 102/172 (59%), Gaps = 18/172 (10%) refINP_703336.1 P. falciparum RESA- like protein with DnaJ domain [Plasmodium falciparum 3D7] embICAD48951.11 P. falciparum RESA-like protein with DnaJ domain [Plasmodium falciparum 3D7] Length = 1451 5076.2 Best -BlastP =>> nrprot 54% Identities = 50/158 (31%), Positives = 87/158 (55%), Gaps = 10/158 (6%) refINP_634196.11 Hydrogenase expression / formation protein [Methanosarcina mazei Geel] emblCAA62962.11 F420-nonreducing hydrogenase II [Methanosarcina mazei] gbIAAM31868.11 Hydrogenase expression / protein formation [Methanosarcina mazei Geel] Length = 161 Best-BlastP =>> nrpro t 60% Identities = 198/424 (46%), Positives = 262/424 (61%), Gaps = 2/424 (0%) refgP_00089783.1 COG3259: Coenzyme F420-reducing hydrogenase, alpha subunit [Azotobacter vinelandii] Length = 442 Best-BlastP =>> nrprot 76% Identities = 250/432 (57%), Positives = 329/432 (76%), Gaps = 3/432 (0%) refINP_052842.1 f hypothetical protein [Coxiella burnetii ] gb1AAD33508.1 1AF131076_34 hypothetical protein [Coxiella burnetii] Length = 433 Best-BlastP =>> nrprot 44% Identities = 121/443 (27%), Positives = 217/443 (48%), Gaps = 26/443 (5%) %) refINP_903425.1 probable peptide transport protein [Chromobacterium violaceum ATCC 12472] gbJAAQ61417.1 J probable peptide transport protein [Chromobacterium violaceum ATCC 12472] Length = 495 Best-BlastP =>> nrprot 50% Identities = 62/173 (35%) , Positive = 96/173 (55%) refINP_520208.1 J PRESERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] embJCAD15794.1 J CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 194 5082.3 Best-BlastP =>> nrprot N o Hits found 5084.4 Best-BlastP =>> nrprot 30% Identities = 94/351 (26%), Positives = 160/351 (45%), Gaps = 28/351 (7%) refIZP_00087727.1! hypothetical protein [Pseudomonas fluorescens PfO-1] Length = 375 5087.2 Best-BlastP =>> nrprot 19% Identities = 37/151 (24%), Positives = 69/151 (45%), Gaps = 11/151 (7% ) refINP_705411.1 j hypothetical protein, conserved [Plasmodium falciparum 3D7] embICAD52648.1 l hypothetical protein, conserved [Plasmodium falciparum 3D7] Length = 5088.2 Best-BlastP =>> nrprot 53% Identities = 49/131 (37%), Positive GTIN = 76/131 (58%), Gaps = 4/131 (3%) refINP_832446.1 Acetyltransferase [Bacillus cereus ATCC 14579] gbIAAP09647.1l Acetyltransferase [Bacillus cereus ATCC 14579] Length. = 141 509.1 Best-BlastP =>> nrprot 50% Identities = 69/172 (40%), Positives = 99/172 (57%), Gaps = 10/172 (5%) refINP_903527.1 J conserved hypothetical protein [Chromobacterium ATCC 12472] gbJAAQ61519.21 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 576 5077.3 5078.2 5080.4 5081.3 5090.2 Best-BlastP =>> nrprot 59% Identities = 148/359 (41%), Positives = 211/359 (58) %), Gaps = 12/359 (3%) refINP_662343.1 J glutamate 5-kinase [Chlorobium tepidum TLS] spIQ8KCG4JPROB_CHLTE Glutamate 5-kinase (Gamma-glutamyl kinase) (GK) gbIAAM72685.1 glutamate 5-kinase [Chlorobium tepidum TLS ] Length = 361 5092.3 Best-BlastP =>> nrprot No Hits found 5093.3 Best-BlastP =>> nrprot 52% Identities = 97/243 (39%), Positives = 128/243 (52%), Gaps = 2/243 (0%) refINP820472.1 UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii RSA 493] gblAAO90986.1 I UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii RSA 493] Length = 243 5094.2 Best-BlastP =>> nrprot 55% Identities = 93/209 (44%), Positives = 129/209 (61%), Gaps = 13/209 (6%) COG0850: Septum formation inhibitor [Pseudomonas fluorescens PfO-1] Length = 245 5097.1 Best- BlastP =>> nrprot 46% Identities = 76/295 (25%), Positives = 139/295 (47%), Gaps = 7/295 (2%) refINP_355292.1 I AGR_C_4240p [Agrobacterium tumefaciens] refINP_533007.1 conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Agrobacterium tumefaciens (strain C58, Cereon) pirIIAE2863 Ati2334 [imported] - Agrobacterium tumefaciens (strain C58, Smith) gblAAK88077.1 AGR_C_4240p [Agrobacterium tumefaciens str. C58 (Cereon)] gblAAL43323.11 conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 302 5098.2 Best-BlastP =>> nrprot No Hits found 510.2 Best-BlastP =>> nrprot No Hits found 5100.2 Best-BlastP =>> nrprot 42% Identities = 101/389 (25% ), Positives = 173/389 (44%), Gaps = 16/389 (4%) refINP_444149.1 I Y4xM [Rhizobium sp. NGR234] spIP55705IY4XM_RHISN HYPOTHETICAL TRANSPORT PROTEIN Y4XM gbIAAB91936.11 Y4xM [Rhizobium sp. NGR234] Length = 404 5103.4 Best-BlastP =>> nrprot 42% Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 1/61 (1%) gblAAG10082.11AF295331_2 outer membrane lipoprotein Pcp [Edwardsiella tarda] Length = 155 5104.3 Best-BlastP =>> nrprot 48% Identities = 203/509 (39%), Positives = 293/509 (57%), Gaps = 9/509 (1%) refINP_896011.1 FAD Iinked oxidase, N-terminal [Prochlorococcus marinus str. MIT 9313] [EmbajCAE22361.1] FAD linked oxidase, N-terminal [Prochlorococcus marinus str. MIT 9313] Length = 571 5106.3 Best-BlastP =>> nrprot 32% Identities = 54/242 (22%), Positives = 111/242 (45%), Gaps = 24/242 (9%) gbJEAA15516.1 I hypothetical protein [Plasmodium yoelii yoelii] Length = 585 5108.2 Best-BlastP =>> nrprot No Hits found 5113.3 Best-BlastP =>> nrprot No Hits found 5114.3 Best-BlastP =>> nrprot No Hits found 5115.2 Best-BlastP =>> nrprot 44% Identities = 77/284 (27%), Positives = 141/284 (49%), Gaps = 19/284 (6%) COG0454: Histone acetyltransferase HPA2 and related acetyltransferases [Desulfovibrio desulfuricans G20] Length = 326 5116.3 Best-BlastP =>> nrprot 56% Identities = 71/173 (41%), Positives = 107/173 (61%) refINP_800289.1 J hypothetical protein VPA0779 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC62122.1 I hypothetical protein [ Vibrio parahaemolyticus] Length = 203 5123.3 Best-BlastP =>> nrprot 57% Identities = 44/78 (56%), Positives = 54/78 (69%) refINP_819379.1 I DNA-binding protein Fis [Coxiella burnetii RSA 493] gbjAAO89893.1 J DNA -binding protein Fis [Coxiella burnetii RSA 493] Length = 103 5124.3 Best-BlastP =>> nrprot 78% Identities = 96/151 (63%), Positives = 120/151 (79%) reflNP_820809.1 I ribose-phosphate pyrophosphokinase [Coxiella burnetii RSA 493] gbjAAO91323.1 J ribosephosphate pyrophosphokinase [Coxiella burnetii RSA 493] Length = 319 5127.4 Best-BlastP =>> nrprot 77% Identities = 117/162 (72%), Positives = 141/162 (87%) %) reflZ_00068148.1 I COG0462: Phosphoribosylpyrophosphate synthetase [Microbulbifer degradans 2-40] Length = 316 5129.4 Best-BlastP =>> nrprot 76% Identities = 607/1050 (57%), Positive = 799/1050 (76%), Gaps = 12/1050 (1%) reflNP_773366.1 AcrB / AcrD / AcrF family protein [Bradyrhizobium japonicum] dbjlBAC51991.11 AcrB / AcrD / AcrF family protein [Bradyrhizobium japonicum USDA 110] Length = 1052 5132.3 Best-BlastP =>> nrprot No Hits found 5133.3 Best-BlastP =>> nrprot No Hits found 5134.4 Best-BlastP =>> nrprot 99% Identities = 308/309 (99%), Positives = 309/309 (100%) gblAAN63820.1 J lysophosph olipase A [Legionella pneumophila] Length = 309 5135.2 Best-BlastP =>> nrprot No Hits found 514.5 Best-BlastP =>> nrprot 16% Identities = 124/559 (22%), Positives = 243/559 (43%), Gaps = 100/559 (17%) gblAAB00143.1 1 putative Length = 1015 5146.2 Best-BlastP =>> nrprot 55% Identities = 154/418 (36%), Positives = 238/418 (56%), Gaps = 13 / 418 (3%) gb1AAC44538.1! ProP [Escherichia con] Length = 500 5147.1 Best-BlastP =>> nrprot No Hits found 5151.1 Best-BlastP =>> nrprot 56% Identities = 109/295 (36%), Positives = 167/295 (56%), Gaps = 9/295 (3%) refINP_346934.1 MccF-like protein [Clostridium acetobutylicum] pirj1G96935 mccF-like protein [imported] - Clostridium acetobutylicum gbJAAK78274.1 1AE007544_3 MccF-like protein [Clostridium acetobutylicum] Length = 306 5152.1 Best-BlastP =>> nrprot 55% Identities = 56/126 (44%), Positives = 72/126 (57%), Gaps = 2/126 (1%) refINP_107051.1 I unknown protein [Mesorhizobium lotus] dbjIBAB52837.1 J unknown protein [Mesorhizobium loti] Length = 274 5153.1 Best-BlastP =>> nrprot 97% Identities = 141/145 (97%), Positives = 142/145 (97%) gbIAAK00280.11AF288536_2 unknown [Legionella longbeachae] Length = 145 5154.2 Best -BlastP =>> nrprot 93% Identities = 253/273 (92%), Positives = 259/273 (94%) gblAAK00279.11AF288536_1 spectinomycin 3 'adenylyltransferase [Legionella longbeachae] Length = 274 5156.1 Best-BlastP =>> n rprot No Hits found 5159.2 Best-BlastP =>> nrprot 62% Identities = 240/471 (50%), Positives = 313/471 (66%), Gaps = 7/471 (1%) refJNP_900831.1 Probable melitin resistence Probably Melitin Resistance Protein [Chromobacterium violaceum ATCC 12472] Protein [Chromobacterium violaceum ATCC 12472] Length = 495 5162.1 Best-BlastP =>> nrprot No Hits found 5164.1 Best-BlastP =>> nrprot No Hits found 5167.4 Best-BlastP = >> nrprot 69% Identities = 49/91 (53%), Positives = 68/91 (74%) gbIAAP83334.1 jAF469614_2 unknown [Francisella tularensis subsp. tularensis] Length = 94 5173.1 Best-BlastP =>> nrprot 41% Identities = 195/643 (30%), Positives = 282/643 (43%), Gaps = 44/643 (6%) refINP_251563.1 I hypothetical protein [Pseudomonas aeruginosa PA0I] pirIIF83287 hypothetical protein PA2873 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG06261.1 1AE004713_10 hypothetical protein PA2873 [Pseudomonas aeruginosa PAOI] Length = 668 5174.2 Best-BlastP =>> nrprot No Hits found 5176.1 Best-BlastP = >> nrprot No Hits found 5177.2 Best-BlastP =>> nrprot 41% Identities = 61/168 (36%), Positives = 95/168 (56%), Gaps = 1/168 (0%) refgP_00144063.1 (Outer membrane 5178.1 5180.1 5188.2 Na + / H + dicarboxylate symporters [Ralstonia metallidurans] Length = 467 5189.2 Best-BlastP =>> nrprot No Hits found 519.3 Best-BlastP =>> nrprot 99% Identities = 549/550 (99%), Positives = 549/550 (99%) pirIIA41468 60K heat shock protein htpB - Legionella pneumophila Length = 550 5193.2 Best-BlastP =>> nrprot 10% dentities = 49/180 (27%), Positives = 75/180 (41%), Gaps= 40/180 (22%) refINP_229450: 1 j alpha-amylase, putative [Thermotoga maritima] pirIIG72227 hypothetical protein TM1650 - Thermotoga maritima (strain MSB8) gbIAAD36717.1 jAE001807_8 alpha-amylase, putative [Thermotoga maritima] Length = 422 5194.1 Best -BlastP =>> nrprot 52% Identities = 74/157 (47%), Positives = 98/157 (62%), Gaps = 5/157 (3%) refZNP_00036504.1 j COG0046:

* Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Enterococcus faecium] Length = 738 5195.2 Best-BlastP =>> nrprot 69% dentities = 237/447 (53%), Positives = 312/447 (69%), Gaps = 4 / 447 (0%) refINP_718290.1 succinylarginine dihydrolase [Shewanella oneidensis MR-1] gbIAAN55734.1 jAE015710_2 succinylarginine dihydrolase [Shewanella oneidensis MR-1] Length = 444 52.1 Best-BlastP =>> nrprot 88% Identities = 52/66 ( 78%), Positive = 60/66 (90%) EmbICAB60050.1 ivrC [Legionella pneumophila] Length = 67 Best-BlastP =>> nrprot 62% Identities = 67/139 (48%), Positive = 92/139 ( 66%) refINP 440670.1 j hypothetical protein [Synechocystis sp. PCC 6803] spIP73321 jYI94_SYNY3 Hypothetical protein s1r1894 pirIIS77503 hypothetical protein sIr1894 - Synechocystis sp. (strain PCC 6803) dbjjBAA17350.1 ORF_ID: slr1894-hypothetical protein [Synechocystis sp. PCC 6803] Length = 156 protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gbIEAA24326.1 1 Outer membrane protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 202 Best-BlastP =>> nrprot 98% dentities = 162/163 (99%), Positives = 162/163 (99%) gbIAAC38179.1 l DotD [Legionella pneumophila] Length = 163 Best-BlastP =>> nrprot 98% dentities = 74/75 (98%), Positives = 75/75 (100%) gbIAAN17184. 1 1AF492466_2 ferrous iron transporter A [Legionella pneumophila] Length = 75 Best-BlastP =>> nrprot 70% dentities = 205/420 (48%), Positives = 305/420 (72%), Gaps = 2/420 (0% ) COG1301: 520.1 Best-BlastP =>> nrprot 77% Identifies = 489/756 (64%), Positives = 587/756 (77%), Gaps = 5/756 (0%) REFINP_820975. 1 DNA topoisomerase I [Coxiella burnetii RSA 493] gbIAAO91489.1 I DNA topoisomerase I [Coxiella burnetii RSA 493] Length = 765 Best-BlastP =>> nrprot 73% Identities = 122/217 (56%), Positives = 165/217 (76%), Gaps = 2/217 (0%) THI Thiocyanate hydrolase gamma subunit dbj1BAA28288.11 thiocyanate hydrolase gamma subunit Thiobacillus thioparus Length = 243 5202.2 Best-BlastP =>> nrprot 55% Identities = 46/92 50%), Positives = 57/92 (61%), Gaps = 2/92 (2%) spIO66187ISCNA_THITI Thiocyanate hydrolase alpha subunit dbjIBAA28287.1 I thiocyanate hydrolase alpha subunit [Thiobacillus thioparus] Length = 126 5204.2 Best-BlastP =>> nrprot 46% Identities = 56/110 (50%), Positives = 74/110 (67%), Gaps = 1/110 (0%) spIO66186jSCNB_THITI Thiocyanate hydrolase beta subunit dbjjBAA28286.1 thiocyanate hydrolase beta subunit [Thiobacillus thioparus] Length = 157 Best-BlastP =>> nrprot 73% Identities = 212/360 (58%), Positives = 272/360 (75%), Gaps = 2/360 (0%) reflZP_00138670.11 COG1706: Fl agellar basal-body P-ring protein [Pseudomonas aeruginosa UCBPP-PA14] Length = 440 Best-BlastP =>> nrprot 55% Identities = 34/86 (39%), Positives = 57/86 (66%), Gaps = 1 / 86 (1%) refINP_924146.1j hypothetical protein gs11200 [Gloeobacter violaceus] dbjIBAC89141.1! gsI1200 [Gloeobacter violaceus] Length = 96 Best-BlastP =>> nrprot 55% Identities = 239/722 (33%), Positives = 382/722 (52%), Gaps = 53/722 (7%) refINP_773225.1 I b116585 [Bradyrhizobium japonicum] dbjIBAC51850.1 I bII6585 [Bradyrhizobium japonicum USDA 110] Length = 861 Best-BlastP =>> nrprot 64% Identities = 127/282 (45%), Positives = 181/282 (64%), Gaps = 9/282 (3%) refINP_643189.11 pirin [Xanthomonas axonopodis pv. citri str. 306] [Xanthomonas axonopodis pv. citri str. 306] Length = 285 Best-BlastP =>> nrprot 76% Identities = 78/118 (66%), Positives = 95/118 (80%) refZep_00024696.1 l COG1484: DNA replication protein [Ralstonia metallidurans] Length = 268 Best -BlastP =>> nrprot 50% Identities = 98/254 (38%), Positives = 135/254 (53%), Gaps = 11/254 (4%) gbIAAM90719.11 TraN [Salmonella typhi] Length = 617 Best- BlastP =>> nrprot 26% Identities = 41/119 (34%), Positives = 58/119 (48%), Gaps = 16/119 (13%) refINP_052852.1 l hypothetical protein [Coxiella burnetii] pirIIS52231 hypothetical protein 160 - Coxiella burnetii embICAA59944.1 I orf 160 [Coxiella burnetii] gbIAAD33484.1IAFI31076_10 hypothetical protein [Coxiella burnetii] Length = 160 5224.2 Best-BlastP =>> nrprot No Hits found 5226.2 Best-BlastP =>> nrprot 76% Identities = 117 / 173 (67%), Positives = 138/173 (79%) refInP_744614.1 I translation initiation factor IF-3 [Pseudomonas putida KT2440] gbIAAN68078.11AE016439_13 translation initiation factor IF-3 [Pseudomonas putida KT2440] Length = 177 Best-Bl astP =>> nrprot 68% Identities = 34/63 (53%), Positives = 46/63 (73%), Gaps = 1/63 (1%) spIP13069IRL35_BACST 50S ribosomal protein L35 pirIIR5BS35 ribosomal protein L35 - Bacillus stearothermophilus embICAA34313. 1 unnamed protein product [Geobacillus stearothermophilus] Length = 66 Best-BlastP =>> nrprot 81% Identities = 108/142 (76%), Positives = 118/142 (83%) refINP_230221.1 J ribosomal protein L13 [Vibrio cholerae 01 biovar eltor str. N16961] pirIIB82308 ribosomal protein L13 VCO570 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAF93738.1 Ribosomal protein L13 [Vibrio cholerae 01 biovar eltor str. N16961] Length = 142 5200.2 5201.2 5206.1 5208.1 521.2 5216.2 5217.1 5219.1 5220.1 5227.2 5229.1 523.2 Best-BlastP =>> nrprot 48% Identifies = 87/267 (32%), Positives = 144/267 (53%), Gaps = 1 / 267 (0%) reflNP_252216.1I likely outer membrane protein [Pseudomonas aeruginosa PAOI] pirllD83204 likely outer membrane protein PA3526 [imported] - Pseudomonas aeruginosa (strain PAOI) gbjAAG06914.1IAE004773_3 probable outer membrane precursor protein [Pseudomonas aeruginosa PAOI] Length = 321 5232.1 Best-BlastP =>> nrprot 39% Identities = 94/302 (31%), Positives = 135/302 (44%), Gaps = 38/302 (12%) refJZP_00065012.1I COG0323: DNA mismatch repair enzyme (predicted ATPase ) [Microbulbifer degradans 2-40] Length = 630 5238.1 Best-BlastP =>> nrprot 71% Identities = 266/495 (53%), Positives = 354/495 (71%), Gaps = 5/495 (1%) reflZP_00067387.1 I COGO138: AICAR transformylase / IMP PurH cyclhydrolase (only IMP cyclohydrolase domain in Aful) [Microbulbifer degradans 2-40] Length = 526 524.2 Best-BlastP => > nrprot 69% Identities = 194/342 (56%), Positives = 241/342 (70%), Gaps = 2/342 (0%) refJNP_820684.1I dihydroorotase, homodimeric type [Coxiella burnetii RSA 493] gbjAAO91198.1 j dihydroorotase, homodimeric type [Coxiella burnetii RSA 493] Length = 351 5242.3 Best-BlastP =>> nrprot No Hits found 5243.2 Best-BlastP =>> nrprot No Hits found 5247.1 Best-BlastP =>> nrprot 40% Identities 80/312 ( 25%), Positives = 141/312 (45%), Gaps = 26/312 (8%) refjZP_00110262.1 hypothetical protein [Nostoc punctiform] Length = 348 5250.2 Best-BlastP =>> nrprot 86% Identities = 234 / 324 (72%), Positives = 280/324 (86%), dehydrogenase, El component, beta subunit, putative [Coxiella burnetii RSA 493] gbjAAO90183.1 dehydrogenase, El component, beta subunit, putative [Coxiella burnetii RSA 493] Length = 326 5253.1 Best-BlastP =>> nrprot 62% Identities = 92/196 (46%), Positives = 132/196 (67%), Gaps = 3/196 (1%) reflZP_00090036.1 COG4445 : Hydroxylase for synthesis of 2-methylthio-cis-ribozea tin in tRNA [Azotobacter vinelandii] Length = 200 5254.1 Best-BlastP =>> nrprot 53% Identities = 72/206 (34%), Positive = 121/206 (58%) ReflNP_820242.1 conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO90756.1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 206 5255.1 Best-BlastP =>> nrprot 54% Identities = 132/378 (34%), Positives = 210/378 (55%), Gaps = 8/378 (2%) refJZP_00087763.1 j COG1520: FOG: WD40- like repeat [Pseudomonas fluorescens PfO-1] Length = 440 5256.2 Best-BlastP =>> nrprot 98% Identities = 64/64 (100%), Positive = 64/64 (100%) gbjAAG40471.1 global regulator [Legionella pneumophila] Length = 64 526.2 Best-BlastP =>> nrprot 97% Identities = 202/207 (97%), Positives = 203/207 (98%) gbjAAM00600.1 j Rnase T [Legionella pneumophila] Length = 207 5266.2 Best-BlastP =>> nrprot 39% Identities = 212/1088 (19%), Positives = 439/1088 (40%), Gaps = 185/1088 (17%) %) pirjjT14867 interaptin slime mold (Dictyostelium discoideum) gblAAC34582.11 inter aptin [Dictyostelium discoideum] Length = 1738 5268.2 Best-BlastP =>> nrprot 54% Identities = 56/183 (30%), Positives = 107/183 (58%), Gaps = 6/183 (3%) refJNP_821059.1 conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO91573.1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 192 5269.1 Best-BlastP =>> nrprot No Hits found 5270.2 Best-BlastP =>> nrprot No Hits found 5273.1 Best -BlastP =>> nrprot 55% Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 3/101 (2%) refINP820129.1 I oligopeptide transporter, OPT family [Coxiella burnetii RSA 493] gblAAO90643.11 oligopeptide transporter, OPT family [Coxiella burnetii RSA 493] Length = 669 5277.3 Best-BlastP =>> nrprot 60% Identities = 186/328 (56%), Positives = 235/328 (71%), Gaps = 5/328 (1%) refINP_901482.1 dihydroorotate oxidase [Chromobacterium violaceum ATCC 12472] gbJAAQ59486.11 dihydroorate oxidase [Chromobacterium violaceum ATCC 12472] Length = 344 5278.3 Best-BlastP =>> nrprot No Hits found 528.2 Best-BlastP =>> nrprot 99% Identities = 200/201 (99%), Positives = 201/201 (100%) gblAAM00601.11 peroxynitrite reductase [Legionella pneumophila] Length = 201 5282.3 Best-BlastP =>> nrprot 44 % Identities = 20/54 (37%), Positive = 32/54 (59%) refIZP_00077653.11 COG0693: Putative intracellular protease / amidase [Methanosarcina barkeri] Length = 209 5288.1 Best-BlastP =>> nrprot 60% Identities = 60 / 130 (46%), Positives = 83/130 (63%), Gaps = 4/130 (3%) pirjIA60635 glutathione transferase (EC 2. 5.1.18), fosfomycin-modifying - Escherichia coli plasmid pSU961 transposon Tn2921 gbIAAA98399. 11 fosfomycin-resistance protein [Serratia marcescens] Length = 141 5289.2 Best-BlastP =>> nrprot 32% Identities = 49/169 (28%), Positives = 73/169 (43%), Gaps = 19/169 (11% ) aminoglycoside N (6 ') - acetyltransferase [Coxiella burnetii RSA 493] gbIAAO90351.11 aminoglycoside N (6') - acetyltransferase [Coxiella burnetii RSA 493] Length = 188 529.2 Best-BlastP =>> nrprot 99% Identities = 105/1 05 (100%), Positive = 105/105 (100%) gbIAAM00602.1 glutaredoxin-like protein [Legionella pneumophila] Length = 115 5295.1 Best-BlastP =>> nrprot 68% Identities = 218/435 (50%), Positive = 309/435 (71%) refINP_253162.11 PmbA protein [Pseudomonas aeruginosa PA01] pirlIB83086 PmbA protein PA4472 [imported] - Pseudomonas aeruginosa (strain PAOI) gblAAG07860.11AE004861_1 PmbA protein [Pseudomonas aeruginosa PAO1] Length = 449 5297.2 Best-BlastP =>> nrprot No Hits found 530.3 Best-BlastP =>> nrprot 50% Identities = 75/162 (46%), Positives = 100/162 (61%), Gaps = 3/162 (1%) refIZP_00129339.1 I hypothetical protein [Desulfovibrio desulfuricans G20] Length = 231 5307.3 Best-BlastP =>> nrprot 19% Identities = 64/234 (27%), Positives = 111/234 (47%), Gaps = 23/234 (9%) refINP_820063 Hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90577.11 hypothetical protein [Coxiella burnetii RSA 493] Length = 468 5309.1 Best-BlastP =>> nrprot 84% Identities = 196/267 (73%), Positives = 234/267 ( 87%) refINP_743889.1 I septum site-determining protein MinD [Pseudomonas putida KT2440] gblAAN67353.11AE016361_7 septum site-determining protein MinD [Pseudomonas putida KT2440] Length = 270 531.4 Best-BlastP =>> nrprot No Hits found 5311.1 Best-BlastP =>> nrprot 58% Identities = 43/94 (45%), Positives = 58/94 (61%) REFIZP_00090060.1 I COG0721: Asp-tRNAAsn / Glu-tRNAGIn amidotransferase C subunit [Azotobacter vinelandii] Length = 146 5312.2 Best-BlastP = >> nrprot 99% Identities = 206/208 (99%), Positives = 207/208 (99%) gbIAAF05324.21 unknown virulence protein [Legionella pneumophila] Length = 208 5313.1 Best-BlastP =>> nrprot 32% Identities = 28 / 91 (30%), Positives = 46/91 (50%), Gaps = 6/91 (6%) ReflNP_520202.1 PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] EmbiCAD15788.11 PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 176 5316.1 Best-BlastP =>> nrprot 41% Identities = 200/203 (98%), Positives = 203/203 (100%) gbJAAF05325.11 unknown virulence protein [Legionella pne umophila] Length = 205 5317.2 Best-BlastP =>> nrprot 65% Identities = 94/204 (46%), Positives = 136/204 (66%), Gaps = 1/204 (0%) reflZP_00067804.1 J hypothetical protein [Microbulbifer degradans 2-40] Length = 206 5318.2 Best-BlastP =>> nrprot 34% Identities = 47/115 (40%), Positives = 72/115 (62%) ReflNP_790719.1 Preserved hypothetical protein [Pseudomonas syringae pv . tomato str. DC3000] gblAAO54414.11 conserved hypothetical protein [Pseudomonas syringae pv. tomato str. DC3000] Length = 249 5319.1 Best-BlastP =>> nrprot No Hits found 532.2 Best-BlastP =>> nrprot 57% Identities = 132/383 (34%), Positives = 215/383 (56%), Gaps = 24 / 383 (6%) refINP_718711.1 conserved hypothetical protein [Shewanella oneidensis MR-1] gbIAAN56155. 11AE015753_I conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 374 5321.1 Best-BlastP =>> nrprot 43% Identities = 27/53 (50%), Positives = 38/53 (71%), Gaps = 2/53 ( 3%) gblAAP84173.1 I conserved hypothetical protein [Pseudomonas aeruginosa] Length = 744 5322.1 Best-BlastP =>> nrprot 58% Identities = 36/102 (35%), Positive = 61/102 (59%), Gaps = 3 / 102 (2%) refINP_816469.1 Preserved domain protein [Enterococcus faecalis V583] gbIAAO82539.11 conserved domain protein [Enterococcus faecalis V583] Length = 104 Best-BlastP =>> nrprot 51% Identities = 72/194 (37%) , Positives = 113/194 (58%), Gaps = 2/194 (1%) refINP_719033.1 I AcrB / AcrD / AcrF family protein [Shewanella oneidensis MR-1] gblAAN56477. 11AE015784_10 AcrB / AcrD / AcrF family protein [Shewanella oneidensis MR-1] Length = 1046 Best-BlastP =>> nrprot 41% Identities = 34/123 (27%), Positive = 62/123 (50%), Gaps = 4 / 123 (3%) refINP_692567.1 l transposase for 18652 [Oceanobacillus iheyensis HTE831] dbjlBAC13602.11 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 402 533.2 Best-BlastP =>> nrprot 64% Identities = 122/264 (46% ), Positives = 172/264 (65%), Gaps = 8/264 (3%) refINP_246208.1 I AroE [Pasteurella multocida] splP57932IAROE_PASMU Shikimate 5-dehydrogenase gbJAAK03355.1 AroE [Pasteurella multocida] Length = 269 5334.1 Best-BlastP =>> nrprot 32% Identities = 70/121 (57%), Positives = 83/121 (68%), Gaps = 9/121 (7%) gbIAAQ82687.1 I Epa5p [Candida glabrata] Length = 1218 5337.1 Best- BlastP =>> nrprot 69% Identities = 49/91 (53%), Positive = 68/91 (74%) gbJAAP83334.11AF469614_2 unknown [Francisella tularensis subsp. tularensis] Length = 94 5338.2 Best-BlastP =>> nrprot 30% Identities = 78/169 (46%), Positives = 111/169 (65%), Gaps = 2/169 (1%) gbIAAN34371.11 ORF1 transposase [ Acinetobacter baumannii] Length = 180 5340.1 Best-BlastP =>> nrprot 14% Identities = 40/136 (29%), Positives = 73/136 (53%), Gaps = 19/136 (13%) gblAAA67447.1 J P120 Length = 232 5324.1 5328.1 5341.1 Best-BlastP =>> nrprot No Hits found 5342.2 Best-BlastP =>> nrprot 60% Identities = 87/178 (48%), Positives = 113/178 (63%), Gaps = 5 / 178 (2%) refINP_819838.1 J transcriptional regulator, TetR family [Coxiella burnetii RSA 493] gblAAO90352.1 1 transcriptional regulator, TetR family [Coxiella burnetii RSA 493] Length = 193 5344.2 Best-BlastP =>> nrprot 21% Identities = 36/77 (46%), Positives = 48/77 (62%), Gaps = 1/77 (1%) refjZP_00028865.1 hypothetical protein [Burkholderia fungorum] Length = 123 5349.3 Best-BlastP =>> nrprot 15% Identities = 65/306 (21%), Positives = 140/306 (45%), Gaps = 40/306 (13%) dbjIBAC86266.1 1 unnamed protein product [Homo sapiens] Length = 486 5354.3 Best-BlastP =>> nrprot No Hits found 5359.2 Best-BlastP =>> nrprot 43% Identities = 22/59 (37%), Positives = 36/59 (61%) refINP_637282. 1 I flagellar protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gblAAM41206.1 J flagellar protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 135 536. 3 Best-BlastP =>> nrprot 69% Identities = 459/876 (52%), Positives = 600/876 (68%), Gaps = 23/876 (2%) refINP_744167.1 aminopeptidase N [Pseudomonas putida KT2440] gbJAAN67631.1 JAE016392_12 aminopeptidase N [Pseudomonas putida KT2440] Length = 885 5360.2 Best-BlastP =>> nrprot No Hits found 5361.2 Best-BlastP =>> nrprot 68% Identities = 179/380 (47% ), Positives = 261/380 (68%), Gaps = 3/380 (0%) refINP_746466.1 J flagellar biosynthetic protein FIhB [Pseudomonas putida KT2440] gblAAN69930.1 jAE016632_1 flagellar biosynthetic protein FIhB [Pseudomonas putida KT2440] Length = 380 5369.2 Best-BlastP =>> nrprot 72% Identities = 47/68 (69%), Positive = 58/68 (85%) refINP_639162.1 130S ribosomal protein S21 [Xanthomonas campestris pv. campestris str. ATCC 33913] refINP_644178.1 130S ribosomal protein S21 [Xanthomonas axonopodis pv. citri str.

  306] spIQ8NL04JRS21_XANAC 30S ribosomal protein S21 gbIAAM38714.1 130S ribosomal protein S21 [Xanthomonas axonopodis pv. citri str. 306] gbIAAM43491.1 130S ribosomal protein S21 [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 71 537.2 Best-BlastP =>> nrprot No Hits found 5370.1 Best-BlastP =>> nrprot 97% Identities = 142/147 (96%), Positives = 144/147 (97%), Gaps = 1 / 147 (0%) gblAAB09541.1 LporfX Length = 146 5373.1 Best-BlastP =>> nrprot No Hits found 5376.2 Best-BlastP =>> nrprot 25% Identities = 185/917 (20%), Positives = 352/917 ( 38%), Gaps = 160/917 (17%) gblEAA15312.1 j hypothetical protein [Plasmodium yoelii yoelii] Length = 1527 5377.2 Best-BlastP =>> nrprot No Hits found 538.1 Best-BlastP =>> nrprot No Hits found 5380.3 Best-BlastP =>> nrprot 49% Identities = 52/160 (32%), Positives = 91/160 (56%), Gaps = 5/160 (3%) refINP_248967.1I hypothetical protein [Pseudomonas aeruginosa PA01] pirlID83612 hypothetical PA0276 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG03665. PAO271 [Pseudomonas aeruginosa PAO1] Length = 171 5381.1 Best-BlastP =>> nrprot No Hits found 5382.1 Best-BlastP =>> nrprot No Hits found 5386.1 Best-BlastP =>> nrprot 67% Identities = 170/327 ( 51%), Positives = 225/327 (68%), Gaps = 3/327 (0%) refINP_844883,1 oxidoreductase, NAD-binding [Bacillus anthracis str. Ames] gbJAAP26369.1! oxidoreductase, NAD-binding [Bacillus anthracis str. Ames] Length = 341 5387.1 Best-BlastP =>> nrprot 67% Identities = 128/249 (51%), Positives = 169/249 (67%), Gaps = 2/249 (0%) gblAAM51645.11 putative transposase [ Francisella tularensis subsp. tularensis] Length = 247 5388.1 Best-BlastP =>> nrprot No Hits found 539.3 Best-BlastP =>> nrprot 61% Identities = 107/144 (74%), Positives = 123/144 (85%) emblCAB46580.1 l 1S1400 transposase B [Yersinia enterocolitica] Length = 294 5390.1 Best-BlastP =>> nrprot 41% Identities = 30/89 (33%), Positives = 51/89 (57%) refINP_716406.1! conserved hypothetical protein [Shewanella oneidensis MR-1] gblAAN53851.1 IAE015522_6 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 100 5391.2 Best-BlastP =>> nrprot 58% Identities = 192/471 (40%), Positives = 283 / 471 (60%), Gaps = 5/471 (1%) refINP_840383.1 J conserved hypothetical protein [Nitrosomonas europaea ATCC19718] encRAD19207.1 conserved hypothetical protein [Nitrosomonas europaea ATCC19718] Length = 510 5398.3 Best-BlastP => nrprot 66% Identities = 173/351 (49%), Positives = 237/351 (67%) COG4972: Tfp pilus assembly protein, PiP ATPase [Pseudomonas fluorescens PfO-1] Length = 354 540.3 Best-BlastP =>> nrprot 72% Identities = 58/101 (57%), Positives = 78/101 (77%) EmbICAB46580.1 IS1400 transposase B [Yersinia enterocolitica] Length = 294 5402.1 Best-BlastP =>> nrprot No Hits found 5404.2 Best- BlastP =>> nrprot No Hits found 5405.2 Best-BlastP =>> nrprot 98% Identities = 314/322 (97%), Positives = 319/322 (99%) gbIAAM00613.11 chemiosm otic B-like protein [Legionella pneumophila] Length = 322 5406.1 Best-BlastP =>> nrprot 34% Identities = 109/300 (36%), Positives = 175/300 (58%), Gaps = 15/300 (5%) refINP_902623.1 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gbIAAQ60621. 11 = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 1390 5412.1 Best-BlastP =>> nrprot 72% Identities = 190/322 (59%), Positives = 232/322 (72%), Gaps = 6/322 (1) %) refINP_638907.11 conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gblAAM42831.11 conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 323 5413.1 Best-BlastP =>> nrprot No Hits found 5417.1 Best-BlastP =>> nrprot 59% Identities = 50/137 (36%), Positives = 82/137 (59%), Gaps = 9 / 137 (6%) refINP 487806.1 j two-component response regulator [Nostoc sp. CPC 7120] pirIIAG2276 two-component response regulator a1I3766 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB75465.1 The two-component response regulator [Nostoc sp. PCC 7120] Length = 143 5420.1 Best-BlastP =>> nrprot 49% Identities = 42/134 (31%), Positives = 67/134 (50%), Gaps = 20/134 (14%) gbIAAH41716.1 I Similar to myosin, heavy polypeptide 4, skeletal muscle [Xenopus laevis] Length = 1170 5421.1 Best-BlastP =>> nrprot No Hits found 5422.1 Best-BlastP =>> nrprot No Hits found 5423.1 Best-BlastP =>> nrprot 64% Identities = 36/75 (48%), Positive = 50/75 (66%) refINP_252731.11 exodeoxyribonuclease VII small subunit [Pseudomonas aeruginosa PAOI] ref! ZP_00137487.1 COG1722: Exonuclease VII small subunit [Pseudomonas aeruginosa UCBPP-PA14] spIQ9HWY5! EX7S_PSEAE Probable exodeoxyribonuclease VII small subunit (Exonuclease VII small subunit) pir11E83139 exodeoxyribonuclease VII small subunit PA4042 [imported] - Pseudomonas aeruginosa (strain PAO1) gblAAG07429.1 JAE004821_2 exodeoxyribonuclease VII small subunit [Pseudomonas aeruginosa PAOI] Length = 80 5424.2 Best-BlastP =>> nrprot No Hits found 5426.2 Best-BlastP =>> nrprot 71% Identities = 86/142 (60%), P ositive = 109/142 (76%), Gaps = 2/142 (1%) refJNP_820558.11 tolR protein [Coxiella burnetii RSA 493] gblAAO91072.1 tolR protein [Coxiella burnetii RSA 493] Length = 147 5427.1 Best-BlastP = >> nrprot 68% Identities = 114/225 (50%), Positives = 154/225 (68%), Gaps = 4/225 (1%) COG0811: Biopolymer transport proteins [Pseudomonas fluorescens PfO-1] Length = 231 5428.1 Best-BlastP =>> nrprot 53% Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 1/116 (0%) refINP_404733.1 I conserved hypothetical protein [ Yersinia pestis] reflNP_670358.1! hypothetical protein [Yersinia pestis KIM] pirlIAH0137 conserved hypothetical protein YPO1120 [imported] - Yersinia pestis (strain CO92) [insert name] [pdf] I conserved hypothetical protein [Yersinia pestis CO92] gbJAAM86609.1 IAE013907_3 hypothetical protein [KIM Yersinia pestis] Length = 133 5429.1 Best -BlastP =>> nrprot 56% - Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 2/73 (2%) refINP 819889.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90403.11 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 82 543.1 Best-BlastP =>> nrprot No Hits found 5437.2 Best-BlastP =>> nrprot No Hits found 5438.1 Best-BlastP =>> nrprot 73% Identities = 114 / 187 (60%), Positives = 144/187 (77%) COG1207: N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Microbulbifer degradans 2-40] Length = 451 544.2 Best-BlastP =>> nrprot 76% Identities = 265/446 (59%), Positives = 337/4 46 (75%), Gaps = 5/446 (1%) refZep_00138105.1 I COG2204: Response regulator containing Chey-like receptor, AAA-type ATPase, and DNA-binding domains [Pseudomonas aeruginosa UCBPP-PA14] Length = 597 5440.1 Best- BlastP =>> nrprot No Hits found 5446.3 Best-BlastP =>> nrprot 62% Identities = 188/449 (41%), Positives = 279/449 (62%), Gaps = 12/449 (2%) gbjAAP74578 .1 kynurenin 3monooxygenase [Polaribacter filamentus] Length = 469 5447.1 Best-BlastP =>> nrprot 51% Identities = 88/224 (39%), Positives = 129/224 (57%), Gaps = 8/224 (3%) ReflNP_484370.1 I unknown protein [Nostoc sp. PCC 7120] pirIIAE1847 hypothetical protein aII0326 [imported] - Nostoc sp. (strain PCC 7120) dbj! BAB72284.1 ORF_ID: aII0326 - unknown protein [Nostoc sp. PCC 7120] Length = 224 5448.1 Best-BlastP =>> nrprot 35% Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 7/120 (5%) spIP45790IGSPC AERHY GENERAL SECRET PATHWAY PROTEIN C embICAA47125.1 J ExeC [Aeromonas hydrophila] Length = 290 Best-BlastP =>> nrprot 68% Identities = 171/344 (49%), Positives = 242/344 (70%), Gaps = 1/344 (0 %) refINP_819316.1 major facilitator family transporter [Coxiella burnetii RSA 493] gblAAO89830.1 Major facilitator family transporter [Coxiella burnetii RSA 493] Length = 458 Best-BlastP =>> nrprot 64% Identities = 71/152 (46%) , Positives = 101/152 (66%) COG5528: Predicted integral membrane protein [UCBPP-PA14 Pseudomonas aeruginosa] Length = 155 Best-BlastP =>> nrprot 99% Identities = 225/226 (99%), Positive = 226/226 (100%) gbIAAQ18123.1 CpxR [Legionella pneumophila] Length = 226 Best-BlastP =>> nrprot 57% Identities = 52/117 (44%), Positives = 77/117 (65%) refINP_384234. 1 I PUTATIVE CYTIDINE DEAMINASE PROTEIN [Sinorhizobium meli loti] embICAC41515. 1 I PUTATIVE CYTIDINE DEAMINASE PROTEIN [Sinorhizobium meliloti] Length = 152 5458.1 Best-BlastP =>> nrprot 53% Identities = 32/96 (33%), Positive = 52/96 (54%), Gaps = 2/96 (2 %) gblAAN34371.11 ORF1 transposase [Acinetobacter baumannii] Length = 180 5460.1 Best-BlastP =>> nrprot 56% Identities = 147/325 (45%), Positives = 206/325 (63%), Gaps = 10/325 ( 3%) refINP_189431.21 DegP protease [Arabidopsis thaliana] gblAAK62640.1 I K16N12.18 / K16N12.18 [Arabidopsis thaliana] gblAAM47381.11 At3g27925 / K16N12.18 [Arabidopsis thaliana] Length = 439 5462.2 Best-BlastP =>> nrprot 66% Identities = 270/541 (49%), Positives = 367/541 (67%), Gaps = 6/541 (1%) refINP_819168.1! penicillinbinding protein 3 [Coxiella burnetii RSA 493] gbJAAO89682.11 Penicillinbinding Protein 3 [Coxiella burnetii RSA 493] Length = 548 5467.1 BestBlastP =>> nrprot No Nits found 5469.1 Best-BlastP =>> nrprot 70% Identities = 24/55 (43 %), Positive = 40/55 (72%) ref1NP_438830.1 I hypothetical protein [Haemophilus influenzae Rd] spIP44814IDTD_HAEIN D-tyrosyl-tRNA (Tyr) deacylase pirIIE64156 hypothetical protein HI0670 Haemophilus influenzae (strain Rd KW20) pdbI1J7GIA Chain A, Structure Of Yihz From Haemophilus Influenzae (Hi0670), D-Tyr-Trna (Tyr) Deacylase gblAAC22330.11 conserved hypothetical protein [Haemophilus influenzae Rd] Length = 144 5470.1 Best-BlastP =>> nrprot 76% Identities = 58/83 (69% ), Positives = 65/83 (78%) refGZP_00083364.1 1 COG1490: D-Tyr-tRNAtyr deacylase [Pseudomonas fluorescens PfO-1] Length = 145 5471.2 Best-BlastP =>> nrprot 59% Identities = 30/57 (52) %), Positives = 41/57 (71%) refINP_773232.1 I bsr6592 [Bradyrhizobium japonicum] dbjIBAC51857.1 bsr6592 [Brady rhizobium japonicum USDA 110] Length = 95 5473.1 Best-BlastP =>> nrprot 73% Identities = 154/270 (57%), Positives = 197/270 (72%), Gaps = 5/270 (1%) refZep_00029131.11 COG3243: Poly (3hydroxyalkanoate) synthetase [Burkholderia fungorum] Length = 642 5474.2 Best-BlastP =>> nrprot 42% Identities = 44/134 (32%), Positives = 73/134 (54%), Gaps = 2/134 ( 1%) refGZP_00027817.1 I COG0454: Histone acetyltransferase HPA2 and related acetyltransferases [Burkholderia fungorum] Length = 174 5476.1 Best-BlastP =>> nrprot 54% Identities = 48/106 (45%), Positive = 67/106 (63% ) Gaps = 1/106 (0%) refINP_759432.11 HesB family protein [Vibrio vuinificus CMCP6] gbIAAO08959.11AE016798_119 HesB family protein [Vibrio vulnificus CMCP6] Length = 107 5477.1 Best-BlastP =>> nrprot 57% Identities = 36 / 84 (42%), Positives = 55/84 (65%), Gaps = 1/84 (1%) ref1NP_873022.11 DNA-binding protein [Haemophilus ducreyi 35000HP] gbIAAP95411.1 DNA-binding protein [Haemophilus ducreyi 35000HP] Length = 98 5453.2 5455.1 5456.1 5457.1 5478.2 Best-BlastP =>> nrprot 28% Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 13/102 (12%) spIQ9W751 IPIX1 XENLA Pituitary homeobox 1 (X-PITX -1) (xPitxl) gbIAAD45292.11AF155206_1 homeodomain transcription factor Pitx-1 [Xenopus laevis] Length = 305 5479.2 Best-BlastP =>> nrprot 51% Identities = 62/169 (36%), Positive = 102/169 (60% ), Gaps = 2/169 (1%) gblAAN46162.11 unknown protein [Synechococcus sp. PCC 7942] Length = 208 548.3 Best-BlastP =>> nrprot No Hits found 5481.1 Best-BlastP =>> nrprot 50% Identities = 143/306 (46%), Positives = 192/306 (62%), Gaps = 1 / 306 (0%) COG0790: FOG: TPR repeat, SEL1 subfamily [Magnetococcus sp. MC-1] Length = 831 5482.2 Best-BlastP =>> nrprot 41% Identities = 75/284 (26%), Positives = 124/284 (43%), Gaps = 17/284 (5%) spI 05780911 Al D_PYRHO Putative 1-aminocyclopropane-1-carboxylate deaminase (ACC deaminase) pdbllJOAIA Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue pdbI1JOAIB Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue pdbI1JOAIC Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue pdbI1JOBIA Chain A, Crystal Structure Analysis Of The Acc Deaminase Complex Counterpart With Inhiitor pdbI1JOBIB Chain B, Crystal Structure Analysis Of The Acc Deaminase Complex Counterpart With Inhiitor pdbllJOBIC Chain C, Crystal Structure Analysis Of The Acc Deaminase Complex Counterpart With Inhiitor pdbl1J0BID Chain D, Crystal Structure Analysis Of The Acc Deaminase Complex Counterpart With Inhiitor pdbI1JOBIE Chain E, Crystal Structure Analysis Of The Acc Deaminase Complex Counterpart With Inhiitor pdbI1JOBIF Chain F, Crystal Structure Analysis Of The Deaminase Acc Accelerate Complexed With Iniitor pdbJ1JOBIG Chain G, Crystal Structure Analysis Of The Deaminase Compl Comp Acc (5484.4 Best-BlastP =>> nrprot No Hits found 5489.2 Best-BlastP =>> nrprot 52% Identities = 64/189 ( 33%), Positives = 107/189 (56%), Gaps = 8/189 (4%) refINP_882264.11 putative exported protein [Bordetella pertussis] refINP_886390.1 putative exported protein [Bordetella parapertussis] refINP_891381.11 putative exported protein [Bordetella bronchiseptica] embICAE44018.1 putative exported protein [Bordetella pertussis] embICAE39540.1 putative exported protein [Bordetella parapertussis] embJCAE35211.11 putative exported protein [Bordetella bronchiseptica] Length = 207,549.5 Best-BlastP =>> nrprot 27% Identities = 60/253 (23%), Positive = 108/253 (42%), Gaps = 12/253 (4%) refINP638097.1 I conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gbIAAM42021.11 conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 618 5492.2 Best-BlastP =>> nrprot 77% Identities = 105/178 (58%), Positives = 145/178 (81%) refINP251274.1 I CDP-diacylglycerol-glycerol-3-phosphate 3 Phosphatidyltransferase [Pseudomonas aeruginosa PA01] pine B83322 CDPdiacylglycerol-glycerol-3-phosphate-3-phosphatidyltransferase PA2584 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG05972.11AE004687_1 CDP-diacylglycerol-glycerol-3-phosphate-3-phosphatidyltransferase [Pseudomonas aeruginosa PAO1 Length = 186 5496.2 Best-BlastP =>> nrprot 95% Identities = 168/175 (96%), Positives = 171/175 (97%) EmbICAB65201.1 I hypothetical protein [Legionella pneumophila] Length = 356 5497.1 Best-BlastP =>> nrprot 98% Identities = 328/334 (98%), Positives = 330/334 (98%) emblCAB65202.1 J WecA protein [Legionella pneumophila] Length = 334 5498.1 Best-BlastP =>> nrprot 99% Identities = 317/318 (99%), Positives = 318/318 (100%) EmbJCAB65203.1 J hypothetical protein [Legionella pneumophila] Length = 318 5499.1 Best-BlastP => > nrprot 99% Identities = 291/291 (100%), Positives = 291/291 (100%) embICAB65204.1 I RmIA protein [Legionella pneumophila] Length = 291 55.1 Best-BlastP =>> nrprot 98% dentities = 125 / 128 (97%), Positives = 127/128 (99%) gblAAM08236.1 J LvrB [Legionella pneumophila] Length = 150 5500.1 Best-BlastP =>> nrprot 98% Identities = 484/494 (97%), Positives = 486 / 494 (98%), Gaps = 2/494 (0%) spIQ9RDY2IG6PI_LEGPN Glucose-6E phosphate isomerase (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) embjCAB65205.1 j Gpi protein [Legionella pneumophila] Length = 497 5504.4 Best-BlastP =>> nrprot No Hits found 551.2 Best-BlastP =>> nrprot 64% Identities = 122/243 (50%), Positives = 163/243 (67%), Gaps = 3/243 (1 %) refJZP_00039313.1 j COG1028: Dehydrogenases with different specificities (Xylella fastidiosa Dixon) Length = 245 5514.2 Best-BlastP =>> nrprot 32% Identities = 56/241 (23%), Positive = 110/241 (45%), Gaps = 36/241 (14%) gbIEAA1 6038.1 d repeat organellar protein-related [Plasmodium yoelii yoelii] Length = 1441 5515.2 Best-BlastP =>> nrprot 78% Identities = 149/249 (59%), Positives = 197/249 (79%) reflNP_251642.11 electron transfer flavoprotein betasubunit [Pseudomonas aeruginosa PA01] pirjjC83277 electron transfer flavoprotein beta-subunit PA2952 [imported] - Pseudomonas aeruginosa (strain PAOI) gbjAAG06340.1 jAE004721_8 electron transfer flavoprotein beta-subunit [Pseudomonas aeruginosa PAO1] Length = 249 5517.1 Best-BlastP =>> nrprot 50% Identities = 47/123 (38%), Positives = 65/123 (52%), Gaps = 14/123 (11%) refJZP_00087881.11 COG0357: Predicted Sadenosylmethionine-dependent methyltransferase involved in bacterial cell division [Pseudomonas fluorescens PfO - 1] Length = 138 5520.1 Best-BlastP =>> nrprot 38% dentities = 31/125 (24%), Positives = 57/125 (45%), Gaps = 4/125 (3%) refjNP_716604.1 j hypothetical protein [Shewanella oneidensis MR-1] gbIAAN54049. 11AE015542_5 hypothetical protein [Shewanella oneidensis MR-1] Length = 474 Best-BlastP =>> nrprot 61% dentities = 47/133 (35%), Positives = 83/133 (62%), Gaps = 1/133 (0% ) Length = 144 Best-BlastP =>> nprot 60% Identities = 157/327 (48%), Positive = conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gblAAQ61581.11 conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] 203/327 (62%), Gaps = 9/327 (2%) refGZP_00086640.1 COG1612: Uncharacterized protein required for cytochrome oxidase assembly [Pseudomonas fluorescens PfO-1] Length = 359 5524.1 Best-BlastP =>> nrprot 43% Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 25/180 (13%) refjNP_800052.1 j hypothetical protein VPA0542 [Vibrio parahaemolyticus RIMD 2210633] dbjjBAC61885.1 j hypothetical protein [Vibrio parahaemolyticus] Length = 178 5526.2 Best-BlastP =>> nrprot 30% Identities = 42/141 (29%), Positives = 64/141 (45%), Gaps = 2/141 (1%) refjZP_00081004.1 COG3637: Opac = protein protein protein [[[[[[[[[[[[[[[[[[[[Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length Length -acetylmuramoylalanine - D-glutamate ligase [Pseudomonas putida KT2440] gblAAN66958.11AE016324_8 UDP-Nacetylmuramoylalanine - D-glutamate ligase [Pseudomonas putida KT2440] Length = 450 5528.2 Best-BlastP =>> nrprot 99% Identities = 239/239 (100 %), Positive = 239/239 (100%) iconAB65196.11 hypothetical protein [Legionella pneumophila] Length = 239 553.1 Best-BlastP =>> nrprot No Hits found 5530.2 Best-BlastP =>> nrprot 68% Identities = 119/231 (51%), Positives = 161/231 (69%) reflNP_767647.1 J b111007 [Bradyrhizobium japonicum] dbjIBAC46272.1I bill 007 [Bradyrhizobium japonicum USDA 110] Length = 345 5532.2 Best-BlastP =>> nrprot 50% Identities = 86 / 270 (31%), Positives = 146/270 (54%), Gaps = 11/270 (4%) reflZP_00117263.1 COG3781: Predicted Membrane Protein [Cytophaga hutchinsonii] Length = 290 5533.2 Best-BlastP =>> nrprot 43% Identities = 28/84 (33%), Positives = 35/84 (41%), Gaps = 16/84 (19%) gbjAAO52009.1 j similar to exonuclease ii [Schizosaccharomyces pombe] [Dictyostelium discoideum] Length = 1749 5534.2 Best-BlastP =>> nrprot 98% Identities = 486/494 (98%), Positives = 489/494 (98%) gblAAK35046.11AF330136_2 type Il protein secretion ATPase LspE [Legionella pneumophila ] Length = 494 5535.1 Best-BlastP =>> nrprot No Hits found 5538.2 Best-BlastP =>> nrprot 75% Identities = 95/159 (59%), Positives = 121/159 (76%), Gaps = 1/159 (0%) ReflNP_819315.1 single-strand binding protein [Coxiella burnetii RSA 493] gblAAO89829.1 I single-strand binding protein [Coxiella burnetii RSA 493] Length = 158 5539.1 Best-BlastP =>> nrprot No Hits found 5540.1 Best- BlastP =>> nrprot 81% Identities = 90/126 (71%), Positive = 104/126 (82%) ref1NP_252927.1 1 50S ribosomal protein L17 [Pseudomonas aeruginosa PA0I] spIO52761 JRL17_PSEAE 50S ribosomal protein L17 pirIIC83113 50S ribosomal protein L17 PA4237 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAACO3117. 1 J ribosomal broad subunit protein L17 [Pseudomonas aeruginosa] gblAAG07625.11AE004841_3 50S ribosomal protein L17 [Pseudomonas aeruginosa PAO1] Length = 129 5542.3 Best-BlastP =>> nrprot 70% Identities = 120/255 (47%), Positive = 183 / 255 (71%), Gaps = 1/255 (0%) RefDNA_831729.1 Aminoglycoside 6-adenylyltransferase [Bacillus cereus ATCC 14579] gblAAP08930.11 Aminoglycoside 6-adenylyltransferase [Bacillus cereus ATCC 14579] Length = 290 5546.1 Best-BlastP = >> nrprot 73% Identities = 65/107 (60%), Positives = 79/107 (73%), Gaps = 1/107 (0%) refJNP_820379.1 I ErfK / YbiS / YcfS / YnhG family protein [Coxiella burnetii RSA 493] gbIAAO90893.1 I ErfK / YbiS / YcfS / YnhG family protein [Coxiella burnetii RSA 493] Length = 175 5548.1 Best-BlastP =>> nrprot No Hits found 5549.2 BestBlastP =>> nrprot 73% Identities = 134/229 ( 58%), Positives = 172/229 (75%), Gaps = 3/229 (1%) reflZP_00065236.1 I COG0847: DNA polymerase III, epsilon subunit and related 3'-5 'exonucleases [Microbulbifer degradans 240] Leng th = 238 555.2 Best-BlastP =>> nrprot 53% Identities = 110/317 (34%), Positives = 171/317 (53%), Gaps = 11/317 (3%) refINP_442295.1 I hypothetical protein [Synechocystis sp. PCC 6803] spIQ55724IY644_SYNY3 Hypothetical protein s1r0644 pirlIS76519 hypothetical protein Synechocystis sp. (strain PCC 6803) 0365.11 ORF_ID: siR0644-hypothetical protein [Synechocystis sp. PCC 6803] Length = 355 5550.3 Best-BlastP =>> nrprot 80% Identities = 334/503 (66%), Positives = 412/503 (81%), Gaps = 2/503 (0%) refINP_819973.11 cytochrome ubiquinol oxidase, subunit 1 [Coxiella burnetii RSA 493] gblAAO90487.1 J cytochrome d ubiquinol oxidase, subunit.I [Coxiella burnetii RSA 493] Length = 521 5552.2 Best-BlastP =>> nrprot 75% Identities = 232/378 (61% ), Positives = 287/378 (75%), Gaps = 2/378 (0%) gbJAAG01153.1 (AF284438_4 subunit cytochrome of oxidase [Brucella melitensis biovar Abortus] Length = 384 5554.2 Best-BlastP =>> nrprot No Hits found 5555.2 Best-BlastP =>> nrprot No Hits found 5556.1 Best-BlastP =>> nrprot No Hits found 5557.2 Best-BlastP =>> nrprot 42% Identities = 113/561 (20%), Positives = 251/561 (44% ), Gaps = 65/561 (11%) dbjJBAB40921.21 heavy chain myosin 2x [Bos taurus] Length = 1938 5559.3 Best-BlastP =>> nrprot No Hits found 5560.3 Best-BlastP =>> nrprot 54% Identities = 68 / 232 (29%), Positives = 116/232 (50%), Gaps = 21/232 (9%) refINP_923239.1 Probab carbonyl reductase [Gloeobacter violaceus] dbjIBAC88234.1 Jg1r0293 [Gloeobacter violaceus] Length = 243 5563.1 Best-BlastP =>> nrprot 54% Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 3/145 (2%) refNP841440.1 GCN5-related Nacetyltransferase [Nitrosomonas europaea ATCC 19718] EmbICAD85310.11 GCN5related N-acetyltransferase [Nitrosomonas europaea ATCC 19718] Length = 157 5564.1 Best-BlastP =>> nrprot 81% Identities = 322/475 (67%), Positives = 387/475 (81%), Gaps = 2/475 (0%) refINP 819499.11 dihydrolipoamide dehydrogenase [Coxiella burnetii RSA 493] gbJAAO90013.1 1 dihydrolipoamide dehydrogenase [Coxiella burnetii RSA 493] Length = 474 5566.1 Best-BlastP =>> nrprot 75% Identities = 38/55 (69%), Positives = 45/55 (81%) refINP_523225.1 I PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] embJCAD18817.11 PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solanacearum] Length = 72 5569.1 Best-BlastP =>> nrprot No Hits found 557.2 Best-BlastP =>> nrprot 75% Identifies = 517/898 ( 57%), Positive = 675/898 (75%), Gaps = 15/898 (1%) refINP820774.1 DNA polymerase I [Coxiella burnetii RSA 493] gbIAAO91288.1 DNA polymerase I [Coxiella burnetii RSA 493] Length = 895 5576.3 Best-BlastP =>> nrprot 26% Identities = 61/216 (28%), Positives = 87/216 (40%), Gaps = 25/216 (11%) refINP_662329.1 I hypothetical protein [Chlorobium tepidum TLS] gbIAAM72671.11 hypothetical protein [Chlorobium tepidum TLS] Length = 325 558.2 Best-BlastP =>> nrprot 34% Identities = 31/95 (32%), Positive = 53/95 (55%), Gaps = 9/95 (9%) gbJAAM15532.1 JAF482691_1 Probable sensor / response regulator hybrid [Pseudomonas aeruginosa] Length = 469 5582.4 Best-BlastP =>> nrprot 88% Identities = 584/737 (79%), Positive = 653/737 (88%) , Gaps = 3/737 (0%) gblAAM00624.1 I putative copper efflux ATPase [Legionella pneumophila] Length = 736 5584.2 5586.1 5587.3 5588.2 559.2 5592.2 5593.1 5595.2 5596.3 5598.2 Best-BlastP =>> nrprot 52% Identities = 188/189 ( 99%), Positives = 188/189 (99%) EmbICAC33489.1 I hypothesis etiological protein [Legionella pneumophila] Length = 189 Best-BlastP =>> nrprot 37% Identity = 32/76 (42%), Positive = 48/76 (63%) refINP_217688.1 I hypothetical protein Rv3172c [Mycobacterium tuberculosis H37Rv] refINP_337786 .1 1 hypothetical protein [Mycobacterium tuberculosis CDC1551] refINP_856842.1 1 HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp. bovis AF2122 / 97] pirjIB70948 hypothetical protein Rv3172c - Mycobacterium tuberculosis (strain H37RV) embICAA16637. 11 hypothetical protein Rv3172c [Mycobacterium tuberculosis H37Rv] gbIAAK47600.1 J hypothetical protein [Mycobacterium tuberculosis CDC1551] icGAD95289.1 1 HYPOTHETICAL PROTEIN [Mycobacterium bovis subsp.

  bovis AF2122 / 97] Length = 160 Best-BlastP =>> nrprot 61% Identities = 132/276 (47%), Positives = 173/276 (62%) refINP 229753.114hydroxybenzoate octaprenyltransferase [Vibrio cholerae 01 biovar eltor str. N16961] pirJIC82365 4-hydroxybenzoate octaprenyltransferase VO0094 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF93272.1 14-hydroxybenzoate octaprenyltransferase [Vibrio cholerae 01 biovar eltor str. N16961] Length = 284 Best-BlastP =>> nrprot 67% Identities = 33/98 (33%), Positives = 65/98 (66%), Gaps = 4/98 (4%) refINP_819561.1 J hypothetical protein [ Coxiella burnetii RSA 493] gblAAO90075.1 1 hypothetical protein [Coxiella burnetii RSA 493] Length = 96 Best-BlastP =>> nrprot 83% Identities = 78/107 (72%), Positives = 92/107 (85%) refINP_862496. 1 l hypothetical protein [Pseudomonas sp. ADP] gblAAK50291.11U66917_59 hypothetical protein [Pseudomonas sp. ADP] Length = 152 Best-BlastP =>> nrprot 81% Identities = 150/229 (65%), Positives = 188/229 (82%) COG0081: Ribosomal Protein L1 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 229 BestBlastP =>> nrprot 40% Identities = 30/79 (37%), Positives = 45/79 (56%) refINP755977.1 1 Hypothetical protein [Escherichia coli CFT073] gblAAN82551.1 jAE016767_311 Hypothetical protein [Escherichia coli CFT073] Length = 144 Best-BlastP =>> nrprot 72% Identities = 112/174 (64%), Positives = 127/174 (72%), Gaps = 18/174 (10%) refZNP_00123239.1 l COG0049: Ribosomal protein S7 [Haemophilus somnus 129PT] reflZP_00131785. 1 l hypothetical protein [Haemophilus somnus 2336] Length = 156 BestBlastP =>> nrprot 90% Identities = 109/123 (88%), Positive = 115/123 (93%) refINP 799152.1 Ribosomal protein S12 [Vibrio parahaemolyticus RIMD 2210633] spIQ87L43IRS12 VIBPA 30S ribosomal protein S12 dbjlBAC61036.1 ribosomal protein S12 [Vibrio parahaemolyticus] Length = 124 Best-BlastP =>> nrprot 66% Identities = 189/394 (47%), Positives = 264/394 (67%), Gaps = 2/394 (0%) refINP_820522.1 J tryptophan / tyrosine permease family protein [Coxiella burnetii RSA 493] gbIAAO91036.1 I tryptophan / tyrosine permease family protein [Coxiella burnetii RSA 493] Length = 426 5600.2 Best-BlastP =>> nrprot 72% Identities = 45/66 (68%), Positive = 55/66 (83%) refINP_747188.11 ribosomal protein L31 [Pseudomonas putida KT2440] gblAAN70652.1 1AE016709 4 ribosomal protein L31 [Pseudomonas putida KT2440] Length = 100 5602.3 Best-BlastP =>> nrprot 65% Identities = 60/155 (38%), Positives = 102/155 (65%), Gaps = 7/155 (4%) refINP_069835.1 con [Archaeoglobus fulgidus DSM 4304] pir1IB69375 phosphohistidine phosphatase (EC3.1.3.-) 6A-related [similarity] Archaeoglobus fulgidus gbIAAB90241.1 I conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304] Length = 151 5605.2 Best-BlastP =>> nrprot No Hits found 5606.2 Best-BlastP =>> nrprot No Hits found 5607.2 Best-BlastP =>> nrprot 64% Identities = 221/475 (46%), Positives = 306/475 (64%), Gaps = 6/475 (1%) refINP_654832.1 I hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] reflNP_843400.1 alginate 0-acetyltransferase, putative [Bacillus anthracis str.

  Ames] gblAAP24886.11 alginate 0-acetyltransferase, putative [Bacillus anthracis str. Ames] Length = 471 5609.1 Best-BlastP =>> nrprot 70% Identities = 60/84 (71%), Positives = 67/84 (79%) reflNP_819512.1 I hypothetical protein [Coxiella burnetii RSA 493] gblAAO90026.1 1 hypothetical protein [Coxiella burnetii RSA 493] Length = 92 561.3 Best-BlastP =>> nrprot 80% Identities = 305/432 (70%), Positives = 352/432 (81%), Gaps = 2/432 (0%) Probably ATPase associated with chromosome architecture [Chromobacterium violaceum ATCC 12472] Probable ATPase associated with chromosome architecture [Chromobacterium violaceum ATCC 12472] Length = 443 5610.1 Best-BlastP =>> nrprot 60% Identities = 47/109 43%), Positives = 67/109 (61%), Gaps = 1/109 (0%) refIgI_00092417.1 I hypothetical protein [Azotobacter vinelandii] Length = 137 5611.1 5615.1 Integrase [Azotobacter vinelandii] Length = 399 562.1 Best-BlastP =>> nrprot 59% Identities = 78/206 (37%), Positives = 120/206 (58%), Gaps = 6/206 (2%) reflZ_00091807.1 I COG2834: Outer membrane lipoprotein-sorting protein [Azotobacter vinelandii] Length = 207 5620.3 Best-BlastP =>> nrprot 51% Identities = 28/61 (45%), Positive = 39/61 (63%) refJNP_600458.1 predicted transcriptional regulator [Corynebacterium glutamicum ATCC 13032] dbjJBAB98628 .1 1 Predicted transcriptional regulators [Corynebacterium glutamicum ATCC 13032] Length = 75 5621.1 Best-BlastP =>> nrprot 35% Identities = 72/345 (20%), Positives = 148/345 (42%), Gaps = 30/345 (8%) ReflZP_00118987.11 COG0477: Permeases of the major superfamily facilitator [Cytophaga hutchinsonii] Length = 441 5623.2 Best-BlastP =>> nrprot 24% Identities = 57/252 (22%), Positives = 114/252 (45%) ), Gaps = 15/252 (5%) refjNP_484762.1 unknown protein [Nostoc sp. PCC 7120] pirjjAE1896 hypothetical protein a1r0719 [imported] - Nostoc sp. (strain PCC 7120) dbjIBAB72676.1 ORF_ID: alr0719 unknown [Nostoc sp. PCC 7120] Length = 393 5626.2 Best-BlastP =>> nrprot 56% Identities = 119/291 (40%), Positives = 169/291 (58%), Gaps = 10/291 (3%) reflZP_00091084.1 l COG0582 : Integrase [Azotobacter vinelandii] Length = 287 5630.1 Best-BlastP =>> nrprot 42% Identities = 47/154 (30%), Positives = 72/154 (46%), Gaps = 24/154 (15%) reflNP_519620. 1 j HYPOTHETICAL PROTEIN [Ralstonia solanacearum] embJCAD15201.11 HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 233 5633.2 Best-BlastP =>> nrprot 68% Identities = 143/273 (52%), Positives = 190/273 (69%), Gaps = 1/273 (0%) reflNP_790075.1 I diaminopimelate epimerase [Pseudomonas syringae pv. tomato str. DC3000] [Diaminopimelate epimerase (DAP epimerase) gbIAAO53770.1 I diaminopimelate epimerase [Pseudomonas syringae pv. tomato str. DC3000] Length = 276 Best-BlastP =>> nrprot 43% Identities = 35/61 (57%), Positive = 47/61 (77%) refIz_00092427.1 I hypothetical protein [Azotobacter vinelandii] Length = 838 Identities = 115 / 242 (47%), Positives = 150/242 (61%), Gaps = 31/242 (12%) refIZP_00090468.1 COG0582: Best-BlastP =>> nrprot 67% 5634.2 Best-BlastP =>> nrprot 58% Identities = 16/32 (50%), Positive = 25/32 (78%) refjZP_00068204.1 I hypothetical protein [Microbulbifer degradans 2-40] Length = 57 5636.1 Best-BlastP =>> No No Hits found 5637.1 Best-BlastP = >> nrprot 58% Identities = 86/198 (43%), Positives = 126/198 (63%), Gaps = 4/198 (2%) refINP_840924.1 Phospholipase / Carboxylesterase [Nitrosomonas europaea ATCC 19718] embICAD84761.11 Phospholipase / Carboxylesterase [Nitrosomonas europaea ATCC 19718] Length = 224 5638.2 Best-BlastP =>> nrprot No Hits found 564.2 Best-BlastP =>> nrprot 68% Identities = 417/792 (52%), Positives = 546/792 (68% ), Gaps = 28/792 (3%) refINP_251305.1 FtsK cell division protein [Pseudomon asparaginosa PA01] spIQ9I0M3JFTSK_PSEAE DNA transiocase ftsK pir1IE83318 cell division protein FtsK PA2615 [imported] - Pseudomonas aeruginosa (strain PAOI) gbIAAG06003. 11AE004690_3 cell division protein FtsK [Pseudomonas aeruginosa PAOI] Length = 811 5642.1 Best-BlastP =>> nrprot No Hits found 5644.3 Best-BlastP =>> nrprot 47% Identities = 193/498 (38%), Positives = 268/498 ( 53%), Gaps = 78/498 (15%) refINP_233251.1 hemagglutinin / protease [Vibrio cholerae 01 biovar eltor str. N16961] spIP24153IHAPT_VIBCH Hemagglutinin / proteinase precursor (HA / protease) (Vibriolysin) pirlIA42358 vibriolysin (EC 3.4.24.-) precursor [validated] - Vibrio cholerae (strain N16961 serogroup 01) gbIAAA27579.1 J HA / protease gbJAAF96763.1 I hemagglutinin / protease [Vibrio cholerae 01 biovar eltor str. N16961] Length = 609 5645.2 Best-BlastP =>> nrprot 82% Identities = 520/752 (69%), Positives = 622/752 (82%), Gaps = 9/752 (1%) refINP_251310.1! ATP-binding protease component CIpA [Pseudomonas aeruginosa PA0I] pir1IB83319 ATP-binding proteinase component CIpA PA2620 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG06008.11AE004690_8 ATP-binding protease component CIpA [Pseudomonas aeruginosa PAO1] Length = 758 5647.1 Best-BlastP =>> nrprot 62% Identities = 55/80 (68%), Positive = 70/80 (87%) refINP_642326.1 1 conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] spIQ8PL06ICLPS_XANAC ATP-dependent Clp protease adaptor protein cIpS gbIAAM36862.1 I conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 106 5648.1 Best-BlastP =>> nrprot 60% Identities = 42/112 (37%), Positives = 68/112 (60%) refINP_753425.1 I Hypothetical protein [Escherichia coli CFT073] gblAAN79985.1 1AE016759_259 Hypothetical protein [Escherichia coli CFT073] Length = 393 5649.1 Best-BlastP =>> nrprot 88% Identities = 327/418 (78%), Positives = 371/418 (88%) refINP_746141.1 I isocitrate dehydrogenase, NADP-dependent, prokaryotic -type [Pseudomonas putida KT2440] gblAAN69605.1 IAE016594_2 isocitrate dehydrogenase, NADP-dependent, prokaryotic-type [Pseudomonas putida KT2440] Length = 418 5650.3 Best-BlastP =>> nrprot 45% Identities = 67/239 (28%), Positive = 107/239 (44%), Gaps = 43/239 (17%) refINP_924301.1 I unknown protein [Gloeobacter violaceus] dbjIBAC89296.1 l gI11355 [Gloeobacter violaceus] Length = 278 5652.2 Best-BlastP =>> nrprot No Hits found 5654.2 Best-BlastP =>> nrprot No Hits found 5655.2 Best-BlastP =>> nrprot 58% Identities = 73/131 (55%), Positives = 94/131 (71%) reflZP_00108601.11 COG2193: Bacterioferritin (cytochrome b1) [Nostoc punctiform] Length = 144 5656.2 Best-BlastP =>> nrprot 15% Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 1/70 (1% ) refINP_171674.21 expressed protein [Arabidopsis thaliana] pir1IF86147 hypothetical protein T1 N6.5 [imported] - Arabidopsis thaliana gbf AAF78398.11A0009273_4 Contains similarity to a putative protein T2J13.100 gij6522560 from Arabidopsis thaliana BAC T2J13 gblAL132967 Length = 308 5660.1 Best-BlastP =>> nrprot 37% Identities = 69/275 (25%), Positives = 124/275 (45%), Gaps = 24/275 (8%) refINP_692096.1 J hypothetical protein [Oceanobacillus iheyensis HTE831] dbjlBAC13131.1 hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 314 5662.1 Best-BlastP =>> nrprot 65% Identities = 92/150 (61%), Positives = 116/150 (77%) refINP_819966.11 conserved hypothetical protein [Coxiella burnetii RSA 493 ] gbjAAO90480.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 414 5668.2 Best-BlastP =>> nrpro t 28% Identities = 100/406 (24%), Positives = 167/406 (41%), Gaps = 82/406 (20%) refINP_220907.1 I unknown [Rickettsia prowazekii] pirlIE71657 hypothetical protein RP534 - Rickettsia prowazekii embICAA14983. 1 unknown [Rickettsia prowazekii] Length = 598 5669.2 Best-BlastP =>> nrprot 43% Identities = 125/540 (23%), Positives = 240/540 (44%), Gaps = 44/540 (8%) ref! ZP_00044012.1 f hypothetical protein [Magnetococcus sp. MC-1] Length = 725 567.5 Best-BlastP =>> nrprot 46% Identities = 236/953 (24%), Positives = 425/953 (44%), Gaps = 81/953 (8%) refINP_052976.1 1 93% identical to sp: TRG1_ECOLI, gp: FPLTRAH_3 [TraG of plasmid F, responsible for pilus biogenesis and stabilization of mating pairs] [Plasmid R100] gbIAAD28728. TraG [Salmonella typhimurium] DbjIBAA78880.1 193% identical to sp: TRG1_ECOLI, gp: FPLTRAH_3 [TraG of plasmid F, responsible for pilus biogenesis and stabilization of mating pairs] [Plasmid R100] Length = 11AF112468_7 inner membrane and periplasmic mating pair stabilization protein 940 5671.2 Best-BlastP =>> nrprot 74% Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 3/123 (2%) refZGP_00122793.1 J COG1607: Acyl-CoA hydrolase [Haemophilus somnus 129PT] reflZP_00133225.1 J hypothetical protein [Haemophilus somnus 2336] Length = 154 5672.1 Best-BlastP =>> nrprot No Hits found 5675.2 Best-BlastP =>> nrprot 52% Identities = 113/338 (33%), Positives = 186/338 (55%), Gaps = 23/338 (6%) refINP_767510.1 I bII0870 [Bradyrhizobium japonicum] dbjlBAC46135.11 bI10870 [Bradyrhizobium japonicum USDA 110] Length = 329 Best-BlastP =>> nrprot 34% Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 21/164 (12%) gblEAA22028. 1 1 putative yir4 protein [Plasmodium yoelii yoelii] Length = 299 Best-BlastP =>> nrprot 83% Identities = 380/535 (71%), Positive = 448/535 (83%) refIOT 00082147. 1 I COG4799: Acetyl- CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Geobacter metallireducens] Length = 535 Best-BlastP =>> nrprot 99% Identities = 405/410 (98%), Positives = 408/410 (99%) gbJAAM00606.1 I unknown [Legionella pneumophila] Length 421 5686.2 Best-BlastP =>> nrprot 70% Identities = 85/154 (55%), Positive = 112/154 (72%) refINP_252654.1 Probable transcriptional regulator [Pseudomonas aeruginosa PAOI] reflZP_00137402. 1I COG1522: Transcriptional regulators [Pseudomonas aeruginosa UCBPP-PA14] pirIIF83150 probable transcription regulator PA3965 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG07352.11AE004814_7 probable transcriptional regulator [Pseudomonas aeruginosa PAOI] Length = 169 5687.1 Best-BlastP =>> nrprot No Hits found 5677.2 568.2 5685.2 Best-BlastP =>> nrprot 39% Identity s = 38/170 (22%), Positives = 75/170 (44%), Gaps = 33/170 (19%) gbIEAA16038.1 repeat organellar protein-related [Plasmodium yoelii yoelii] Length = 1441 Best-BlastP => > nrprot 64% Identities = 136/258 (52%), Positives = 170/258 (65%), Gaps = 1/258 (0%) refJZP_00082146.1I COG1024: Enzyme CoA hydratase / carnithine racemase [Geobacter metallireducens] Length = 263 Best-BlastP =>> nrprot 70% Identities = 75/146 (51%), Positives = 99/146 (67%), Gaps = 9/146 (6%) ReflNP 641722.1 I conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gbIAAM36258.1I conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 149 5694.2 Best-BlastP =>> nrprot 64% Identities = 70/152 (46%), Positives = 103/152 (67%), Gaps = 3/152 (1%) refINP_719482.1I mce-related protein [Shewanella oneidensis MR-1] gbIAAN56926.1IAE015826_11 mce-related protein [Shewanella oneidensis MR-1] Length = 157 5695.1 Best-BlastP =>> nrprot 77% Identities = 152/259 (58%), Positives = 202/259 (77%) refINP_931230.11 hypothetical protein [Photorhabdus luminescens subsp. laumondii TTO1] embICAE16405.11 unnamed protein product [Photorhabdus luminescens subsp. Iaumondii TTOI] Length = 260 5696.2 Best-BlastP =>> nrprot 77% Identifies = 168/258 (65%), Positives = 205/258 (79%) reflNP_794201.1! toluene tolerance ABC transporter, ATP binding protein, putative [Pseudomonas syringae pv. tomato str. DC3000] gbIAAO57896.1I toluene tolerance ABC transport, ATPbinding protein, putative [Pseudomonas syringae pv. tomato str. DC3000] Length = 269 57.1 Best-BlastP =>> nrprot 96% Identities = 272/289 (94%), Positives = 279/289 (96%) gbIAAM08235.1I LvrA [Legionella pneumophila] Length = 289 5701.2 Best-BlastP = >> nrprot 67% Identities = 179/375 (47%), Positives = 250/375 (66%), Gaps = 9/375 (2%) refINP 519920.1 I PUTATIVE DIHYDROLIPOAMIDE ACETYLTRANSFERASE (COMPONENT E2 OF PYRUVATE DEHYDROGENASE COMPLEX) PROTEIN [ Ralstonia solanacearum] pICICTIVE DIHYDROLIPOAMIDE ACETYLTRANSFERASE (COMPONENT E2 OF PYRUVATE DEHYDROGENASE COMPLEX) PROTEIN [Ralstonia solanacearum] Length = 372 571.2 Best-BlastP =>> nrprot 67% Identities = 336/671 (50%), Positive = 440 / 671 (65%), Gaps = 23/671 (3%) refGZP_00082145.1 I COG4770: Acetyl / propionyl-CoA carboxylase, alpha subunit [Geobacter metallireducens] Length = 668 5711.2 Best-BlastP =>> nrprot No Hits found 5719.2 Best -BlastP =>> nrprot 66% Identities = 116/246 (47%), Positives = 167/246 (67%), Gaps = 1/246 (0%) refJZP_00123187.1I COG0149: Triosephosphate isomerase [Ha emophilus somnus 129PT] Length = 255 572.2 Best-BlastP =>> nrprot 38% Identities = 161/480 (33%), Positives = 219/480 (45%), Gaps = 84/480 (17%) pirIIJC4908 alkaline serine proteinase (EC 3.4.-.-) I precursor - Alteromonas sp Length = 715 5720.1 Best-BlastP =>> nrprot No Hits found 5723.1 Best-BlastP =>> nrprot 69% Identities = 49/91 (53%), Positives = 68 / 91 (74%) gbIAAP83334.1 AF469614_2 unknown [Francisella tularensis subsp. tularensis] Length = 94 5724.2 Best-BlastP =>> nrprot No Hits found 573.1 Best-BlastP =>> nrprot 79% Identities = 52/94 (55%), Positives = 75/94 (79%) refINP_820064.1 I hypothetical protein [Coxiella burnetii RSA 493] gbIAAO90578.1I hypothetical protein [Coxiella burnetii RSA 493] Length = 94 5688.2 569.2 5690.2 5730.1 Best-BlastP =>> nrprot No Hits found 5735.2 Best-BlastP =>> nrprot 63% Identities = 181/388 (46%), Positive = 251/388 (64%), Gaps = 2/388 (0%) refINP820522.1 I tryptophan / tyrosine permease family protein [Coxiella burnetii RSA 493] gblAAO91036.1 tryptophan / tyrosine permease family protein [Coxiella burnetii RSA 493] Length = 426 5739.3 Best-BlastP =>> nrprot 31% Identities = 357/1425 (25%), Positives = 551/1425 (38%), Gaps = 320/1425 (22%) refINP_772111. [Bradyrhizobium japonicum] dbjlBAC50736.1 I b115471 [Bradyrhizobium japonicum USDA 110] Length = 4210 574.2 Best-BlastP =>> nrprot No Hits found 5741.1 Best-BlastP =>> nrprot 60% Identities = 76/174 (43% ), Positiv es = 116/174 (66%) COG0398: Uncharacterized conserved protein [Magnetococcus sp. MC-1] Length = 222 5743.1 Best-BlastP =>> nrprot No Hits found 5747.1 Best-BlastP =>> nrprot No Hits found 5761.1 Best-BlastP =>> nrprot 25% Identities = 26/72 (36%), Positive = 38/72 (52%), Gaps = 1/72 (1%) refINP_902894.1l probable dehydrogenase [Chromobacterium violaceum ATCC 12472] gblAAQ60890.11 probable dehydrogenase [Chromobacterium violaceum ATCC 12472] Length = 417 5765.1 Best-BlastP =>> nrprot 53% Identities = 39/100 (39%), Positive = 62/100 (62%) refINP_795325.1 ParB family protein [Pseudomonas syringae pv. tomato str. DC3000] gbJAAO59020.1 I ParB family protein [Pseudomonas syringae pv. tomato str. DC3000] Length = 290 5766.1 Best-BlastP =>> nrprot 34% Identities = 39/142 (27%), Positives = 62/142 (43%), Gaps = 18/142 (12%) REFINP 464180.1 I Imo0653 [Listeria monocytogenes EGD-e] pirIIAE1156 hypothetical protein Imo0653 [imported] - Listeria monocytogenes (strain EGD-e) emblCAC98731.1 j Imo0653 [Listeria monocytogenes] Length = 306 5767.1 Best-BlastP =>> nrprot No Hits found 5769.2 Best-BlastP => > nrprot 58% Identities = 52/126 (41%), Positives = 77/126 (61%), Gaps = 4/126 (3%) REFINP 251491.11 hypothetical protein [Pseudomonas aeruginosa PA01] pir1IA83296 hypothetical protein PA2801 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG06189.11AE0047078 hypothetical protein PA2801 [Pseudomonas aeruginosa PAOI] Length = 134 577.2 Best-BlastP =>> nrprot 37% Identities = 58/180 (32%), Positives = 107/180 (59%), Gaps = 1/180 (0%) refINP_624053.1 Predicted transposase [Thermoanaerobacter tengcongensis] gbJAAM25657.1 Predicted transposase [Thermoanaerobacter tengcongensis] Length = 267 5774.2 Best-BlastP =>> nrprot No Hits found 5776.1 Best-BlastP =>> nrprot No Hits found 5780.1 Best-BlastP =>> nrprot 61% Identities = 56/79 (70%), Positives = 63/79 (79 %) refINP_246141.1! HisF [Pasteurella multocida] spIQ9CLMOIHIS6_PASMU Imidazole glycerol phosphate synthase subunit hisF (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) gbIAAK03288.1 I HisF [Pasteurella multocida] Length = 256 5796.3 Best- BlastP =>> nrprot 46% Identities = 61/195 (31%), Positives = 92/195 (47%), Gaps = 26/195 (13%) refINP890659.1 I putative ringhydroxylating dioxygenase broad subunit [Bordetella bronchiseptica] embICAE34488 .1 I putative ring-hydroxylating dioxygenase broad subunit [Bordetella bronchiseptica] Length = 438 Best-BlastP =>> nrprot 95% Identities = 211/227 (92%), Positives = 217/227 (95%) gbIAAM08234.1 j putative phage repressor [Legionella pneumophila] Length = 227 Best-BlastP =>> nrprot 53% Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 12/137 (8%) refINP_229825.1j cytochrome c5 [Vibrio cholerae 01 biovar eltor str. N16961] pir1IF82355 cytochrome c5 VC0168 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gb1AAF93344.11 cytochrome c5 [Vibrio cholerae 01 biovar eltor str. N16961] Length = 135 5806.2 Best-BlastP =>> nrprot 75% Identities = 54/87 (62%), Positives = 67/87 (77%) refJZP_00125359.11 COG0268: Ribosomal protein S20 [Pseudomonas syringae pv. syringae B728a] refINP_790649.1 ribosomal protein S20 [Pseudomonas syringae pv. tomato str.

  DC3000] gbjAAO54344. Ribosomal protein S20 [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 92 5807. 1 Best-BlastP =>> nrprot 66% Identities = 48/113 (42%), Positives = 76/113 (67%) spIQ43948jHYPA_AZOCH Hydrogenase nickel incorporation protein hypA (Protein hupA) pirjjJN0646 hydrogenase expression / formation protein HupA - Azotobacter chroococcum gbjAAA22132 . 11 hydrogenase accessory protein HupA Length = 113 5808. 1 Best-BlastP =>> nrprot 48% Identities = 59/180 (32%), Positives = 87/180 (48%), Gaps = 13/180 (7%) gblAAA25680. 1 aminoglycoside 6'-Nacetyltransferase Length = 1805809. 1 Best-BlastP =>> nrprot No Hits found 5812. 1 Best-BlastP =>> nrprot 60% Identities = 57/154 (37%), Positives = 95/154 (61%), Gaps = 6/154 (3%) EmbJCAB60049. 11 IvrB [Legionella pneumophila] Length = 157 5813. 1 Best-BlastP =>> nrprot 65% Identities = 30/57 (52%), Positives = 43/57 (75%) embjCAB60050. 1 j IvC [Legionella pneumophila] Length = 67 5814. 1 Best-BlastP =>> nrprot 45% Identities = 38/121 (31%), Positives = 66/121 (54%), Gaps = 6/121 (4%) gbjAAL05416. 1 Piil [Yersinia pseudotuberculosis] Length = 356 5816. 1 Best-BlastP =>> nrprot 69% Identities = 52/96 (54%), Positives = 79/96 (82%) refJZP_00122751. COG0718: Uncharacterized protein stored in bacteria [Haemophilus somnus 129PT] reflZP_00132634. 1 hypothetical protein [Haemophilus somnus 2336] Length = 109 5818. 1 Best-BlastP =>> nrprot No Hits found 5821. 1 Best-BlastP =>> nrprot No Hits found 5822. 1 Best-BlastP =>> nrprot No Hits found 5823. 2 Best-BlastP =>> nrprot 49% Identities = 125/369 (33%), Positives = 198/369 (53%), Gaps = 33/369 (8%) refINP_899726. 1 probable aminopeptidase [Chromobacterium violaceum ATCC 12472] gbjAAQ57736. Probably aminopeptidase [Chromobacterium violaceum ATCC 12472] Length = 415 5824. 1 Best-BlastP =>> nrprot 56% Identities = 43/67 (64%), Positives = 53/67 (79%) refJNP_773113. BII6473 [Bradyrhizobium japonicum] dbjiBAC51738. 1 d b116473 [Bradyrhizobium japonicum USDA 110] Length = 345 5829. 2 Best-BlastP =>> nrprot 50% Identities = 67/218 (30%), Positives = 124/218 (56%), Gaps = 1/218 (0%) refINP_880554. 1 j putative glutamine binding periplasmic protein precursor [Bordetella pertussis] embyCAE42138. 1 putative glutamine-binding periplasmic protein precursor [Bordetella pertussis] Length = 247 58. 1 5804. 1,583. 2 Best-BlastP =>> nrprot 82% Identities = 128/198 (64%), Positives = 164/198 (82%), Gaps = 1/198 (0%) refINP_743801. 1 trp repressor binding protein [Pseudomonas putida KT2440] gblAAN67265. 11AE016353_5 trp repressor binding protein [Pseudomonas putida KT2440] Length = 201 5844. 1 Best-BlastP =>> nrprot 65% Identities = 66/135 (48%), Positives = 88/135 (65%), Gaps = 5/135 (3%) refINP_044227. 1 J KIcA [Enterobacter aerogenes] refINP862440. 11 KIcA protein [Pseudomonas sp.  ADP] spIP52602IKLA1_ECOLI Antirestriction Protein kIcA pirlIT08486 probable aniti-restriction protein klcA - Enterobacter aerogenes plasmid R751 gblAAC64430. 1 KIcA [Enterobacter aerogenes] gbIAAK50236. 1 IU66917_3 KIcA protein [Pseudomonas sp.  ADP] Length = 142 5846. 2 Best-BlastP =>> nrprot No Hits found 5848. 1 Best-BlastP =>> nrprot No Hits found 585. 2 Best-BlastP =>> nrprot 72% Identities = 62/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (0%) refINP_274848. 1 J conserved hypothetical protein [Neisseria meningitidis MC58] pirIIA81035 conserved hypothetical protein NMB1852 [imported] - Neisseria meningitidis (strain MC58 serogroup B) gbjAAF42186. 11 conserved hypothetical protein [Neisseria meningitidis MC58] Length = 129 5856. 1 Best-BlastP =>> nrprot 42% Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 1/43 (2%) refIZP_00141162. 1! COG0617: tRNA nucleotidyltransferase / poly (A) polymerase [Pseudomonas aeruginosa UCBPP-PA14] Length = 467 5857. 1 Best-BlastP =>> nrprot 64% Identities = 65/139 (46%), Positives = 92/139 (66%) refINP_735626. 1 j Unknown [Streptococcus agalactiae NEM316] embjCAD46839. Unknown [Streptococcus agalactiae NEM316] Length = 162 5867. 1 Best-BlastP =>> nrprot No Hits found 587. 2 Best-BlastP =>> nrprot 74% Identities = 149/254 (58%), Positives = 194/254 (76%), Gaps = 1/254 (0%) gbjEAA20230. Exodeoxyribonuclease III [Plasmodium yoelii yoelii] Length = 271 5871. 3 Best-BlastP =>> nrprot 46% Identities = 94/364 (25%), Positives = 174/364 (47%), Gaps = 21/364 (5%) refINP_691531. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] refJNP_692364. 1j hypothetical protein [Oceanobacillus iheyensis HTE831] refINP_693263. 1d transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjjBAC12566. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjjBAC13399. 1 1 hypothetical conserved protein [Oceanobacillus iheyensis HTE831] dbjjBAC14298. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 402 5872. 1 Best-BlastP =>> nrprot No Hits found 5874. 1 Best-BlastP =>> nrprot 71% Identities = 96/178 (53%), Positives = 128/178 (71%), Gaps = 1/178 (0%) refJZP_00024697. COG4584: Transposase and Inactivated Derivatives [Ralstonia metallidurans] Length = 343 5875. 1 Best-BlastP =>> nrprot 43% Identities = 28/90 (31%), Positives = 44/90 (48%) gbjAAN34371. 1 1 ORF1 transposase [Acinetobacter baumannii] Length = 180 5876. 2 Best-BlastP =>> nrprot 71% Identities = 121/219 (55%), Positives = 165/219 (75%), Gaps = 1/219 (0%) refINP_791574. Cytidylate kinase [Pseudomonas syringae pv.  tomato str.  DC3000] gbjAA055269. 1 cytidylate kinase [Pseudomonas syringae pv.  tomato str.  DC3000] Length = 229,588. 3 Best-BlastP =>> nrprot 72% Identities = 146/252 (57%), Positives = 186/252 (73%) refINP_840124. 1! Exodeoxyribonuclease III: Exodeoxyribonuclease III xth [Nitrosomonas europaea ATCC 19718] emblCAD83934. Exodeoxyribonuclease III: Exodeoxyribonuclease III xth [Nitrosomonas europaea ATCC 19718] Length = 254 5890. 1 Best-BlastP =>> nrprot No Hits found 5892. 1 Best-BlastP =>> nrprot 73% Identities = 59/99 (59%), Positives = 73/99 (73%) refINP_742622. 11 ribosomal protein L23 [Pseudomonas putida KT2440] gbIAAN66086. 1 JAE016238_4 ribosomal protein L23 [Pseudomonas putida KT2440] Length = 99.5894. 3 Best-BlastP =>> nrprot 82% Identities = 202/275 (73%), Positives = 229/275 (83%) refIZP_00067989. COG0090: Ribosomal protein L2 [Microbulbifer degradans 2-40] Length = 275 5895. 3 Best-BlastP =>> nrprot 86% Identities = 65/90 (72%), Positives = 80/90 (88%) refINP_882398. 11 30S ribosomal protein S19 [Bordetella parapertussis] refINP_886586. 1 J 30S Ribosomal Protein S19 [Bordetella bronchiseptica] EMBASE39774. 1 J 30S Ribosomal Protein S19 [Bordetella parapertussis] embEAE30535. 30S ribosomal protein S19 [Bordetella bronchiseptica] Length = 91 5896. 1 Best-BlastP =>> nrprot 62% Identities = 42/115 (36%), Positives = 75/115 (65%) refINP_286169. 1 J putative transport protein [Escherichia coli O157: H7 EDL933] refINP_308508. Predicted transport protein [Escherichia coli O157: H7] pirIIA90689 substrain EDL933) gbIAAG54777. 1 JAE005222 2 putative transport protein [Escherichia coli O157: H7 EDL933] dbjlBAB33904. 1 putative transport protein [Escherichia coli O157: H7] Length = 456 5897. 1 Best-BlastP =>> nrprot 55% Identities = 41/73 (56%), Positives = 51/73 (69%) refINP_931085. 11 hypothetical protein [Photorhabdus luminescens subsp.  laumondii TTOI] embICAE16252. 1 J unnamed protein product [Photorhabdus luminescens subsp.  laumondii TTO1] Length = 459 5898. 2 Best-BlastP =>> nrprot 97% Identities = 266/271 (98%), Positives = 268/271 (98%) gbIAAC83338. 1 J major outer membrane protein precursor [Legionella pneumophila] gbIAAC83342. 1 J major outer membrane precursor protein [Legionella pneumophila] Length = 289 5899. 1 Best-BlastP =>> nrprot No Hits found 59. 1 Best-BlastP =>> nrprot 95% Identities = 137/145 (94%), Positives = 142/145 (97%) gbIAAM08233. 1 J unknown [Legionella pneumophila] Length = 243,590. 4 Best-BlastP =>> nrprot 17% Identities = 93/427 (21%), Positives = 182/427 (42%), Gaps = 50/427 (11%) refINP_603419. Exonuclease SBCC [Fusobacterium nucleatum subsp.  nucleatum ATCC 25586] gbIAAL94718. Exonuclease SBCC [Fusobacterium nucleatum subsp.  nucleatum ATCC 25586] Length = 921 5900. 3 Best-BlastP =>> nrprot No Hits found 5901. 3 Best-BlastP =>> nrprot 17% Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 27/177 (15%) refINP_001259. 1 J RCC1-like G exchanging factor RLG [Homo sapiens] pirIIT50663 RCC1-like G exchanging factor RLG [imported] - human gbIAAC79987. 1 J RCC1-like G exchanging factor RLG [Homo sapiens] gbIAAH29052. 1 J RCC1-like G exchanging factor RLG [Homo sapiens] gbIAAP88928. 1 chromosome condensation 1-like [Homo sapiens] Length = 551 5903. 2 Best-BlastP =>> nrprot 76% Identities = 191/318 (60%), Positives = 247/318 (77%) refINP_819776. 1 J KpsF / GutQ family protein [Coxiella burnetii RSA 493] gbIAAO90290. 1 J KpsF / GutQ family protein [Coxiella burnetii RSA 493] Length = 324 5904. 2 Best-BlastP =>> nrprot 21% Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 6/100 (6%) refINP_283688. 1 hypothetical protein NMA0899 [Neisseria meningitidis Z2491] pir11D81936 hypothetical protein NMA0899 [imported] - Neisseria meningitidis (strain Z2491 serogroup A) embICAB84177. 1 hypothetical protein NMA0899 [Neisseria meningitidis Z2491] Length = 124 5905. 1 Best-BlastP =>> nrprot 53% Identities = 118/304 (38%), Positives = 165/304 (54%), Gaps = 7/304 (2%) refINP_902888. 1 J likely translation initiation protein, Sua5 / YciO / YrdC family [Chromobacterium violaceum ATCC 12472] gbJAAQ60884. Probably translation initiation protein, Sua5 / YciO / YrdC family [Chromobacterium violaceum ATCC 12472] Length = 321 5906. 1 Best-BlastP =>> nrprot 100% Identities = 138/138 (100%), Positives = 138/138 (100%) embICAA67994. 1 oxaloacetate decarboxylase alphachain [Legionella pneumophiia] Length = 596 5907. 1 Best-BlastP =>> nrprot 56% Identities = 20/31 (64%), Positives = 30/31 (96%) refINP_283131. 11 hypothetical protein NMA0292 [Neisseria meningitidis Z2491] pirIIG82024 hypothetical protein NMA0292 [imported] Neisseria meningitidis (strain Z2491 serogroup A) embICAB83599. 1 hypothetical protein NMA0292 [Neisseria meningitidis Z2491] Length = 94,591. 3 Best-BlastP =>> nrprot 74% Identities = 156/258 (60%), Positives = 198/258 (76%) refZNP_00024696. COG1484: DNA replication protein [Ralstonia metallidurans] Length = 268 5910. 1 Best-BlastP =>> nrprot No Hits found 592. 3 Best-BlastP =>> nrprot 96% Identities = 531/559 (94%), Positives = 540/559 (96%) gbIAAM00619. 11 unknown [Legionella pneumophila] Length = 559 5920. 2 Best-BlastP =>> nrprot 46% Identities = 94/364 (25%), Positives = 174/364 (47%), Gaps = 21/364 (5%) refINP_691531. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] refINP_692364. 1J hypothetical protein [Oceanobacillus iheyensis HTE831] refINP_693263. 1J transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjJBAC12566. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjIBAC13399. 1 j hypothetical conserved protein [Oceanobacillus iheyensis HTE831] dbjIBAC14298. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 402 5926. 1 Best-BlastP =>> nrprot 59% Identities = 36/74 (48%), Positives = 47/74 (63%) refINP_355900. 11 AGR_L_236p [Agrobacterium tumefaciens] refINP_535243. 1 J conserved hypothetical protein [Agrobacterium tumefaciens str.  C58 (U.  Washington)] pirIIC98145 hypothetical protein AGR_L_236 [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pirIIAI3142 conserved hypothetical protein Atu4765 [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gbIAAK88685. 1 d AGR_L_236p [Agrobacterium tumefaciens str.  C58 (Cereon)] gbIAAL45559. 1 J conserved hypothetical protein [Agrobacterium tumefaciens str.  C58 (U.  Washington)] Length = 507,593. 2 Best-BlastP =>> nrprot No Hits found 5935. 1 Best-BlastP =>> nrprot No Hits found 594. 1 Best-BlastP =>> nrprot 97% Identities = 145/150 (96%), Positives = 147/150 (98%) gbIAAM00620. Chemiosmotic efflux system C protein [Legionella pneumophila] Length = 150 5944. 1 Best-BlastP =>> nrprot No Hits found 5947. 1 Best-BlastP =>> nrprot 65% Identities = 17/39 (43%), Positive = 30/39 (76%) REFINP 469382. 1 J similar to E.  coli DedA protein [Listeria innocua] pirIIAD1437 E.  coli DedA protein homolog Iin0035 [imported] - Listeria innocua (strain CIip11262). 1 Iin0035 [Listeria innocua] Length = 219 5950. 1 Best-BlastP =>> nrprot No Hits found 5952. 1 Best-BlastP =>> nrprot 79% Identities = 49/52 (94%), Positives = 49/52 (94%) gblAAM00633. 11 unknown [Legionella pneumophila] Length = 176 5953. 1 Best-BlastP =>> nrprot 87% Identities = 48/57 (84%), Positive = 50/57 (87%) splQ488151HELA_LEGPN Protein helA gblAAB05679. 11 HeIA Length = 1052 5957. 1 Best-BlastP =>> nrprot 68% Identities = 162/270 (60%), Positives = 214/270 (79%) refIZP_00122424. COG1185: Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Haemophilus somnus 129PT] Length = 713,596. 3 Best-BlastP =>> nrprot 73% Identities = 314/570 (55%), Positives = 419/570 (73%), Gaps = 5/570 (0%) reflNP_819843. 11 malate oxidoreductase [Coxiella burnetii RSA 493] gblAAO90357. 11 malate oxidoreductase [Coxiella burnetii RSA 493] Length = 565,597. 2 Best-BlastP =>> nrprot 37% Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 1/80 (1%) refI NP_820267. 1 I hypothetical protein [Coxiella burnetii RSA 493] gblAAO90781. 11 hypothetical protein [Coxiella burnetii RSA 493] Length = 160 5978. 2 Best-BlastP =>> nrprot 68% Identities = 92/166 (55%), Positives = 126/166 (75%) refJNP_931234. 11 hypothetical protein [Photorhabdus luminescens subsp.  laumondii TTO1] embICAE16409. 1J unnamed protein product [Photorhabdus luminescens subsp.  Iaumondii TTOI] Length = 187 5979. 1 Best-BlastP =>> nrprot No Hits found 598. 2 Best-BlastP =>> nrprot 46% Identities = 36/101 (35%), Positive = 49/101 (48%), Gaps = 15/101 (14%) REFINP 249404. [Pseudomonas aeruginosa PA01] hypothetical protein PA0713 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG04102. PA0713 [Pseudomonas aeruginosa PAO1] Length = 97 5983. 1 Best-BlastP =>> nrprot No Hits found 5985. 1 Best-BlastP =>> nrprot 44% Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 4/106 (3%) reflNP_692567. 11 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjlBAC13602. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 402 5986. 2 Best-BlastP =>> nrprot No Hits found 5987. 1 Best-BlastP =>> nrprot No Hits found 5988. 1 Best-BlastP =>> nrprot 35% Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 3/55 (5%) dbjJBAC94688. 1 I hypothetical protein [Vibrio vulnificus YJ016] Length = 343 5996. 1 Best-BlastP =>> nrprot 51% Identities = 67/159 (42%), Positives = 90/159 (56%), Gaps = 3/159 (1%) ref] NP_742500. 1 I conserved hypothetical protein [Pseudomonas putida KT2440] gblAAN65964. 11AE016224_8 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 166 5999. 1 Best-BlastP =>> nrprot 69% Identities = 49/91 (53%), Positives = 68/91 (74%) gblAAP83334. 11AF469614_2 unknown [Francisella tularensis subsp.  tularensis] Length = 94 60. 1 Best-BlastP =>> nrprot No Hits found 600. 3 Best-BlastP =>> nrprot 73% Identities = 117/172 (68%), Positives = 137/172 (79%) refINP_220600. 1 ABC TRANSPORTER ATP-BINDING PROTEIN (abcT3) [Rickettsia prowazekii] ABC pir11F71732 transporter ATP-binding protein (abcT3) RP214 - Rickettsia prowazekii emblCAA14677. 11 ABC TRANSPORTER ATP-BINDING PROTEIN (abcT3) [Rickettsia prowazekii] Length = 548,6002. 1 Best-BlastP =>> nrprot 30% Identities = 78/169 (46%), Positives = 111/169 (65%), Gaps = 2/169 (1%) gblAAN34371. 1 J ORF1 transposase [Acinetobacter baumannii] Length = 180,6004. 1 Best-BlastP =>> nrprot No Hits found 6007. 1 Best-BlastP =>> nrprot No Hits found 601. 4 Best-BlastP =>> nrprot 45% Identities = 97/361 (26%), Positives = 180/361 (49%), Gaps = 13/361 (3%) reflNP_359923. 1 j multidrug resistance ABC transporter ATP-binding protein [Rickettsia conorii] pirilF97735 hypothetical protein abcT3 [imported] - Rickettsia conorii (strain Malish 7) gbJAAL02824. 1 multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] Length = 589 6015. 1 Best-BlastP =>> nrprot No Hits found 6016. 1 Best-BlastP =>> nrprot 40% Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 1/71 (1%) ref! NP_774998. 1 I putative protein [Citrobacter freundii] gblAAN87662. 11 putative protein [Citrobacter freundii] Length = 112 6018. 1 Best-BlastP =>> nrprot No Hits found 6019. 1 Best-BlastP =>> nrprot 56% Identities = 67/145 (46%), Positives = 100/145 (68%) refINP_635334. 1! transcriptional regulator, AraC family [Methanosarcina mazei Goel] gbIAAM33006. 1 transcriptional regulator, AraC family [Methanosarcina mazei Goel] Length = 209 602. 4 Best-BlastP =>> nrprot 39% Identities = 64/253 (25%), Positives = 125/253 (49%), Gaps = 21/253 (8%) refINP_834835. 1 Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] gbIAAP12036. 1 I Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] Length = 254 6029. 1 Best-BlastP =>> nrprot 70% Identities = 31/48 (64%), Positives = 39/48 (81%) reftNP_520567. 1 I PROBABLE 50S RIBOSOMAL SUBUNIT PROTEIN L33 [Ralstonia solanacearum] sp! Q8XWM8IRL33_RALSO "50S ribosomal protein L33 emblCAD16153. 1 I PROBABLE 50S RIBOSOMAL SUBUNIT PROTEIN L33 [Ralstonia solanacearum] Length = 56 6036. 1 Best-BlastP =>> nrprot 99% Identities = 110/110 (100%), Positives = 110/110 (100%) embICAC33488. 1 I hypothetical protein [Legionella pneumophila] Length = 110 6037. 1 Best-BlastP =>> nrprot 47% Identities = 33/78 (42%), Positives = 54/78 (69%) spIPO4928ISANT_PLAFN S-ANTIGEN PROTEIN PRECURSOR pirIIYAZQN7 S-antigen precursor-malaria parasite (Plasmodium falciparum) (strain NF7 / Ghana) gblAAA29758. 1 antigen precursor Length = 309 6038. 1 Best-BlastP =>> nrprot No Hits found 6039. 1 Best-BlastP =>> nrprot 82% Identities = 366/558 (65%), Positives = 460/558 (82%), Gaps = 3/558 (0%) refJNP_251852. 30S ribosomal protein S1 [Pseudomonas aeruginosa PA01] pir11C83250 30S ribosomal protein S1 PA3162 [imported] - Pseudomonas aeruginosa (strain PAOI) gbjAAG06550. 11AE004740_3 30S ribosomal protein S1 [Pseudomonas aeruginosa PAO1] Length = 559604. 3 Best-BlastP =>> nrprot 55% Identities = 104/249 (41%), Positives = 138/249 (55%), Gaps = 6/249 (2%) refINP_419511. 1 transcriptional regulator SkgA [Caulobacter crescentus CB15] Transcriptional regulator skgA (Stationary-phase regulation of katG protein) pirj1C87335 transcription regulator SkgA [imported] - Caulobacter crescentus gblAAF01797. 11AF170912_1 putative helix-turn-helix transcriptional regulator SkgA [Caulobacter crescentus] gblAAK22679. 1 transcriptional regulator SkgA [Caulobacter crescentus CB15] Length = 255 6040. 1 Best-BlastP =>> nrprot 71% Identities = 54/92 (58%), Positives = 72/92 (78%) refINP_819558. 3-phosphoshikimate 1carboxyvinyltransferase [Coxiella burnetii RSA 493] gbIAAO90072. 1j 3phosphoshikimate 1-carboxyvinyltransferase [Coxiella burnetii RSA 493] Length = 438 6042. 1 Best-BlastP =>> nrprot 69% Identities = 105/209 (50%), Positives = 149/209 (71%), Gaps = 2/209 (0%) refIVE 00122964. COG0125: Thymidylate kinase [Haemophilus somnus 129PT] Length = 210 6044. 1 Best-BlastP =>> nrprot No Hits found 6049. 1 Best-BlastP =>> nrprot 74% Identities = 123/208 (59%), Positives = 155/208 (74%), Gaps. = 2/208 (0%) refINP_903586. Probably electrontransferring-flavoprotein dehydrogenase [Chromobacterium violaceum ATCC 12472] gbIAAQ61577. Probably electron-transferring-flavoprotein dehydrogenase [Chromobacterium violaceum ATCC 12472] Length = 539 6052. 1 Best-BlastP =>> nrprot 47% Identities = 55/162 (33%), Positives = 91/162 (56%), Gaps = 2/162 (1%) refINP_719829. 1 I conserved hypothetical protein [Shewanella oneidensis MR-1] gbIAAN57273. 1IAE015863_2 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 191606. 3 Best-BlastP =>> nrprot 56% Identities = 199/513 (38%), Positives = 301/513 (58%), Gaps = 6/513 (1%) refINP_819600. Amino acid permease family protein [Coxiella burnetii RSA 493] gbIAAO90114. Amino acid permease family protein [Coxiella burnetii RSA 493] Length = 560 6061. 1 Best-BlastP =>> nrprot No Hits found 6062. 1 Best-BlastP =>> nrprot 62% Identities = 75/166 (45%), Positives = 108/166 (65%), Gaps = 2/166 (1%) gbIAAN34371. 1 day ORF1 transposase [Acinetobacter baumannii] Length = 180 6064. 1 Best-BlastP =>> nrprot No Hits found 6066. 1 Best-BlastP =>> nrprot 35% Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 10/122 (8%) refINP_242278. 1 transposase (01) [Bacillus halodurans] pirIID83826 transposase (01) BH1412 [imported] - Bacillus halodurans (strain C-125) dbjIBAB05131. 1 transposase (01) [Bacillus halodurans] Length = 405 6070. 1 Best-BlastP =>> nrprot 65% Identities = 59/121 (48%), Positives = 85/121 (70%) refINP_781505. 1 12-hydroxyacid dehydrogenase [Clostridium tetani E88] gbIAAO35442. 1 12-hydroxyacid dehydrogenase [Clostridium tetani E88] Length = 357 6071. 1 Best-BlastP =>> nrprot 43% Identities = 23/67 (34%), Positives = 31/67 (46%) gbIAAK61303. 1 putative transposase [Xanthomonas oryzae pv.  oryzae] Length = 344 6072. 1 Best-BlastP =>> nrprot 45% Identities = 18/43 (41%), Positives = 29/43 (67%) gbIAAB38861. 11 putative transposase [Burkholderia cepacia] Length = 345 6074. 1 Best-BlastP =>> nrprot 49% Identities = 48/175 (27%), Positives = 84/175 (48%), Gaps = 14/175 (8%) refINP_692337. Transposase for IS652 [Oceanobacillus iheyensis HTE831] refINP_693308. 1 transposase for 15652 [Oceanobacillus iheyensis HTE831] dbjIBAC13372. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjIBAC14343. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 397 6079. 1 Best-BlastP =>> nrprot 44% Identities = 35/96 (36%), Positives = 49/96 (51%) gbIAAB97874. Antigen surface [Trypanosoma cruzi] Length = 722 6081. 1 Best-BlastP =>> nrprot 45% Identities = 24/44 (54%), Positives = 32/44 (72%) dbjIBAC93915. 1 L-asparaginase 1 [Vibrio vulnificus YJ016] Length = 337 6083. 1 Best-BlastP =>> nrprot No Hits found 6086. 1 Best-BlastP =>> nrprot 98% Identities = 102/104 (98%), Positives = 103/104 (99%) gbIAAM00607. 1 I unknown [Legionella pneumophila] Length = 121 6087. 1 Best-BlastP =>> nrprot No Hits found 6089. 1 Best-BlastP =>> nrprot 49% Identities = 48/175 (27%), Positives = 84/175 (48%), Gaps = 14/175 (8%) reflNP_692337. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] refINP_693308. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjJBAC13372. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjIBAC14343. 11 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 397 6093. 1 Best-BlastP =>> nrprot No Hits found 6094. 1 Best-BlastP =>> nrprot No Hits found 6097. 1 Best-BlastP =>> nrprot 41% Identities = 1129/1221 (92%), Positives = 1163/1221 (95%), Gaps = 16/1221 (1%) gblAAD41583. 1AAF057703_1 structural toxin protein RtxA [Legionella pneumophila] Length = 1208 6098. 1 Best-BlastP =>> nrprot 50% Identities = 41/74 (55%), Positives = 53/74 (71%) refINP_927457. 1 DNA adenine methylase (Deoxyadenosylmethyltransferase) [Photorhabdus luminescens subsp.  laumondii TT01] embICAE12382. 1 DNA adenine methylase (Deoxyadenosyl methyltransferase) [Photorhabdus luminescens subsp.  laumondii TT01] Length = 270 61. 1 Best-BlastP =>> nrprot No Hits found 6106. 1 Best-BlastP =>> nrprot 37% Identities = 20/56 (35%), Positives = 32/56 (57%) reflNP_051664. 1 transposase, putative [Deinococcus radiodurans] pirllA75633 probable transposase - Deinococcus radiodurans (strain R1) gbIAAF12606. 11AE001826_75 transposase, putative [Deinococcus radiodurans] Length = 327 6107. 1 Best-BlastP =>> nrprot No Hits found 6108. 1 Best-BlastP =>> nrprot 63% Identities = 76/169 (44%), Positives = 110/169 (65%), Gaps = 2/169 (1%) gbjAAN34371. ORF1 transposase [Acinetobacter baumannii] Length = 180 6110. 1 Best-BlastP =>> nrprot 85% Identities = 74/77 (96%), Positives = 74/77 (96%) embICAB65201. 11 hypothetical protein [Legionella pneumophila] Length = 356 6117. 1 Best-BlastP =>> nrprot 11% Identities = 83/277 (29%), Positives = 126/277 (45%), Gaps = 51/277 (18%) reflXP_300615. Homo sapiens Length = 423 6119. 1 Best-BlastP =>> nrprot 41% Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 4/123 (3%) refJNP_692567. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] dbjIBAC13602. 1 transposase for IS652 [Oceanobacillus iheyensis HTE831] Length = 402,612. 2 Best-BlastP =>> nrprot 97% Identities = 696/721 (96%), Positives = 706/721 (97%) gblAAC64361. 1 catalase-peroxidase KatB [Legionella pneumophila] Length = 721 6121. 1 Best-BlastP =>> nrprot 52% Identities = 51/199 (25%), Positives = 100/199 (50%), Gaps = 21/199 (10%) gbIAAB05879. 11 putative transposase Length = 424 6122. 1 Best-BlastP =>> nrprot No Hits found 6123. 1 Best-BlastP =>> nrprot No Hits found 6125. 1 6128. 6130. 1,613. 1,613. 1,613. 1,613. 1,615. 5,616. 4,618. 3,619. 1 Best-BlastP =>> nrprot 98% Identities = 51/51 (100%), Positives = 51/51 (100%) pir! IT42167 Rep protein - Escherichia coli plasmid pO157 gblAAC70135. 11 Rep protein El [Escherichia coli O157: H7] Length = 51 Best-BlastP =>> nrprot 99% Identities = 388/388 (100%), Positives = 388/388 (100%) refINP_061425. 1 1100 pct identical to gp: FPLMCG_6 [SopA of plasmid F] [Plasmid F] gbJAAA24902. 1 l Protein A dbjJBAA97916. 1 j 100 pct identical to gp: FPLMCG_6 [SopA of plasmid F] [Plasmid F], and embicAC79981. 1 orf1176 [Escherichia coli] gbjAAO61293. 1 ParA [BAC cloning vector pEBAC190G] embjCAD50597. 1 d SopA protein [Cloning vector pUvBBAC] Length = 391 Best-BlastP =>> nrprot 99% Identities = 323/323 (100%), Positives = 323/323 (100%) refINP_061426. 1 j 100 pct identical to sp: SOPB_ECOLI [SopB of plasmid F] [Plasmid F] refINP_052641. 1 SopB protein [Escherichia coli O157: H7] spIP088671SOPB_ECOLI SopB protein (Plasmid partition protein B) pirjIT00244 sopB protein - Escherichia coli plasmids pO157 and F embjCAA28296. 1 j unnamed protein product [Escherichia con] gbjAAA24903. 1 day Protein B gbjAAC53637. 1 SopB dbjjBAA31791. 1 d SopB protein [Escherichia coli] gbjAAC70137. Plasmid partitioning protein [Escherichia coli O157: H7] dbjjBAA97917. 1 j 100 pct identical to sp: SOPB_ECOLI [SopB of plasmid F] [Plasmid F] embjCAC79980. 1 orf972 [Escherichia coli] gblAAO61294. 1 j ParB [BAC cloning vector pEBAC190G] emblCAD50598. 1 d SopB protein [Cloning vector pUvBBAC] Length = 323 Best-BlastP =>> nrprot 47% Identities = 239/927 (25%), Positives = 368/927 (39%), Gaps = 188/927 (20%) refINP_772111. BII5471 [Bradyrhizobium japonicum] dbjjBAC50736. 1 b115471 [Bradyrhizobium japonicum USDA 110] Length = 4210 Best-BlastP =>> nrprot 37% Identities = 21/57 (36%), Positive = 33/57 (57%) refINP_051664. 1 transposase, putative [Deinococcus radiodurans] pirjIA75633 probable transposase - Deinococcus radiodurans (strain RI) gbjAAF12606. 1 jAE001826_75 transposase, putative [Deinococcus radiodurans] Length = 327 Best-BlastP =>> nrprot 67% Identities = 44/80 (55%), Positives = 59/80 (73%) refINP_273113. 1! [Neisseria meningitidis MC58] pirlIB81244 conserved hypothetical protein NMB0047 [imported] - Neisseria meningitidis (strain MC58 serogroup B) gbjAAF40518. 1jconserved hypothetical protein [Neisseria meningitidis MC58] Length = 94 Best-BlastP =>> nrprot 54% Identities = 78/169 (46%), Positives = 111/169 (65%), Gaps = 2/169 (1%) gbjAAN34371 . 1 d ORF1 transposase [Acinetobacter baumannii] Length = 180 Best-BlastP =>> nrprot 53% Identities = 58/230 (25%), Positives = 114/230 (49%), Gaps = 26/230 (11%) refINP_603496 . Transposase [Fusobacterium nucleatum subsp.  nucleatum ATCC 25586] gbjAAL94795. 1 I Transposase [Fusobacterium nucleatum subsp.  nucleatum ATCC 25586] Length = 428 Best-BlastP =>> nrprot 67% Identities = 179/333 (53%), Positives = 231/333 (69%), Gaps = 4/333 (1%) refJZP_00024697. COG4584: Transposase and inactivated derivatives [Ralstonia metallidurans] Length = 343 Best-BlastP =>> nrprot 55% Identities = 48/125 (38%), Positives = 77/125 (61%), Gaps = 2/125 ( 1%) refINP_867668. Probable acyl carrier protein [Pirellula sp. ] embjCAD75215. Likely acyl carrier protein [Pirellula sp. Length = 129 Best-BlastP =>> nrprot 19% Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 2/118 (1%) refINP_785252. 1 (3R) -hydroxymyristoyl [acyl carrier protein] dehydratase [Lactobacillus plantarum WCFS1] sp. (Q88WG9) 2FABZ-LACPL (3R) -hydroxymyristoyl- [acyl carrier protein] dehydratase ((3R) -hydroxymyristoyl ACP dehydrase) emb19CAD64100.  11 (3R) -hydroxymyristoyl- [acyl carrier protein] dehydratase [Lactobacillus plantarum WCFS1] Length = 147 Best-BlastP =>> nrprot 62% Identities = 195/428 (45%), Positive = 269/428 (62%), Gaps = 17/428 (3%) refINP_214178. 11 3-oxoacyl- [acylcarrier-protein] synthase II [Aquifex aeolicus] pirIIB70448 3-oxoacyl- [acyl-carrier-protein] synthase (EC 2. 3. 1. 41) He - Aquifex aeolicus gbIAAC07574. 3-oxoacyl- [acylcarrier-protein] synthase II [Aquifex aeolicus VF5] Length = 415 BestBlastP =>> nrprot 69% Identities = 412/793 (51%), Positives = 556/793 (70%), Gaps = 12/793 (1%) refINP_820864. Penicillin-binding protein 1A [Coxiella burnetii RSA 493] gbIAAO91378. Penicillin-binding protein 1A [Coxiella burnetii RSA 493] Length = 793 Best-BlastP =>> nrprot 77% Identities = 253/370 (68%), Positives = 289/370 (78%) refZNP_00013240.  11 COG0686: Alanine dehydrogenase [Rhodospirillum rubrum] Length = 372 Best-BlastP =>> nrprot 39% Identities = 110/214 (51%), Positives = 138/214 (64%), Gaps = 14/214 (6%) refiNP_612899. 1 hypothetical protein [Stx2 converting bacteriophage I] dbjIBAB87868. 1 I hypothetical protein [Stx2 converting bacteriophage I] Length = 678 628. 3 Best-BlastP =>> nrprot No Hits found 63. 1 Best-BlastP =>> nrprot No Hits found 630. 4 Best-BlastP =>> nrprot 73% Identities = 577/1040 (55%), Positives = 773/1040 (74%), Gaps = 1/1040 (0%) refgP_00055701. 11 hypothetical protein [Magnetospirillum magnetotacticum] Length = 1059 632. 2 Best-BlastP =>> nrprot 71% Identities = 136/258 (52%), Positives = 189/258 (73%), Gaps = 1/258 (0%) refINP_760580. 1 Dihydropteroate synthase [Vibrio vulnificus CMCP6] gbIAAO10107. 11AE016802_150 Dihydropteroate synthase [Vibrio vulnificus CMCP6] Length = 259 Best-BlastP =>> nrprot 75% Identities = 282/442 (63%), Positives = 344/442 (77%), Gaps = 1/442 (0%) refINP_406959 .  Probable phosphoglucomutase / phosphomannomutase [Yersinia pestis] refINP_668021. 1I mrsA protein [Yersinia pestis KIM] pirIIAE0425 Probable phosphoglucomutase / phosphomannomutase [imported] - Yersinia pestis (CO92 strain) embICAC92729. Probable phosphoglucomutase / phosphomannomutase [Yersinia pestis CO92] gbIAAM84272.  1 IAE013670_9 mrsA protein [Yersinia pestis KIM] Length = 446 Best-BlastP =>> nrprot 51% Identities = 85/166 (51%), Positives = 93/166 (56%) embICAB44711. 1 I hypothetical protein (P4 (21) n) [Mus musculus] Length = 400,635. 5 Best-BlastP =>> nrprot 83% Identities = 278/398 (69%), Positives = 332/398 (83%), Gaps = 14/398 (3%) refINP_819191. 1 cell division protein FtsZ [Coxiella burnetii RSA 493] gbIAAO89705. FTSZ cell division protein [Coxiella burnetii RSA 493] Length = 386,636. 2 Best-BlastP =>> nrprot 77% Identities = 198/287 (68%), Positives = 236/287 (82%) refJZP_00090126. COG0774: UDP-3-O-acyl-Nacetyl-glucosamine deacetylase [Azotobacter vinelandii] Length = 303,637. 3 Best-BlastP =>> nrprot 62% Identities = 261/623 (41%), Positives = 396/623 (63%), Gaps = 5/623 (0%) refINP_616924. Endothelin converting enzyme homolog PepO [Methanosarcina acetivorans str.  C2A] gbIAAM05404. Endothelin converting enzyme homolog PepO [Methanosarcina acetivorans str.  C2A] Length = 665 64. 3 Best-BlastP =>> nrprot No Hits found 640. 2 Best-BlastP =>> nrprot 51% Identities = 102/309 (33%), Positives = 157/309 (50%), Gaps = 8/309 (2%) refINP_103911. 1 j hypothetical protein [Mesorhizobium loti] dbjIBAB49697. 1 I hypothetical protein [Mesorhizobium loti] Length = 345 621. 5,622. 3,623. 2,627. 1,633. 3,634. 4 Best-BlastP =>> nrprot 74% Identities = 416/663 (62%), Positives = 506/663 (76%), Gaps = 5/663 (0%) refINP_931190. 1,2-dienoyl-CoA reductase [NADPH] (2,4-dienoyl coenzyme A reductase) [Photorhabdus luminescens subsp.  laumondii TTOI] embICAE16362. 1 2,4-dienoyl-CoA reductase [NADPH] (2,4-dienoyl coenzyme A reductase) [Photorhabdus luminescens subsp.

  laumondii TTO1] Length = 673 Best-BlastP =>> nrprot 59% Identities = 208/462 (45%), Positives = 287/462 (62%), Gaps = 10/462 (2%) refINP_284769.1 j UDP- N-acetylmuramyl-tripeptide synthetase [Neisseria meningitidis Z2491] spiQ9JSZOIMURE_NEIMA UDP-N-acetylmuramoylalanyl-Dglutamate-2,6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide synthase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc- tripeptide synthetase) pirjIA81778 UDP-N-acetylmuramoylalanylD-glutamate-2,6-diaminopimelate ligase (EC 6.3.2.13) NMA2071 [similarity] - Neisseria meningitidis (strain Z2491 serogroup A) [UDPN-acetylmuramyl-tripeptide synthase [ Neisseria meningitidis Z2491] Length = 492 Best-BlastP =>> nrprot 52% Identities = 113/344 (32%), Positives = 185/344 (53%), Gaps = 10/344 (2%) refINP_820791.1 erythronate4- phosphate dehydrogenase, putative [Coxiella burnetii RSA 493] gblAAO91305.1 Jerythronate-4-phosphate dehydrogenase, putative [Coxiella burnetii RSA 493] Length = 375 645.4 Best-Bl astP =>> nrprot 66% Identities = 107/219 (48%), Positives = 147/219 (67%), Gaps = 5/219 (2%) refINP_820725.1 I membrane protein, putative [Coxiella burnetii RSA 493] gbIAAO91239.1 I protein membrane, putative [Coxiella burnetii RSA 493] Length = 230 647.5 Best-BlastP =>> nrprot 49% Identities = 55/179 (30%), Positives = 107/179 (59%), Gaps = 1 / 179 (0%) gblAAQ75156.1 d Pap2 superfamily protein [Alvinella pompejana epibiont 7G3] Length = 202 65.1 Best-BlastP =>> nrprot No Hits found 650.3 Best-BlastP =>> nrprot 72% Identities = 211/372 (56 %), Positive = 272/372 (73%), Gaps = 2/372 (0%) refJZP_00029745.11 COG2170: Uncharacterized preserved protein [Burkholderia fungorum] Length = 388 651.2 Best-BlastP =>> nrprot 73% Identities = 70 / 130 (53%), Positives = 98/130 (75%) COG1832: Predicted CoA-binding protein [Geobacter metallireducens] Length = 136 652.1 Best-BlastP =>> nrprot 62% Identities = 144/267 ( 53%), Positives = 179/267 (67%), Gaps = 5/267 (1%) refINP_404647.1 1 advisable [Yersinia pestis KIM] [Yersinia pestis] [Yersinia pestis] [YER] protein [Yersinia pestis KIM] Length = 281 656.3 Best-BlastP =>> nrprot No Hits found 657.3 Best-BlastP =>> nrprot 6% Identities = 39/123 (31%), Positive = 64/123 (52%), Gaps = 11/123 (8%) ref1NP_828913.1 l serine / threonine protein kinase [Chlamydophila caviae GPIC] gblAAPO4791.lj serine / threonine protein kinase [Chlamydophila caviae GPIC] Length = 659.2 Best-BlastP =>> nrprot 31% Identities = 56/209 (26%), Positives = 100/209 (47%), Gaps = 11/209 (5%) refINP_843168.1 I conserved hypothetical protein [Bacillus anthracis str. [Bacillus anthracis str. Ames] Length = 323 641.3 643.3 644.2 660.1 Best-BlastP =>> nrprot 61% Identities = 83/178 (46%), Positives = 117/178 (65%) refINP_794412.11 acetyltransferase, GNAT family [Pseudomonas syringae pv. tomato str. DC3000] gbIAAO58107.1, acetyltransferase, GNAT family [Pseudomonas syringae pv. tomato str. DC3000] Length = 189 661.3 Best-BlastP =>> nrprot 20% Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 10/148 (6%) refIZP_00109305.1 I COG1670: Acetyltransferases, including N-acetylases of ribosomal proteins [Nostoc punctiform] Length = 191 663.2 Best-BlastP =>> nrprot 49% Identities = 193/671 (28%), Positives = 325/671 (48%), Gaps = 62 / 671 (9%) gblAAL77346.11AF443847_2 putative 0- acetyltransferase WavN [Vibrio cholerae] Length = 663 665.2 Best-BlastP =>> nrprot 69% Identities = 43/78 (55%), Positives = 62/78 (79%) refINP_273842 .1 l conserved hypothetical protein [Neisseria meningitidis MC58] pir! IG81157 conserved hypothetical protein NMB0800 [imported] - Neisseria meningitidis (strain MC58 serogroup B) gblAAF41213. 1 1 conserved hypothetical protein [Neisseria meningitidis MC58] Length = 94 666.2 Best-BlastP =>> nrprot 76% Identities = 120/204 (58%), Positives = 158/204 (77%) reflZP_00126281.11 COG0293: 23S rRNA methylase [Pseudomonas syringae pv. syringae B728a] Length = 216 667.3 Best-BlastP =>> nrprot 32% Identities = 68/178 (38%), Positives = 71/178 (39%) pirllA40215 Antigen TcD - Trypanosoma cruzi Length = 207 Best-BlastP =>> nrprot 99% Identities = 1026/1048 (97%), Positive = 1040/1048 (99%) 011118334 icmE protein - Legionella pneumophila emblCAA75331.1! IcmE protein [Legionella pneumophila] Length = 1048 BestBlastP =>> nrprot 66% Identities = 213/471 (45%), Positives = 308/471 (65%), Gaps = 18/471 (3%) refZNP_00107537.1 I COG1249 : Pyruvate / 2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Nostoc punctiform] Length = 472 Best-BlastP =>> nrprot 42% Identities = 123/548 (22%), Positives = 218/548 (39%), Gaps = 102/548 (18%) REFINP 458664.1 I putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi] refINP_807874.1 putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] pirlIAI1031 probable membrane protein STY4579 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) emblCAD09354.1 I putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi] gblAAO71734.1 putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 501 675.6 Best-BlastP =>> nrprot No Hits found 677.6 Best-BlastP =>> nrprot 58% Identities = 258/683 (37%), Positives = 389/683 (56%), Gaps = 39/683 (5%) gblAAN62290.11AF440524_77 conserved hypothetical protein [Pseudomonas aeruginosa] Length = 724 678.3 Best-BlastP =>> nrprot No Hits found 680.3 Best-BlastP =>> nrprot 53% Identities = 57/132 (43% ), Positives = 83/132 (62%), Gaps = 2/132 (1%) refINP_283256.1 Patch repair protein [Neisseria meningitidis Z2491] spIQ9JWD6IVSR_NEIMA Patching protein patch-repair endonuclease pir11H81959 patch repair protein (EC 3.1 NMA0429 [imported] - Neisseria meningitidis (strain Z2491 serogroup A) Embicab83728.1 I repair repair protein [Neisseria meningitidis Z2491] Length = 140 681.3 Best-BlastP =>> nrprot No Hits found 668.4 670.1 673.3 Best-BlastP =>> nrprot 76% Identities = 191/295 (64%), Positives = 229/295 (77%), Gaps = 7/295 (2%) spIQ59603IMTB1_NEIGO Modification methylase NgoBI (Cytosine-specific methylt Ransferase NgoBI) (M.NgoBI) (M.NgoI) gbIAAB03206.21 Cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae] Length = 317 Best-BlastP =>> nrprot 64% Identities = 200/443 (45%), Positives = 289/443 (65%), Gaps = 11/443 (2%) refINP_819174.1 1 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl ligase [Coxiella burnetii RSA 493] gbIAAO89688.1 1 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl ligase [Coxiella burnetii RSA 493] Length = 446 Best-BlastP =>> nrprot 48% Identities = 73/253 (28%), Positives = 127/253 (50%), Gaps = 40/253 (15%) refINP_819573.1 I cell division protein ZipA, putative [Coxiella burnetii RSA 493] gbjAAO90087.1 I cell division protein ZipA, putative [Coxiella burnetii RSA 493] Length = 225 687.5 Best-BlastP =>> nrprot 47% Identities = 120/426 (28%), Positives = 204/426 (47%), Gaps = 29/426 (6%) reflZP_00082430. 1! COG0304: 3-oxoacyl- (acyl-carrier-protein) synthase [Geobacter metallireducens] Length = 410 688.1 Best-BlastP =>> nrprot 48% Identities = 71/266 (26%), Positives = 138/266 (51%) , Gaps = 11/266 (4%) refINP_908017.1 I LIPID A BIOSYNTHESIS ACYLTRANSFERASE [Wolinella succinogenes] embICAE10917.11 BIOSYNTHESIS ACYLTRANSFERASE LIPID [Wolinella succinogenes] Length = 300 692.1 Best-BlastP =>> nrprot No Hits found 693.1 Best- BlastP =>> nrprot 71% Identities = 96/172 (55%), Positives = 128/172 (74%) refINP_299266.1 conserved hypothetical protein [Xylella fastidiosa 9a5c] pirIIC82613 conserved hypothetical protein XF1984 [imported] - Xylella fastidiosa ( strain 9a5c) gbIAAF84786.1 IAE004018 2 conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 187 694.3 Best-BlastP =>> nrprot 72% Identities = 239/453 (52%), Positives = 330/453 (72%), Gaps = 9/453 (1%) dbjIBAB33285.11 glutathione reductase [Acinetobacter sp. M-1] Length = 450 696.2 Best-BlastP =>> nrprot 74% Identities = 92/143 (64%), Positives = 107/143 (74%), Gaps = 13/143 (9%) refINP_230222.1 ribosomal protein S9 [Vibrio cholerae 01 biovar eltor str. N16961] spiQ9KUFOIRS9_VIBCH 30S ribosomal protein S9 pir1IC82308 ribosomal protein S9 VCO571 [imported] Vibrio cholerae (strain N16961 serogroup 01) gbIAAF93739.1 l ribosomal protein S9 [Vibrio cholerae 01 biovar eltor str.

  N16961] Length = 130 697.1 Best-BlastP =>> nrprot 74% Identities = 111/188 (59%), Positives = 142/188 (75%), Gaps = 3/188 (1%) refINP_840883.1 I Rieske iron -sulfur protein 2Fe-2S subunit [Nitrosomonas europaea ATCC 19718] embICAD84720.1 I Rieske iron-sulfur protein 2Fe-2S subunit [Nitrosomonas europaea ATCC 19718] Length = 201 698.2 Best-BlastP =>> nrprot 81% Identities = 273/401 (68%), Positive = 332/401 (82%) refINP_743478.1 ubiquinol - cytochrome c reductase, cytochrome b [Pseudomonas putida KT2440] gbJAAN66942.1 JAE016322_9 ubiquinol - cytochrome c reductase, cytochrome b [Pseudomonas putida KT2440] Length = 403 699.3 Best-BlastP =>> nrprot 59% Identities = 157/374 (41%), Positives = 226/374 (60%), Gaps = 4/374 (1%) refIZP_00089161.1 COG0607: Rhodanese-related sulfurtransferase [Azotobacter vinelandii] Length = 377 7.1 Best-BlastP =>> nrprot 43% Identities = 394/1345 (29%), Positives = 596/1345 (44%), Gaps = 225/1345 (16%) refINP_907747.1 J hypothetical protein WS1613 [Wolinella succi nogenes] embJCAE10647.1 J hypothetical protein [Wolinella succinogenes] Length = 1409 682.2 683.2 684.5 701.2 Best-BlastP =>> nrprot 62% Identities = 231/482 (47%), Positives = 307/482 (63%), Gaps = 6/482 (1%) refINP_819376.1 phosphomethylpyrimidine kinase / thiamin phosphate pyrophosphorylase [Coxiella burnetii RSA 493] gbIAA089890.11 phosphomethylpyrimidine kinase / thiamin phosphate pyrophosphorylase [Coxiella burnetii RSA 493] Length 479 702.2 Best-BlastP =>> nrprot 73% Identities = 153/259 (59%), Positives = 193/259 (74%) refZD 00067659.1 I COG2022: Uncharacterized enzyme of thiazole biosynthesis [Microbulbifer degradans 2-40] Length = 269 704.4 Best-BlastP =>> nrprot No Hits found 705.1 Best-BlastP =>> nrprot 60% Identities = 179/427 (41%), Positives = 263/427 (61%), Gaps = 17/427 (3%) refINP_691145.1 hydroxymethylglutaryl-CoA reductase [Oceanobacillus iheyensis HTE831] dbjIBAC12180.11 hydroxymethylglutaryl-CoA reductase [Oceanobacillus iheyensis HTE831] Length = 429 706.2 Best-Blast P =>> nrprot 27% Identities = 40/115 (34%), Positives = 49/115 (42%), Gaps = 1/115 (0%) pirllS75426 hypothetical protein c05009 Sulfolobus solfataricus embICAA69540.1I orf cO5009 [Sulfolobus solfataricus ] Length = 115 707.2 Best-BlastP =>> nrprot 57% Identities = 141/338 (41%), Positives = 196/338 (57%), Gaps = 4/338 (1%) COG 1304 refLN_00072976.1 L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases [Trichodesmium erythraeum IMS101] Length = 345 709.1 Best-BlastP =>> nrprot No Hits found 711.2 Best-BlastP =>> nrprot 74% Identities = 396/663 (59%), Positives = 497/663 (74%), Gaps = 2/663 (0%) refINP_249239.1 1 transketolase [Pseudomonas aeruginosa PA01] pirIIB83577 transketolase PA0548 [imported] - Pseudomonas aeruginosa (strain PA01) gbIAAG03937.1 jAE004491_4 transketolase [Pseudomonas aeruginosa PA01] Length = 665 712.2 Best-BlastP =>> nrprot 79% Identities = 212/329 (64%), Positives = 263/329 (79%), Gaps = 5/329 (1%) refZNP_00033578 .1 1 hypothetical p rotein [Burkholderia fungorum] Length = 336 713.2 Best-BlastP =>> nrprot No Hits found 715.1 Best-BlastP =>> nrprot No Hits found 716.1 Best-BlastP =>> nrprot No Hits found 717.2 Best-BlastP =>> nrprot No Hits found 719.4 Best-BlastP =>> nrprot 75% Identities = 484/781 (61%), Positives = 592/781 (75%), Gaps = 24/781 (3%) refINP_901207.1 Probable transcriptional accessory protein [Chromobacterium violaceum ATCC 12472] gblAAQ59212.1! Probable transcriptional accessory protein [Chromobacterium violaceum ATCC 12472] Length = 770 722.3 Best-BlastP =>> nrprot 58% Identities = 79/215 (36%), Positives = 130/215 (60%), Gaps = 3/215 (1 %) refINP_716217.1! thiopurine S-methyltransferase [Shewanella oneidensis MR-1] gbIAAN53662.11AE015505_5 thiopurine S-methyltransferase [Shewanella oneidensis MR-1] Length = 218 723.3 Best-BlastP =>> nrprot 75% Identities = 353/611 (57%), Positive = 454/611 (74%), Gaps = 7/611 (1%) REFINP_820767.1 I glucosamine-- fructose-6-phosphate aminotransferase, isomerizing [Coxiella burnetii RSA 493] gbIAA091281.1! glucosamine - fructose-6-phosphate aminotransferase, isomerizing [Coxiella burnetii RSA 493] Length = 611 727.3 Best-BlastP =>> nrprot 82% Identities = 756/1070 (70%), Positive = 881/1070 (82%), Gaps = 5/1070 (0%) refINP_794254.1 carbamoylphosphate synthase, large subunit [Pseudomonas syringae pv. tomato str. DC3000] gbIAA057949.1 J carbamoyl phosphate synthase, broad subunit [Pseudomonas syringae pv. tomato str. DC3000] Length = 1073 Best-BlastP =>> nrprot 53% Identities = 49/111 (44%), Positives = 72/111 (64%) refINP_799407.1 j CrcB protein [Vibrio parahaemolyticus RIMD 2210633] spIQ87KE9jCRCB_VIBPA Protein crcB homolog dbjjBAC61291 .1 j CrcB protein [Vibrio parahaemolyticus] Length = 127 Best-BlastP =>> nrprot 73% Identifies = 135/256 (52%), Positives = 190/256 (74%) refINP_252334.1 j UDP-N-acetylglucosamine acyltransferase [Pseudomonas aeruginosa PA01] spiQ9X6P4jLPXA_PSEAE Acyl- [acyl-carrier-protein] - UDP-N-acetylglucosamine 0-acyltransferase (UDP-N-acetylglucosamine acyltransferase) pin UD-N-acetylglucosamine acyltransferase PA3644 [imported] - Pseudomonas aeruginosa (strain PAOI) gblAAD30149.1 jAF142597_1 hydroxydecanoyl-acyl carrier protein-dependent UDP-N-acetylglucosamine-3-O-acyltransferase [Pseudomonas aeruginosa] gbjAAG07032.1 jAE004784_5 UDP-N-acetylglucosamine acyltransferase [Pseudomonas aeruginosa PAO1] Length = 258 Best-BlastP = >> nrprot 68% Identifies = 79/142 (55%), Pos itives = 104/142 (73%), Gaps = 1/142 (0%) refINP_873649.1 (3R) -hydroxymyristoyl-acyl carrier protein dehydratase [Haemophilus ducreyi 35000HP] gbjAAP96038.1 (3R) -hydroxymyristoyl-acyl carrier protein dehydratase [Haemophilus ducreyi 35000HP] Length = 154 Best-BlastP =>> nrprot 57% Identifies = 132/334 (39%), Positives = 193/334 (57%) refINP_717250.11 UDP-3-O- (3- hydroxymyristoyl) glucosamine n-acyltransferase [Shewanella oneidensis MR-1] gbjAAN54694.11AE015609_13 UDP-3-O- (3-hydroxymyristoyl) glucosamine n-acyltransferase [Shewanella oneidensis MR-1] Length = 341 Best-BlastP =>> nrprot 53% Identifies = 50/139 (35%), Positives = 89/139 (64%) OmpH membrane protein, putative [Coxiella burnetii RSA 493] gbiAAO90156.1 OmpH outer membrane protein, putative [Coxiella burnetii RSA 493 ] Length = 165 Best-BlastP =>> nrprot 45% Identities = 101/299 (33%), Positives = 156/299 (52%), Gaps = 15/299 (5%) refINP_812239.1 j ATP-dependent DNA helicase recG [Bacteroides thetaiota omicron VPI-5482] gbjAAO78433.1 ATP-dependent DNA helicase recG [Bacteroides thetaiotaomicron VPI-5482] Length = 485 Best-BlastP =>> nrprot 46% Identifies = 48/153 (31%), Positives = 81/153 ( 52%), Gaps = 2/153 (1%) refINP_617319.1 ATP-dependent DNA helicase [Methanosarcina acetivorans str. C2A] gbjAAM05799.1 ATP-dependent DNA helicase [Methanosarcina acetivorans str. C2A] Length = 514 739.4 Best-BlastP =>> nrprot 69% Identifies = 146/295 (49%), Positives = 202/295 (68%), Gaps = 10/295 (3%) refINP_052845.1 j hypothetical protein [Coxiella burnetii] refINP_819051.1 protein, putative [Coxiella burnetii RSA 493] gbjAAD33477.1 1AF131076_3 hypothetical protein [Coxiella burnetii] gbjAAO91611.1 protein, putative [Coxiella burnetii RSA 493] Length = 289 740.2 Best-BlastP = >> nrprot 81% Identifies = 72/114 (63%), Positives = 93/114 (81%) refINP_772410.1 bII5770 [Bradyrhizobium japonicum] dbjjBAC51035.1 b1I5770 [Bradyrhizobium japonicum USDA 110] Length = 118 741.2 Best-BlastP =>> nrprot No Hits found 742.3 Best-BlastP =>> nrprot 76% Identifies = 280/467 (59%), Positives = 357/467 (76%), Gaps = 3/467 (0%) refINP_820336.1 j amino acid antiporter [Coxiella burnetii RSA 493] gbjAAO90850.1 amino acid antiporter [Coxiella burnetii RSA 493] Length = 474 743.3 Best-BlastP =>> nrprot 94% Identifies = 124/131 (94%), Positives = 125/131 (95%) gbjAAM00634. 1 j unknown [Legionella pneumophila] Length = 131 728.2 729.1 730.1 731.2 732.3 737.1 738.2 744.3 Best-BlastP =>> nrprot 97% Identities = 163/168 (97%), Positives = 164/168 (97%) gblAAM00635.1 I putative cadmium efflux ATPase [Legionella pneumophila] Length = 635 747.3 Best-BlastP =>> nrprot 99% Identifies = 723/729 (99%), Positive = 725/729 (99%) gb! AAM00636.1! unknown [Legionella pneumophila] Length = 729 748.3 Best-BlastP =>> nrprot 30% Identities = 99/321 (30%), Positives = 137/321 (42%), Gaps = 72/321 (22%) refgP_00129242.1 COG2821: Membrane-bound lytic murein transglycosylase [Desulfovibrio desulfuricans G20] Length = 442 749.1 Best-BlastP =>> nrprot No Hits found 750.2 Best-BlastP =>> nrprot No Hits found 751.2 Best-BlastP =>> nrprot No Hits found 752.2 Best-BlastP =>> nrprot No Hits found 753.2 Best-BlastP =>> nrprot 51% Identities = 92/311 (29%), Positives = 164/311 (52%), Gaps = 28/311 (9%) refINP_782216.1 I conserved protein [Clostridium tetani E88] gbIAAO36153.1 I conserved protein [Clostridium tetani E88] Length = 307 754.2 Best-BlastP =>> nrprot 62% Identities = 160/323 (49%), Positive = 209/323 (64%), Gaps = 6/323 (1%) ref! ZP_00107451.1! COG0667: Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Nostoc punctiform] Length = 326 755.3 Best-BlastP =>> nrprot 46% Identities = 72/227 (31%), Positives = 126/227 (55%), Gaps = 12/227 (5%) COG0062: Uncharacterized conserved protein [Microbulbifer degradans 2-40] Length = 500 757.1 Best-BlastP =>> nrprot 64% Identities = 95/203 (46%), Positive = 132 / 203 (65%), Gaps = 9/203 (4%) refINP_820677.1 14Fe-4S binding domain protein [Coxiella burnetii RSA 493] gbJAAO91191.11 4Fe-4S binding domain protein [Coxiella burnetii RSA 493] Length = 213 Best -BlastP =>> nrprot 82% Identities = 155/208 (74%), Positives = 174/208 (83%) refIZP_00122593. 1 I COG0177: Predicted Endoll1-related endonuclease [Haemophilus somnus 129PT] Length = 211 Best-BlastP =>> nrprot No Hits found Best- BlastP =>> nrprot 22% Identities = 41/124 (33%), Positive = 70 / 124 (56%), Gaps = 8/124 (6%) refINP_656804.1 J Acetyltransf, Acetyltransferase (GNAT) family [Bacillus anthracis A2012] refINP_845271.1! acetyltransferase, GNAT family [Bacillus anthracis str.

  Ames] gbJAAP26757.1 acetyltransferase, GNAT family [Bacillus anthracis str. Length = 135 Best-BlastP =>> nrprot 56% Identities = 80/200 (40%), Positives = 123/200 (61%), Gaps = 1/200 (0%) refJZP_00086065.1 J COG1280: Putative threonine efflux protein [Pseudomonas fluorescens PfO-1] Length = 209 Best-BlastP =>> nrprot 52% Identities = 53/167 (31%), Positives = 90/167 (53%), Gaps = 4/167 (2% ) refINP 490158.1 probable acetyltransferase [Nostoc sp. PCC 7120] pirjJAD2484 hypothetical protein a1r7052 [imported] - Nostoc sp. (strain PCC 7120) plasmid pCC7120alpha dbjJBAB78136.1 J ORF_ID: alr7052 probable acetyltransferase [Nostoc sp. PCC 7120] Length = 169 Best-BlastP =>> nrprot 61% Identities = 99/234 (42%), Positives = 148/234 (63%), Gaps = 8/234 (3%) refINP_217318.11 hypothetical protein Rv2802c [Mycobacterium tuberculosis H37Rv] refINP_856471.1 HYPOTHETICAL ARGININE AND ALANINE RICH PROTEIN [Mycobacterium bovis subsp. bovis AF2122 / 97] pirJIE70689 hypothetical protein Rv2802c - Mycobacterium tuberculosis (strain H37RV) embJCAB03674. 1 J hypothetical protein Rv2802c [Mycobacterium tuberculosis H37Rv] EmbICAD95010.1 HYPOTHETICAL ARGININE AND ALANINE RICH PROTEIN [Mycobacterium bovis subsp. bovis AF2122 / 97] Length = 347 758.1 760.2 761.2 762.2 764.1 765.1 766.3 Best-BlastP =>> nrprot 36% Identities = 99/398 (24%), Positives = 173/398 (43%), Gaps = 71/398 ( 17%) refINP_845051.1 esterase, putative [Bacillus anthracis str. Ames] gbIAAP26537.11 esterase, putative [Bacillus anthracis str. Ames] Length = 382 767.3 Best-BlastP =>> nrprot 64% Identities = 206/430 (47%), Positives = 2741430 (63%), Gaps = 8/430 (1%) refINP_248707.1 J conserved hypothetical protein [ Pseudomonas aeruginosa PA0I] pirIIF83643 conserved hypothetical protein PA0017 [imported] Pseudomonas aeruginosa (strain PAO1) gbIAAG03407.1 JAE004441_8 conserved hypothetical protein [Pseudomonas aeruginosa PAOI] Length = 434 769.2 Best-BlastP =>> nrprot 71% Identities = 167/311 (53 %), Positives = 225/311 (72%), Gaps = 4/311 (1%) REFIGP_00082909.1 J COG0223: Methionyl-tRNA formyltransferase [Pseudomonas fluorescens PfO-1] Length = 319 77.1 Best-BlastP =>> nrprot No Hits found 770.3 Best-BlastP =>> nrprot 98% Identities = 157/161 (97%), Positives = 160/161 (99%) gbIAAD43221.1 JAF111940_3 LspH precursor [Legionella pneumophila] Length = 161 771.4 Best-BlastP = >> nrprot 99% Identities = 140/140 (100%), Positives = 140/140 (100%) gbIAAD43220.1 JAF111940_2 LspG precursor [Legionella pneumophila] gbIAAP69529.1 J type II pr otein secretion LspG pseudopilin [Legionella pneumophila] Length = 140 772.4 Best-BlastP =>> nrprot 99% Identities = 393/399 (98%), Positives = 396/399 (99%) gbIAAK35047.21AF330137_1 type II protein secretion LspF [Legionella pneumophila] Length = 399 774.3 Best-BlastP =>> nrprot 82% Identities = 325/469 (69%), Positives = 386/469 (82%) refINP_719933.1 J glutamine synthetase, type 1 [Shewanella oneidensis MR-1] gbIAAN57377.1 JAE015874 4 glutamine synthetase, type 1 [Shewanella oneidensis MR-1] Length = 469.775.2 Best-BlastP =>> nrprot 51% Identities = 62/171 (36%), Positive = 96/171 (56%), Gaps = 11/171 (6%) refINP_796499.1 J hypothetical protein VP0120 [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC58383.1 J hypothetical protein [Vibrio parahaemolyticus] Length = 193 776.3 Best-BlastP =>> nrprot 99% Identities = 497/502 (99%), Positives = 500/502 (99%), Gaps = 1/502 (0%) gbIAAF34822.1 JAF167992_2 IraB [Legionella pneumophila] Length = 501 778.2 Best-BlastP =>> nrprot 99% Identities = 272 / 27 2 (100%), Positive = 272/272 (100%) EmbICAB65217.1 J hypothetical protein [Legionella pneumophila] gbIAAF34821.1 JAF167992_1 small molecule methyltransferase IraA [Legionella pneumophila] Length = 272 779.4 Best-BlastP =>> nrprot 99 % Identities = 459/460 (99%), Positives = 460/460 (100%). B) Legislative protein [Legionella pneumophila] Length = 460 783.2 Best-BlastP =>> nrprot 62% Identities = 51/105 (48%) %), Positives = 75/105 (71%), Gaps = 1/105 (0%) refINP_359553.1 Conserved hypothetical protein [Streptococcus pneumoniae R6] pirIIG98116 conserved hypothetical protein [962] [imported] - Streptococcus pneumoniae (strain R6) gbIAAL00764.1 J = 787.4 Best-BlastP =>> nrprot No Hits found 787.3 Best-BlastP =>> nrprot 68% Identities = 344/658 (52%), Positives = 452 / 658 (68%), Gaps = 23/658 (3%) refINP_718364.1 J ribonuclease E [Shewanella oneidensis MR-1] gbIAAN55808. 1JAE015717_9 ribonuclease E [Shewanella oneidensis MR-1] Length = 1088 789.4 Best-BlastP =>> nrprot 51% Identities = 25/77 (32%), Positive = 43/77 (55%) refJNP_085189.1 i IS10 orf [Shigella flexneri] refINP_858160. 11 hypothetical protein [Shigella flexneri 2a] gbIAAK18345.11AF348706_34 IS10 orf [Shigella flexneri] gbIAAL72480.1I hypothetical protein [Shigella flexneri 2a] Length = 407 79.1 Best-BlastP =>> nrprot 82% Identities = 52/66 (78%), Positive = 56/66 (84%) refINP_759471.11 Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759894.1 i Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759939.1 I Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760021.1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760123.1 1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760403.11 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbIAAO08317.1 1AE016813_69 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAAO08998.1jAE016798_158 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbIAAO09421.1 JAE016800_26 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbIAAO09427.1 IAE016800_32 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbIAAO09466.1 jAE016800_71 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbjAA 790.3 Best-BlastP =>> nrprot No Hits found 791.5 Best-BlastP =>> nrprot 98% Identities = 367/375 (97%), Positive = 372/375 (99%) gbIAAM00643.1 I cyciopropane fatty acyl phospholipid synthase [Legionella pneumophila] Length = 375 793.2 Best-BlastP =>> nrprot No Hits found 794.2 Best-BlastP =>> nrprot No Hits found 795.2 Best-BlastP =>> nrprot 69% Identities = 134/260 (51%), Positives = 181/260 (69%), Gaps = 5/260 (1%) refINP_635864.1 indole-3-glycerol phosphate synthase [Xanthomonas campestris pv. campestris str. ATCC 33913] spIQ8PD70jTRPC_XANCP Indole-3-glycerol phosphate synthase (IGPS) gbIAAM39788.1 Indole-3-glycerol phosphate synthase [Xanthomonas campestris pv. campestris str.

  ATCC 33913] Length = 265 796.2 Best-BlastP =>> nrprot 39% Identities = 60/227 (26%), Positives = 98/227 (43%), Gaps = 25/227 (11%) refINP_783943.1 adenylyl transferase (putative) [Lactobacillus plantarum WCFS1] embICAD62779.1j adenylyl transferase (putative) [Lactobacillus plantarum WCFS1] Length = 259 798.2 Best-BlastP =>> nrprot 60% Identities = 242/575 (42%), Positives = 364/575 (63%), Gaps = 8/575 (1%) refINP_359923.1 I multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] pirIIF97735 hypothetical protein abcT3 [imported] Rickettsia conorii (Malish strain 7) gbIAAL02824.1 j multidrug resistance ABC carry ATP-binding protein [Rickettsia conorii] Length = 589 799.3 Best-BlastP =>> nrprot 50% Identities = 156/500 (31%), Positives = 249/500 (49%), Gaps = 60/500 (12%) % =% uptake of ATPase domains [Nostoc punctiform] Length = 544 Best-BlastP =>> nrprot 77% Identities = 34/42 (80%), Positive = 34/42 (80%) refINP_759472.1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_759895.1 Conserved hypothetical protein [Vibrio vuinificus CMCP6] refINP_759901.1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] refINP_760122.1 [Vibrio vulnificus CMCP6] refINP_760328.1 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbJAA008316.11AE016813_68 Conserved hypothetical protein [Vibrio vuinificus CMCP6] gbIAAO08999.11AE016798_159 Conserved hypothetical protein [Vibrio vuinificus CMCP6] gb1AA009422 .11AE016800 27 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbIAAO09428. 11AE016800_33 Conserved hypothetical protein [Vibrio vulnificus CMCP6] gbIAAO09649.1 1AE016800_254 Conserved hypothetical protein [Vibrio vuinificus CMCP6] gblAA009855.1 jAE016801_174 Conserved hypothetical protein [Vibrio vuinificus CMCP6] Length = 43 Best-BlastP =>> nrprot 61% Identities = 104/249 (41%), Positives = 152/249 (61%), Gaps = 3/249 (1%) refZGP_00032174.1 J COG4787: Flagellar Basal Body Rod Protein [Burkholderia fungorum] Length = 461 802.3 Best-BlastP =>> nrprot 74% Identities = 158/261 (60%), Positives = 196/261 (75%) refINP_249773.1 I flagellar basal body rod protein FIgG [Pseudomonas aeruginosa PAOI] COG4786: Flagellar basal body rod protein [Pseudomonas aeruginosa UCBPP-PA14] pirlIH83510 flagellar basal-body rod protein FIgG PA1082 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG04471.11AE004539_13 flagellar basal-body rod protein FIgG [Pseudomonas aeruginosa PAO1] Length = 261 803.3 Best-BlastP =>> nrprot 58% Identities = 84/223 (37%), Posit ives = 136/223 (60%), Gaps = 3/223 (1%) gbjAAN08643.11 FIgH [Aeromonas hydrophila] Length = 223 806.2 Best-BlastP =>> nrprot 41% Identities = 54/206 (26%), Positive = 102/206 (49%), Gaps = 11/206 (5%) spIQ00924IHYUE_PSESN HYDANTOIN RACEMASE pir1IB41895 hydantoin racemase HyuE-Pseudomonas sp gblAAA25843.1 J 5substituted hydantoin racemase Length = 249 807.2 Best-BlastP =>> nrprot 46% Identities = 135/390 (34%), Positives = 205/390 (52%), Gaps = 14/390 (3%) REFIZP_00090340.1 I COG0402: Cytosine deaminase and related metal-dependent hydrolases [Azotobacter vinelandii] Length = 463 808.4 Best-BlastP =>> nrprot 20% Identities = 110/492 (22%), Positives = 193/492 (39%), Gaps = 57/492 (11%) refINP_213438.1 I chromosome assembly protein homolog [Aquifex aeolicus] pirlIB70356 chromosome assembly protein homolog - Aquifex aeolicus gbIAAC06839.11 chromosome assembly protein homolog [Aquifex aeolicus VF5] Length = 1156 81.3 Best-BlastP =>> nrprot 52% Identities = 20/40 (50%), Positive = 24/40 (60 % ) refINP_907600.1 I hypothetical protein WS1440 [Wolinella succinogenes] embICAE10500.1 hypothetical protein [Wolinella succinogenes] Length = 42813.2 Best-BlastP =>> nrprot 60% Identities = 178/412 (43%), Positive = 259/412 (Wolinella succinogenes) 62%), Gaps = 8/412 (1%) refINP_821038.11 major facilitator family transporter [Coxiella burnetii RSA 493] gbjAA091552.11 major facilitator family transporter [Coxiella burnetii RSA 493] Length = -446 815.2 Best-BlastP =>> nrprot 75% Identities = 251/408 (61%), Positives = 306/408 (75%), Gaps = 7/408 (1%) refINP_671036: 1 phosphopentomutase [Yersinia pestis KIM] gbIAAM87287.1 IAE013977_6 phosphopentomutase [Yersinia pestis KIM ] Length = 429 817.7 Best-BlastP =>> nrprot 21% Identities = 198/995 (19%), Positives = 410/995 (41%), Gaps = 142/995 (14%) dbjIBAA34954.1 I myosin heavy chain [Dugesia japonica] Length = 1958 80.3 801.3 Best-BlastP =>> nrprot 42% Identities = 68/304 (22%), Positives = 122/304 (40%), Gaps = 28/304 (9%) refINP_866394.1 j ATP synthase gamma subunit C-terminus homolog [Pirellula sp.] EmbICAD78175.1 I ATP synthase gamma subunit C-terminus homolog [Pirellula sp.] Length = 306 Best-BlastP =>> nrprot 67% Identities = 217/484 (44%), Positives = 330/484 (68%), Gaps = 11/484 (2%) refInP_229412.1 J ATP synthase FI, subunit alpha [Thermotoga maritima] pirIIF72231 ATP synthase F1, subunit alpha - Thermotoga maritima (strain MSB8) gbIAAD36679.11AE001805 4 ATP IF synthase, alpha subunit [Thermotoga maritima] Length = 503 82.2 Best-BlastP =>> nrprot 28% Identities = 23/33 (69%), Positive = 24/33 (72%) pirIIA44803 pGl protein - human (fragment) Length = 75 821.2 Best-BlastP =>> nrprot No Hits found 823.4 Best-BlastP =>> nrprot 68% Identities = 143/268 (53%), Positives = 184/268 (68%), Gaps = 5/268 (1 % UDP-Nacetylglucosamine pyrophosphorylase [Coxiella burnetii RSA 493] gbIAAO91437.11 UDP-N-acetylglucosamine pyrophosphorylase [Coxiella burnetii RSA 493] Length = 455 825.4 Best-BlastP =>> nrprot 99% Identities = 407/413 (%) 98%), Posi = 411/413 (99%) gbIAAM00639.11 aresenite efflux membrane component-like protein [Legionella pneumophila] Length = 413 829.2 Best-BlastP =>> nrprot 80% Identities = 373/541 (68%), Positive = 457 / 541 (84%) refINP_888942.1! putative sulfate transporter [Bordetella bronchiseptica] embICAE32896.1 I putative sulfate transporter [Bordetella bronchiseptica] Length = 563 830.4 Best-BlastP =>> nrprot 45% Identities = 229/949 (24%), Positives = 392/949 (41%) , Gaps = 162/949 (17%) refINP_819243.1! conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAAO89757.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 929 Best-BlastP =>> nrprot 70% Identities = 186/321 (57%), Positives = 235/321 ( 73%), Gaps = 5/321 (1%) refINP_615542.1 J porphobilinogen synthase [Methanosarcina acetivorans str. C2A] gbIAAM04022.1 1 porphobilinogen synthase [Methanosarcina acetivorans str. C2A] Length = 324 Best-BlastP =>> nrprot 33% Identities = 170/674 (25%), Positives = 264/674 (39%), Gaps = 134/674 (19%) refINP_798717.1 I chitinase [Vibrio parahaemolyticus RIMD 2210633] dbjIBAC60601.1! chitinase [Vibrio parahaemolyticus] Length = 848 835.2 Best-BlastP =>> nrprot 60% Identities = 355/836 (42%), Positives = 523/836 (62%), Gaps = 12/836 (1%) refINP_252348.1 Protein-PII urinary protein (PII uridylyl transferase) (Uridylyl removing enzyme) (UTase) pirIIE83189 protein-PII uridylyltransferase PA3658 [imported] - Pseudomonas aeruginosa (strain PAOI) gbIAAG07046 . 11AE004785_10 protein-PII uridylyltransferase [Pseudomonas aeruginosa PAO1] Length = 900 837.2 Best-BlastP =>> nrprot 82% Identities = 185/255 (72%), Positives = 210/255 (82%), Gaps = 1/255 (0) %) refINP_820377.1! methionine aminopeptidase, type I [Coxiella burnetii RSA 493] gbIAAO90891.1! methionine aminopeptidase, type I [Coxiella burnetii RSA 493] Length = 258 838.3 Best-BlastP =>> nrprot 80% Identities = 322/460 (70%), Positive = 372/460 (80%) refINP_710366.1 I Fumarate hydratase [ Leptospira interrogans serovar lai str. 56601] gbIAAN47384.11AE011209_3 Fumarate hydratase [Leptospira interrogans serovar lai str. 56601] Length = 464 818.2 819.2 832.3 833.3 84.4 840.2 841.3 843.2 844.2 845.4 847.4 852.3 853.1 854.3 856.2 857.2 Best-BlastP =>> nrprot 59% Identities = 243/551 (44%), Positive = 334/551 (60%), Gaps = 49/551 (8%) refINP_819689.11 DNA polymerase III, gamma and tau subunits [Coxiella burnetii RSA 493] gbIAAO90203.1 DNA polymerase III, gamma and tau subunits [Coxiella burnetii RSA 493] Length = 509 Best-BlastP =>> nrprot 63% Identities = 124/242 (51%), Positives = 155/242 (64%) refINP_404551.11 conserved hypothetical protein [Yersinia pestis] refINP_670619.1 J hypothetical protein [KIM Yersinia pestis] pirIIAF0114 conserved hypothetical protein YPO0934 [imported] - Yersinia pestis (strain CO92) cGCG89777.1 conserved hypothetical protein [Yersinia pestis CO92] gbfAAM86870.1 1AE013933_7 hypothetical protein [KIM Yersinia pestis] Length = 243 Best-BlastP =>> nrprot 78% Identities = 70 / 108 (64%), Positives = 86/108 (79%) ReflZP_00023150.1 e COG0526: Thiol-disulfide isomerase and thiore doxins [Ralstonia metallidurans] Length = 108 Best-BlastP =>> nrprot 99% Identities = 188/189 (99%), Positives = 189/189 (100%) embfCAD90948.1 J putative pyrimidine phosphoribosyl transferase [Legionella pneumophila] Length = Best-BlastP =>> nrprot 70% Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 2/101 (1%) reffZP_00068029.1 COG4517: Uncharacterized protein conserved in bacteria [Microbulbifer degradans 2-40] Length = 189 Best-BlastP =>> nrprot 38% Identities = 54/212 (25%), Positives = 97/212 (45%), Gaps = 6/212 (2%) refINP_819358. 1-conserved hypothetical protein [Coxiella burnetii RSA 493] gbjAAO89872.1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 243 Best-BlastP =>> nrprot 68% Identities = 562/1047 (53%), Positives = 719/1047 (68%), Gaps = 18/1047 (1%) refINP_639180.1 bifunctional PutA protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gbf AAM43071.11 bifunctional PutA protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 1066 Best-BlastP =>> nrprot 58% Identities = 92/194 (47%), Positives = 116/194 (59%) refINP_642158.1 f amidotransferase [Xanthomonas axonopodis pv. citri str. 306] gbfAAM36694.11 amidotransferase [Xanthomonas axonopodis pv. citri str. 306] Length = 200 Best-BlastP =>> nrprot 62% Identities = 99/239 (41%), Positives = 149/239 (62%), Gaps = 2/239 (0%) refINP_928857.1 phosphoribosylformimino-5- aminoimidazole carboxamide ribotide isomerase [Photorhabdus luminescens subsp. laumondii TTOI] embecaE13859.11 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [Photorhabdus luminescens subsp. laumondii TTOI] Length = 245 Best-BlastP =>> nrprot 62% Identities = 97/179 (54%), Positives = 132/179 (73%), Gaps = 2/179 (1%) refINP_797522.1 imidazoleglycerolphosphate synthase , cyclase subunit [Vibrio parahaemolyticus RIMD 2210633] spfQ87QK6jHIS6_VIBPA Imidazole glycerol phosphate synthase subunit hisF (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) dbjIBAC59406.1 imidazoleglycerol-phosphate synthase, cyclase subunit [Vibrio parahaemolyticus] Length = 257 Best-BlastP =>> nrprot No Hits found Best-BlastP =>> nrprot 64% Identities = 349/779 (44%), Positives = 498/779 (63%), Gaps = 20 / 779 (2%) refINP_668468.1 j putative penicillinbinding protein [Yersinia pestis KIM] gbf AAM84719.11AE013717_1 putative penicillin-binding protein [KIM Yersinia pestis] Length = 845 858.2 Best-BlastP =>> nrprot 60% Identities = 71/157 ( 45%), Positives = 99/157 (63%) ReflZP_00089699.1 I COG1376: Uncharacterized Protein Preserved in Bacteria [Azoto bacter Vineliaii] Length = 174 859.2 Best-BlastP =>> nrprot 69% Identities = 240/454 (52%), Positive = 324/454 (71%) refINP_820199.11 aldehyde dehydrogenase family protein [Coxiella burnetii RSA 493] gbIAAO90713. 1 l aldehyde dehydrogenase family protein [Coxiella burnetii RSA 493] Length = 455 860.2 Best-BlastP =>> nrprot 28% Identities = 112/372 (30%), Positives = 167/372 (44%), Gaps = 46/372 (12%) refIXP_313257.11 ENSANGP00000010409 [Anopheles gambiae] gblEAA08897.1 J ENSANGP00000010409 [Anopheles gambiae str. PEST] Length = 862.1 Best-BlastP =>> nrprot No Hits found 863.1 Best-BlastP =>> nrprot 72% Identities = 70/114 (61%), Positives = 90/114 (78%) reflZP_00092569.1 l COG3293: Transposase and inactivated derivatives [Azotobacter vinelandii] Length = 249 864.1 Best-BlastP =>> nrprot 85% Identities = 70/95 (73%), Positive = 83/95 (87%) refINP_820693.1 conserved hypothetical protein [Coxiella burnetii RSA 493] gblAAO91207.1 I conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 96 865.2 Best-BlastP =>> nrprot 75% Identities = 227/379 (59%), Positives = 280/379 (73%), Gaps = 12/379 (3%) carbamoyl phosphate synthase, small subunit [Vibrio cholerae 01 biovar eltor str. N16961] spIQ9KPH8jCARA VIBCH Carbamoyl-phosphate synthase small chain (Carbamoyl-phosphate synthetase glutamine chain) pirllE82083 carbamoyl-phosphate synthase, small chain VC2390 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gb! AAF95533.1 J carbamoyl phosphate synthase, small subunit [Vibrio cholerae 01 biovar eltor str. N16961] Length = 379 866.2 Best-BlastP =>> nrprot 99% Identities = 379/379 (100%), Positives = 379/379 (100%) splP50025IDNAJ_LEGPN Chaperone protein dnaJ gbIAAA80278.1 I heat-shock protein Length = 379 869.2 Best-BlastP =>> nrprot No Hits found 870.3 Best-BlastP =>> nrprot 98% Identity = 355/360 (98%), Positive = 357/360 (99%) pin IT18333 icmK protein - Legionella pneumophila gblAAC38189.11 DotH [Legionella pneumophila] embICAA75330.1 I IcmK protein [Legionella pneumophila] Length = 360 872.2 Best-BlastP =>> nrprot 99% Identities = 212/212 (100%), Positives = 212/212 (100%) pirIIT18332 icmL protein Legionella Pneumophila gbIAAC38190.1 Dotl [Legionella pneumophila] emblCAA75329.1 J lcmL protein [Legionella pneumophila] embICAD43145.1! Dotl protein [Legionella pneumophila serogroup 6] Length = 212 873.2 Best-BlastP =>> nrprot 96% Identities = 91/94 (96%), Positive = 92/94 (97%) pirilT18331 icmM protein - Legionella pneumophila gblAAC38191. 11 DotJ [Legionella pneumophila] embICAA75328.1I IcmM protein [Legionella pneumophila] Length = 94 874.2 Best-BlastP =>> nrprot 99% Identities = 187/189 (98%), Positive = 189/189 (100%) pirIIT18330 IphA protein Legionella pneumophila embICAA75327.1 I LphA protein [Legionella pneumophila] Length = 189 875.5 Best-BlastP =>> nrprot 53% Identities = 133/408 (32%), Positives = 227/408 (55%), Gaps = 10/408 (2%) refINP_827016.1 I putative integral membrane transport protein [Streptomyces avermitilis MA-4680] dbj! BAC73551.11 putative integral membrane transport protein [Streptomyces avermitilis MA-4680] Length = 490 876.1 Best-BlastP =>> nrprot 23% Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 2/67 (2%) ReflNP_355599.1 I AGR_C_4826p [Agrobacterium tumefaciens] refINP_533327.1 I Acetyltransferase [Agrobacterium tumefaciens str. C58 (U. Washington)] pir1IG97678 hypothetical protein AGR_C_4826 [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pirjIAE2903 acetyltransferase [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gbIAAK88384. 11 AGR_C_4826p [Agrobacterium tumefaciens str. C58 (Cereon)] gblAAL43643.11 acetyltransferase [Agrobacterium tumefaciens str. C58 (Washington U.S.) Length = 168 Best-BlastP =>> nrprot 60% Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 10/153 (6%) refIZP_00090468. 1 J COG0582: Integrase [Azotobacter vinelandii] Length = 399 Best-BlastP =>> nrprot 60% Identities = 137/352 (38%), Positive = 215/352 (61%) reflNP_819830.1 I membrane protein, putative [Coxiella burnetii RSA 493] gblAAO90344.1 1 protein membrane, putative [Coxiella burnetii RSA 493] Length = 355 Best-BlastP =>> nrprot 61% Identities = 141/359 (39%), Positive = 221/359 (61%), Gaps = 7/359 (1%) refINP_819829. 1! protein membrane, putative [Coxiella burnetii RSA 493] gbjAAO90343.11 protein membrane, putative [Coxiella burnetii RSA 493] Length = 370 Best-BlastP =>> nrprot 63% Identities = 218/487 (44%), Positives = 308/487 (63%), Gaps = 12/487 (2%) refINP 439847.1 aminopeptidase A / l [Haemophilus influenzae Rd] spIP45334jAMPA_HAEIN Cytosol aminopeptidase (Leucine aminopeptidase) (LAP) (Leucyl aminopeptidase) pirjJC64137 leucyl aminopeptidase (EC 3.4.11.1) A Haemophilus influenzae (strain Rd KW20) gbjAAC23351.11 aminopeptidase M (pepA) [Haemophilus influenzae Rd] Length = 491 Best-BlastP =>> nrprot 23% Identities = 48/193 (24%), Positives = 77/193 (39%) %), Gaps = 9/193 (4%) refINP_624872.1 hypothetical protein SCF73.06c [Streptomyces coelicolor A3 (2)] embICAB57411.1 1 hypothetical protein SCF73.06c [Streptomyces coelicolor A3 (2)] Length 885.2 Best-BlastP =>> nrprot 38% Identities = 160/289 (55%), Positives = 204/289 (70%) refINP 386181.11 HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] embJCAC46654 .1 j HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 299 886.3 Best-BlastP =>> nrprot 31% Identities = 50/153 (32%), Positives = 83/153 (54%), Gaps = 2/153 (1%) ) refINP299124.1 I shikimate kinase [Vibrio parahaemolyticus RIMD 2210633] spIQ87L67IAROK_VIBPA Shikimate kinase (SK) dbjIBAC61008.1 I shikimate kinase [Vibrio parahaemolyticus] Length = 172 887.4 Best-BlastP =>> nrprot 18% Identities = 82/315 (26% ), Positives = 132/315 (41%), Gaps = 67/315 (21%) refINP_229450.1 I alpha-amylase, putative [Thermotoga maritima] pir1IG72227 hypothetical protein TM1650 - Thermotoga maritima (strain MSB8) gbIAAD36717.11AE001807_8 alpha- amylase, putative [Thermotoga maritima] Length = 422 888.3 Best-BlastP =>> nrprot 73% Identities = 240/415 (57%), Positives = 303/415 (73%), Gaps = 2/415 (0%) refINP_794674 .1 GTP-binding protein HfIX [Pseudomonas syringae pv. tomato str. DC3000] gbIAAO58369.1 I GTP-binding protein HfIX [Pseudomonas syringae pv.

  tomato str. DC3000] Length = 433 889.1 Best-BlastP =>> nrprot 45% Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 1/128 (0%) spIP35160IRESA_BACSU Thiol-disulfide oxidoreductase resA Length = 179 891.3 Best-BlastP =>> nrprot 29% Identities = 84/420 (20%), Positives = 157/420 (37%), Gaps = 115/420 (27%) embjCAC18568.1 J phosphatidylcholinehydrolyzing phospholipase C [ Pseudomonas fluorescens] Length = 385 879.2 880.3 881.2 882.3 884.3 893.4 Best-BlastP =>> nrprot 67% Identities = 430/811 (53%), Positives = 561/811 (69%), Gaps = 6/811 (0%) dbjIBAA77891.1j Acyl-CoA dehydrogenase (EC 1.3.99.-). [Escherichia coli] Length = 840 894.3 Best-BlastP =>> nrprot No Hits found 895.3 Best-BlastP =>> nrprot 54% Identities = 102/300 (34%), Positives = 159/300 (53%), Gaps = 25/300 (8%) refGZP_00107238.1 COG0697: Permeases of the drug / metabolite transporter (DMT) superfamily [Nostoc punctiform] Length = 369 897.2 Best-BlastP =>> nrprot 99% Identities = 764/764 (100%) , Positive = 764/764 (100%) gbIAAF05327.2d phosphoenoipyruvate-protein phosphotransferase PtsP [Legionella pneumophila] Length = 764 898.2 Best-BlastP =>> nrprot 57% Identities = 96/257 (37%), Positive = 156/257 (60%), Gaps = 1/257 (0%) refIZP_00130066.1! COG0730: Predicted permeases [Desulfovibrio desulfuricans G20] Length = 265 899.3 Best-BlastP =>> nrprot 77% Identities = 163/257 (63%), Positives = 200/257 (77%), Gaps = 1/257 (0% ) [PROGRESSIVE DIPLOMACYLYLYL TRANSLATION] [Coxiella burnetii RSA 493] Prolipoprotein diacylglyceryl transferase [Coxiella burnetii RSA 493] Length = 261 9.1 Best-BlastP =>> nrprot 44% Identities = 57/140 (40%), Positives = 75/140 (53%), Gaps = 4/140 (2%) dbjIBAC94688.1 j hypothetical protein [Vibrio vulnificus YJ016] Length = 343 901.2 Best-BlastP =>> nrprot No Hits found 903.2 Best-BlastP => > nrprot No Hits found 905.2 Best-BlastP =>> nrprot 78% Identities = 176/285 (61%), Positives = 225/285 (78%), Gaps = 2/285 (0%) refINP_773784.1 j oxidoreductase [ Bradyrhizobium japonicum] dbjIBAC52409. 1 I oxidoreductase [Bradyrhizobium japonicum USDA 110] Length = 308 907.4 Best-BlastP =>> nrprot 81% Identities = 571/879 (64%), Positives = 727/879 (82%), Gaps = 2/879 (0% COG2609: Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Azotobacter vinelandii] Length = 893 908.4 Best-BlastP =>> nrprot 69% Identities = 273/562 (48%), Positives = 378/562 (67%) %), Gaps = 26/562 (4%) refINP_716062.1 pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase [Shewanella oneidensis MR-1] gbIAAN53507.1 IAE015490_8 pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase [Shewanella oneidensis MR- 1] Length = 677 909.2 Best-BlastP =>> nrprot 54% Identities = 107/278 (38%), Positive = 156/278 (56%) refINP820642.1 1 conserved hypothetical protein [Coxiella burnetii RSA 493] gbIAA091156.1 conserved hypothetical protein [Coxiella burnetii RSA 493] Length = 294 910.4 Best-BlastP =>> nrprot 78% Identities = 476/739 (64%), Positi ves = 590/739 (79%) refINP_253651.1 j topoisomerase IV subunit A [Pseudomonas aeruginosa PA01] pirjIG83025 topoisomerase IV subunit A PA4964 [imported] - Pseudomonas aeruginosa (strain PA01) gbjAAGO8349.1 jAE004909_5 topoisomerase IV subunit A [Pseudomonas aeruginosa PA01 ] Length = 754 914.3 Best-BlastP =>> nrprot 70% Identities = 338/573 (58%), Positives = 411/573 (71%), Gaps = 6/573 (1%) gbjAAL27383.1 jAF426171_14 putative ABC carry EIsE [Yersinia pestis] Length = 580 915.3 Best-BlastP =>> nrprot 64% Identities = 132/332 (39%), Positives = 183/332 (55%), Gaps = 54/332 (16%) refINP 455356.1 HIyD -family secretion protein [Salmonella enterica subsp. enterica serovar Typhi] refINP_805830. 11 HIyD-family secretion protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] spIQ8Z879IYBHG_SALTI Hypothetical UPF0194 protein membrane ybhG pirIIAG0599 HIyD-family secretion protein [imported] Salmonella enterica subsp. enterica serovar typhi (strain CT18) embicAD05265.1 I HIyD- family secretion protein [Salmonella enterica subsp. enterica serovar Typhi] gbIAAO69690.1 I HIyD-family secretion protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 331 916.3 Best-BlastP =>> nrprot 69% Identities = 162/336 (48%), Positives = 232/336 (69%), Gaps = 11/336 (3%) refINP_819097.1 I ferrochelatase [Coxiella burnetii RSA 493] gbIAAO89611.1 1 ferrochelatase [Coxiella burnetii RSA 493] Length = 343 917.3 Best-BlastP =>> nrprot 65% Identities = 43/71 (60%), Positives = 51/71 (71% refINP_404959.1 I cold shock-like protein [Yersinia pestis] pirIIAH0166 cold shock-like protein [imported] Yersinia pestis (strain 0092) embICAC90195.1 cold shock-like protein [Yersinia pestis CO92] Length = 87 918.3 Best-BlastP =>> nrprot No Hits found 919.1 Best-BlastP =>> nrprot 62% Identities = 51/125 (40%), Positives = 86/125 (68%), Gaps = 1/125 (0%) refINP_249650.1 j hypothetical protein [Pseudomonas aeruginosa PA0I] pirIIA83524 hypothetical protein PA0959 [imported] - Pseudomonas aeruginosa (strain PAO1) gbIAAG04348. PA0959 [Pseudomonas aeruginosa PAO1] Length = 209 920.2 Best-BlastP =>> nrprot 43% Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 4/116 ( 3%) refizP_00082077.1 I hypothetical protein [Geobacter metallireducens] Length = 130 921.3 Best-BlastP =>> nrprot 71% Identities = 107/194 (55%), Positives = 141/194 (72%), Gaps = 1 / Recombinational DNA repair protein [Vibrio vulnificus CMCP6] dbjIBAC95173.1 Recombinational DNA repair protein [Vibrio vulnificus YJ016] Recombinational DNA repair protein [Vibrio vulnificus YJ016] Recombinational DNA repair protein [Vibrio vulnificus YJ016] Recombinational DNA repair protein [Vibrio vulnificus YJ016] = 200 922.2 Best-BlastP =>> nrprot 54% Identities = 101/244 (41%), Positives = 150/244 (61%), Gaps = 10/244 (4%) refINP_232123.1 I hypothetical protein VC2494 [Vibrio cholerae 01 biovar eltor str. N16961] pirIJA82069 hypothetical protein VC2494 [imported] - Vibrio cholerae (strain N16961 serogroup 01) gblAAF95636.1I hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] Length = 263 Best-BlastP =>> nrprot 26% Identities = 104/453 (22%), Positives = 180/453 (39%), Gaps = 103/453 (22%) refINP_126866.1 I hypothetical protein [ Pyrococcus abyssi] pir11075099 hypothetical protein PAB0793 - Pyrococcus abyssis (strain Orsay) embICAB50096.1 I Sulphatase [Pyrococcus abyssi] Length = 479 Best-BlastP =>> nrprot 63% Identities = 282/620 (45%), Positives = 401/620 (64%), Gaps = 9/620 (1%) refINP_246321. 11 SpeA [Pasteurella multocida] gbIAAK03466.1 I SpeA [Pasteurella multocida] Length = 644 Best-BlastP =>> nrprot 55% Identities = 85/232 (36%), Positives = 130/232 (56%), Gaps = 1 / 232 (0%) refINP_743997.1 I glutamine amidotransferase, class I [Pseudomonas putida KT2440] gbIAAN67461.11AE016373_3 glutamine amidotransferase, class I [Pseudomonas putida KT2440] Length = 244 Best-BlastP =>> nrprot 72% Identities = 217/380 (57%), Positives = 279/380 (73%) refINP_386317.11 PUTATIVE ALCOHOL DEHYDROGENASE PROTEIN [Sinorhizobium meliloti] EmbICAC46790.1 PUTATIVE ALCOHOL DEHYDROGENASE PROTEIN [Sinorhizobium meliloti] Length = 381 923.3 925.3 926.4 928.1 929.2 Best-BlastP =>> nrprot 72% Identities = 255/464 (54%), Positives = 339/464 (73%), Gaps = 3/464 (0%) refINP_104264.11 dehydrogenase, (succinatesemialdehyde dehydrogenase, aldehyde dehydrogenase, aldehyde dehydrogenase) [Mesorhizobium loti ] dbjIBAB50050.1 I dehydrogenase; succinatesemialdehyde dehydrogenase; aldehyde dehydrogenase; aldehyde dehydrogenase [Mesorhizobium loti] Length = 462 930.3 Best-BlastP =>> nrprot 67% Identities = 226/441 (51%), Positives = 309/441 (70%), Gaps = 3/441 (0%) reflNP_220602. 1 CYTOCHROME OF UBIQUINOL OXIDASE SUBUNIT I (cydA) [Rickettsia prowazekii] pirl1H71732 cytochrome D ubiquinol oxidase chain I (cydA) RP216 - Rickettsia prowazekii embICAA14679.11 CYTOCHROME OF UBIQUINOL OXIDASE SUBUNIT I (cydA) [Rickettsia prowazekii] Length = 453 932.1 Best -BlastP =>> nrprot 69% Identities = 157/331 (47%), Positives = 229/331 (69%), Gaps = 3/331 (0%) refINP_794398.1 cyanide-insensitive terminal oxidase CioB [Pseudomonas syringae pv . tomato str. DC3000] gblAAO58093.1 1 cyanide-insensitive terminal oxidase C10B [Pseudomonas syringae pv. tomato str. DC3000] Length = 335 935.2 Best-BlastP =>> nrprot 50% Identities = 81/260 (31%), Positives = 132/260 (50%), Gaps = 6/260 (2%) refINP_532654.1 I conserved hypothetical protein [Agrobacterium tumefaciens str. US Pat. C58 (U. Washington)] Length = 262 936.3 Best-BlastP =>> nrprot 35% Identities = 38/156 (24%), Positives = 65/156 (41%), Gaps = 22/156 (14%) reflNP_718932 .11 conserved hypothetical protein [Shewanella oneidensis MR-1] gbjAAN56376.11AE015774_11 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 190 937.3 Best-BlastP =>> nrprot 67% Identities = 237/470 (50%), Positives = 320/470 (68%), Gaps = 8/470 (1%) refINP_820223.1 I sensor histidine kinase [Coxiella burnetii RSA 493] gbIAAO90737.1 J sensor histidine kinase [Coxiella burnetii RSA 493] Length = 478 938.3 Best-BlastP =>> nrprot 6% Identities = 22/49 (44%), Positive = 36/49 (73%) gbJEAAI6201.1 J ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [Plasmodium yoelii yoelii] Length = 643 94.7 Best-BlastP =>> nrprot 23 % Identities = 354/1425 (24%), Positives = 554/1425 (38%), Gaps = 309/1425 (21%) RefDNA_772111.1 J bII5471 [Bradyrhizobium japonicum] dbjIBAC50736.1 bII5471 [Bradyrhizobium japonicum USDA 110] Length = 4210 940.4 Best-BlastP =>> nrprot 60% Identities = 134/293 (45%), Positives = 176/293 (60%), Gaps = 23/293 (7%) refJNP_931279.1 Ribosomal protein L11 methyltransferase [Photorhabdus luminescens subsp. laumondii TTOI] embJCAE16459.1J ribosomal protein L11 methyltransferase [Photorhabdus luminescens subsp. ## EQU1 ## (ACC) [Photorhabdus luminescens subsp. biotin carboxylase (A subunit of acetyl-CoA carboxylase) (ACC) [Photorhabdus luminescens subsp. laumondii TTO1] Length = 449 943.3 Best-BlastP =>> nrprot 72% Identities = 86/160 (53%), Positives = 117/160 (73%), Gaps = 6/160 (3%) refJNP_760165.1 J Biotin carboxyl carrier protein [Vibrio vulnificus CMCP6] gbJAAO09692.11AE016801_11 Biotin carboxyl carrier protein [Vibrio vulnificus CMCP6] dbjJBAC95899.11 biotin carboxyl carrier protein [Vibrio vulnificus YJ016] Length = 154 944.3 Best-BlastP =>> nrprot 78% Identities = 93/145 (64%), Positives = 114/145 (78%) COG0757: 3-dehydroquinate dehydratase II [Azotobacter vinelandii] Length = 147,946.3 Best-BlastP =>> nrprot 62% Identities = 80/201 (39%) ), Positives = 126/201 (62%) refINP_768568.1 bII1928 [Bradyrhizobium japonicum] gbjAAG60905.11AF322013_24 ID481 [Bradyrhizobium japonicum] dbjJBAC47193. 11 bill 928 [Bradyrhizobium japonicum USDA 110] Length = 223 947.3 Best-BlastP =>> nrprot 43% Identities = 42/78 (53%), Positives = 53/78 (67%) refINP_768567.1 I bII1927 [Bradyrhizobium japonicum] id479 [Bradyrhizobium japonicum] dbjIBAC47192. 1927 [Bradyrhizobium japonicum USDA 110] Length = 374,948.3 Best-BlastP =>> nrprot 72% Identities = 88/155 (56%), Positives = 118/155 (76%) refJZP_00092102.1 I COG1943: Transposase and inactivated derivatives [Azotobacter vinelandii] Length = 270 949.3 Best-BlastP =>> nrprot 70% Identities = 322/616 (52%), Positives = 436/616 (70%), Gaps = 4/616 (0%) refINP_820141.1 protein-export membrane protein SecD [Coxiella burnetii RSA 493] gbIAAO90655.1 I protein-export membrane protein SecD [Coxiella burnetii RSA 493] Length = 622 950.2 Best-BlastP =>> nrprot 15% Identities = 49/165 (29% ), Positives = 77/165 (46%), Gaps = 13/165 (7%) embJCAA70596.1 cinnamate-4-hydroxylase [Phaseolus vulgaris] Length = 355 952.1 Best-BlastP =>> nrprot 46% Identities = 87/296 (29%), Positive = 142/296 (47%), Gaps = 12/296 (4%) gbIAAD02145.11 regulatory protein [Pseudomonas stutzeri] Length = 300 953.2 Best-BlastP =>> nrprot 12% Identities = 30 / 118 (25%), Positives = 62/118 (52%), Gaps = 19/118 (16%) refINP_78 5847.1 Esterase (putative) [Lactobacillus plantarum WCFS1] EmbICAD64698.1I esterase (putative) [Lactobacillus plantarum WCFS1] Length = 339 956.2 Best-BlastP =>> nprot 56% Identities = 102/249 (40%), Positive = 143 / 249 (57%), Gaps = 3/249 (1%) refINP_419511.1 I transcriptional regulator SkgA [Caulobacter crescentus CB15] spIQ9RP67JSKGA_CAUCR Transcriptional regulator skgA (Stationary-phase regulation of katG protein) pin C87335 transcription regulator SkgA [imported] - Caulobacter crescentus gbJAAF01797.1 IAF170912_1 putative helix-turn-helix transcriptional regulator SkgA [Caulobacter crescentus] gbjAAK22679.1 transcriptional regulator SkgA [Caulobacter crescentus CB15] Length = 255 957.2 Best-BlastP =>> nrprot 44% Identities = 89/269 (33% ), Positives = 129/269 (47%), Gaps = 3/269 (1%) refINP_337940.1 l hydrolase, alpha / beta hydrolase family fold [Mycobacterium tuberculosis CDC1551] gbjAAK47754.1 hydrolase, alpha / beta hydrolase fold family [Mycobacterium tuberculosis CDC1551] Leng th = 310 959.2 Best-BlastP =>> nrprot No Hits found 96.6 Best-BlastP =>> nrprot 99% Identities = 276/277 (99%), Positives = 277/277 (100%) gbIAAM00632.1 j unknown [Legionella Pneumophila] Length = 294 960.2 Best-BlastP =>> nrprot 82% Identities = 79/102 (77%), Positives = 86/102 (84%) gbIAAM00607.1 [Legionella pneumophila] Length = 121 964.3 Best-BlastP = >> nrprot 24% Identities = 61/202 (30%), Positives = 103/202 (50%), Gaps = 18/202 (8%) gbJAAF05325.1 j virulence protein [Legionella pneumophila] Length = 205 965.3 Best -BlastP =>> nrprot 99% Identities = 118/118 (100%), Positives = 118/118 (100%) gb (AAQ10305.1 (DotV [Legionella pneumophila] Length = 180 966.2 Best-BlastP =>> nrprot 53 % Identities = 95/244 (38%), Positive = 133/244 (54%), Gaps = 7/244 (2%) refINP_639315.1 I phenol hydroxylase [Xanthomonas campestris pv. campestris str. ATCC 33913] gbIAAM43197.11 phenol hydroxylase [Xanthomonas campestris pv.

  campestris str. ATCC 33913] Length = 307 967.2 Best-BlastP =>> nrprot 71% Identities = 184/333 (55%), Positives = 242/333 (72%) reflZP_00032409.11 COG3588: Fructose-1,6-bisphosphate aldolase [Burkholderia fungorum] Length = 370 969.2 Best-BlastP =>> nrprot 67% Identities = 116/243 (47%), Positives = 168/243 (69%), Gaps = 1/243 (0%) refINP_819931.11 endonuclease / exonuclease / phosphatase family [Coxiella burnetii RSA 493] gblAAO90445.1 1 endonuclease / exonuclease / phosphatase family [Coxiella burnetii RSA 493] Length = 255 97.2 Best-BlastP =>> nrprot No Hits found 971.2 Best-BlastP =>> nrprot No Hits found 972.3 Best-BlastP =>> nrprot 24% Identities = 82/304 (26%), Positives = 130/304 (42%), Gaps = 29/304 (9%) refINP 477218.1 I loki CG10895-PB [Drosophila melanogaster] refInP_724241.1 I loki CG10895-PC [Drosophila melanogaster] dbjIBAA28756.1 I short form of nuclear kinase [Drosophila melanogaster] gbIAAL48020.11 LD27857p [Drosophila melanogaster] gblAAN11062.1l CG10895-PB [Drosophila melanogaster] gblAAN11063 .1 j CG10895-PC [Drosophila melanogaster] Length = 459 974.2 Best-BlastP =>> nrprot 58% Identities = 151/387 (39%), Positives = 226/387 (58%), Gaps = 8/387 (2) %) refINP_925546.1 I aspartate aminotransferase [Gloeobacter violaceus] dbjIBAC90541.1 Aspartate aminotransferase [Gloeobacter violaceus] Length = 395 976.3 Best-BlastP =>> nrprot 58% Identities = 31/82 (37%), Positive = 51/82 (62%) refINP_378270.1I 341aa long conserved hypothetical protein [Sulfolobus tokodaii] dbjlBAB67379.1 1341aa long conserved hypothetical protein [Sulfolobus tokodaii] Length = 341 977.3 Best-BlastP =>> nrprot 39% Identities = 69/181 (38%) , Positives = 88/181 (48%), Gaps = 6/181 (3%) refINP_632394.1 J chorismate mutase; prephenate dehydratase [Methanosarcina mazei Goel] gblAAM30066.11 chorismate mutase; prephenate dehydratase [Methanosarcina mazei Goel] Length = 354 979.3 Best-BlastP =>> nrprot 40% Identities = 124/252 (49%), Positives = 162/252 (64%), Gaps = 3/252 (1%) gblAAB97629 .1 J malonate decarboxylase beta subunit [Acinetobacter calcoaceticus] Length = 295 980.1 Best-BlastP =>> nrprot 58% Identities = 89/229 (38%), Positives = 140/229 (61%), Gaps = 3/229 ( 1%) refINP 640916.1 I malonate decarboxylase gamma subunit [Xanthomonas axonopodis pv. citri str. 306] gblAAM35452.1! malonate decarboxylase gamma subunit [Xanthomonas axonopodis pv. citri str. 306] Length = 234 981.2 Best-BlastP =>> nrprot 52% Identities = 60/217 (27%), Positives = 113/217 (52%), Gaps = 29/217 (13%) gbIAAF20287.1IAFI21266_9 MdcE [Acinetobacter calcoaceticus] Length = 226 982.3 Best-BlastP =>> nrprot 64% Identities = 196/465 (42%), Positives = 301/465 (64%), Gaps = 21/465 (4%) refINP_819781.1 Protease DO [Coxiella burnetii RSA 493] gbjAAO90295.11 DO protease [Coxiella burnetii RSA 493] Length = 451 983.1 Best-BlastP =>> nrprot 64% Identities = 112/239 (46%), Positive = 156/239 (65%), Gaps = 7/239 (2%) refINP_230359.1 conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. [Vibrio cholerae (strain N16961 serogroup 01) gblAAF93875.11 conserved hypothetical protein [Vibrio cholerae 01 biovar eltor str. N16961] pirlIH82289

  N16961] Length = 240 985.2 Best-BlastP =>> nrprot 66% Identities = 148/309 (47%), Positives = 215/309 (69%), Gaps = 4/309 (1%) refINP 779940.1 (ribosomal large subunit pseudouridine synthase D [Xylella fastidiosa Temeculal] spIQ87AR7IRLUD XYLFT Ribosomal broad subunit pseudouridine synthase D (Pseudomonidylate synthase) (Uracil hydrolyase) gbjAA029589.1 J ribosomal broad subunit pseudouridine D synthase [Xylella fastidiosa Temeculal] Length = 331 986.3 Best-BlastP =>> nrprot 83% Identifies = 55/83 (66%), Positives = 72/83 (86%), Gaps = 3/83 (3%) refJZP_00065010.1 J COG1923: Uncharacterized host factor protein [Microbulbifer degradans2-40] Length = 86 989.3 Best-BlastP =>> nrprot No Hits found 99.1 Best-BlastP =>> nrprot No Hits found 991.2 Best-BlastP =>> nrprot 53% Identities = 104/276 (37%), Positives = 152/276 (55 %), Gaps = 3/276 (1%) refINP_680903.1 ORF_ID: tlr0112 probable hydrolase [Thermosynechococcus elongatus BP-1] dbjIBAC07665.1J ORF_ID: t! R0112-probable hydrolase [Thermosynechococ cus elongatus BP-1] Length = 285 992.2 Best-BlastP =>> nrprot No Hits found 993.2 Best-BlastP =>> nrprot 80% Identities = 285/416 (68%), Positives = 332/416 (79%), Gaps = 3/416 (0%) refINP 820266.1) phosphofructokinase, putative [Coxiella burnetii RSA 493] gb! AA090780.11 phosphofructokinase, putative [Coxiella burnetii RSA 493] Length = 420 994.2 995.2 transferase family protein [Shewanella oneidensis MR-1] gblAAN54726.11AE015613_3 glutathione S-transferase family protein [Shewanella oneidensis MR-1] Length = 216 996.2 Best-BlastP =>> nrprot 79% Identities = 221/328 (67%), Positives = 266/328 (81%), Gaps RefDoc, THE reference in scientific document supply. 99% Identifies = 345/348 (99%), Positives = 347/348 (99%) spIQ53407! LLY_LEGPN 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE (4HPPD) (HPD) (LEGIOLYSIN) gb! AA C32843.1 I legiolysin [Legionella pneumophila] Length = 348 998.3 Best-BlastP =>> nrprot 69% Identities = 337/597 (56%), Positives = 425/597 (71%), Gaps = 4/597 (0% ) ATP-dependent DNA helicase RecQ [Coxiella burnetii RSA 493] gbjAA090021.1 ATP-dependent DNA helicase RecQ [Coxiella burnetii RSA 493] Length = 601 999.2 Best-BlastP =>> nrprot 75% Identifies = 225 / 375 (60%), Positives = 290/375 (77%) ref! ZP_00056039.1! COG1960: Acyl-CoA dehydrogenases BestBlastP =>> nrprot 53% Identifies = 284/930 (30%), Positives = 483/930 (51%), Gaps = 57/930 (6%) refJZP_00126364.1! COG0784: FOG: CheY-Iike receiver [Pseudomonas syringae pv. syringae B728a] Length = 917 Best-BlastP =>> nrprot 70% Identifies = 109/212 (51%), Positives = 151/212 (71%), Gaps = 6/212 (2%) refINP217282.1 I glutathione S -

Claims (66)

  1. Isolated or purified nucleotide sequence of Legionella pneumophila strain Paris, characterized in that it is chosen from the sequence SEQ ID N 55 and among the sequences SEQ ID N 1 to SEQ ID N 54, and SEQ ID Na 56.   2. Isolated or purified nucleotide sequence of Legionella pneumophila strain Paris, characterized in that it is chosen from: a) a nucleotide sequence comprising at least one sequence having 80% identity with the sequence SEQ ID N 55 and the SEQ sequences ID N 1 to 10 SEQ ID 54, and SEQ ID 56; b) a nucleotide sequence hybridizing under conditions of high stringency with SEQ ID N 1 to SEQ ID N 56; c) a nucleotide sequence complementary to SEQ ID No. 1 to SEQ ID No. 56 or complementary to a nucleotide sequence as defined in a), or b), or a nucleotide sequence of the corresponding RNA; and d) a nucleotide sequence of at least 15 nucleotides of fragment representative of SEQ ID No. 1 to SEQ ID No. 56, or fragment representative of their sequence.   3. Nucleotide sequence according to claim 2, characterized in that it codes for a polypeptide chosen from polypeptides of sequence SEQ ID N 57 to SEQ ID N 3455.   4. A nucleotide sequence characterized in that it comprises a nucleotide sequence chosen from: a) a nucleotide sequence according to claim 3; b) a nucleotide sequence comprising at least 80% identity with a nucleotide sequence according to claim 3; c) a nucleotide sequence hybridizing under conditions of high stringency with a nucleotide sequence according to claim 3; d) a complementary nucleotide sequence or RNA corresponding to a sequence as defined in a), b) or c); and e) a representative fragment nucleotide sequence of at least 15 nucleotides of a sequence as defined in a) or d).   5. Polypeptide encoded by a nucleotide sequence according to one of claims 2 to 4.   6. Polypeptide according to claim 5, characterized in that it is chosen from the sequences SEQ ID N 57 to SEQ ID N 3455.   7. Polypeptide characterized in that it comprises a polypeptide chosen from: a) a polypeptide according to one of claims 5 and 6; b) a polypeptide having at least 80% identity with a polypeptide according to one of claims 5 and 6; and c) a biologically active fragment of at least 5 amino acids of a polypeptide according to one of claims 5 and 6.   Nucleotide sequence encoding a polypeptide according to claim 7.   9. Nucleotide sequence according to one of claims 2 to 4, and 8, characterized in that it codes for a specific polypeptide of a bacterium of the genus Legionella, or one of its fragments of at least 5 amino acids , or its complementary nucleic sequence.   10. Nucleotide sequence according to one of claims 2 to 4, and 8, characterized in that it codes for a specific polypeptide of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.   11. Nucleotide sequence according to one of claims 2 to 4, and 8, characterized in that it codes for a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris, or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.   12. nucleotide sequence according to one of claims 2 to 4, and 8, characterized in that it codes for a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, or the one of its fragments of at least 5 amino acids, in particular chosen from polypeptides of sequence SEQ ID NO: 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181 or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.   13. Nucleotide sequence according to one of claims 2 to 4, and 8, characterized in that it codes for a surface polypeptide of Legionella pneumophila strain Paris, or one of its fragments of at least 5 amino acids, in particular, chosen from polypeptides of sequence SEQ ID Ns. 3410, 704, 746, 2267, 2751, 3192, 3218, 3221, 3222, 3317, 3324, 136, 171, 310, 337, 481, 527, 652, 664, 893, 972, 1148, 1298, 1361, 1503, 1521. , 1576, 1651, 1755, 1847, 1877, 2224, 2406, 2843, 2930, 3037, 3139, 3157, 3165, 3181, or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.   14. Nucleotide sequence according to claim 13, characterized in that it codes for a specific surface polypeptide of Legionella pneumophila strain Paris relative to the Philadelphia strain, chosen from the polypeptides of sequence of sequence SEQ ID No. 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or one of its fragments of at least 5 amino acids, or its complementary nucleic sequence.   15. Nucleotide sequence according to one of claims 2 to 4, and 8, characterized in that it encodes a polypeptide involved in the biosynthesis of cell envelope polysaccharide Legionella pneumophila strain Paris, in particular selected from the polypeptides of sequence SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411, or one of its representative fragments of at least 5 amino acids, or its complementary nucleic sequence.   16. Polypeptide according to one of claims 5 to 7, characterized in that it is a specific polypeptide of a bacterium of the genus Legionella, or one of its fragments of at least 5 amino acids.   17. Polypeptide according to one of claims 5 to 7, characterized in that it is a specific polypeptide of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or one of its representative fragments of at least 5 amino acids.   18. Polypeptide according to one of claims 5 to 7, characterized in that it is a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris, or one of its fragments representative of at least 5 amino acids.   19. Polypeptide according to one of claims 5 to 7, characterized in that it is a specific polypeptide of a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, or one of its representative fragments of at least 5 amino acids, in particular chosen from polypeptides of sequence SEQ ID NO: 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or one of its representative fragments of at least 5 amino acids.   20. Polypeptide according to one of claims 5 to 7, characterized in that it is a surface polypeptide of Legionella pneumophila strain Paris, or one of its representative fragments of at least 5 amino acids, in particular, chosen from polypeptides of sequence SEQ ID Ns. 3410, 704, 746, 2267, 2751, 3192, 3218, 3221, 3222, 3317, 3324, 136, 171, 310, 337, 481, 527, 652, 664, 893, 972, 1148, 1298, 1361, 1503, 1521. , 1576, 1651, 1755, 1847, 1877, 2224, 2406, 2843, 2930, 3037, 3139, 3157, 3165, 3181, or one of its representative fragments of at least 5 amino acids.   21. Polypeptide according to one of claims 5 to 7, characterized in that it is a surface specific polypeptide of Legionella pneumophila strain Paris with respect to the Philadelphia strain, selected from polypeptides of sequence SEQ ID N 3410, 171, 337, 481, 652, 1148, 1521, 2843, 3037, 3181, or a representative fragment thereof of at least 5 amino acids.   22. Polypeptide according to one of claims 5 to 7, characterized in that it is a polypeptide involved in the biosynthesis of cell envelope polysaccharide Legionella pneumophila strain Paris, in particular selected from the sequence polypeptides SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411, or one of its representative fragments of at least 5 amino acids.   23. Nucleotide sequence usable as a primer or as a probe, characterized in that said sequence is chosen from the nucleotide sequences according to one of Claims 2 to 4, and 8 to 15.   24. Nucleotide sequence according to claim 23, characterized in that it is labeled.   25. Use of a nucleotide sequence according to claim 23 or 24 for the detection and / or amplification of nucleic sequences.   26. DNA chip or filter, characterized in that it contains at least one nucleotide sequence according to claim 23 or 24.   27. DNA chip or filter according to claim 26, characterized in that it further contains at least one nucleotide sequence of a microorganism other than Legionella pneumophila strain Paris, immobilized on the support of said chip.   28. DNA chip or filter according to claim 27, characterized in that the other microorganism is selected from a microorganism of the genus Legionella, in particular of the species pneumophila.   29. Kit or kit for the detection and / or identification of a bacterium of the genus Legionella, or of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, in a sample, characterized in that it comprises a DNA chip or a filter according to one of claims 26 at 28.   30. Kit or kit for the detection and / or quantification of the expression of at least one gene specific for a bacterium of the genus Legionella, or a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila , or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris with respect to the Philadelphia strain, in a sample, characterized in that it contains a nucleotide sequence according to one of claims 2 to 4 and 8 to 15.   31. cloning vector, and / or expression, characterized in that it contains a nucleotide sequence according to one of claims 2 to 4 and 8 to 15.   32. Cloning vector, and / or expression according to claim 31, characterized in that it contains a nucleotide sequence according to claim 13.   33. Cloning vector, and / or expression according to claim 31, characterized in that it contains a nucleotide sequence according to claim 14.   34. Host cell, characterized in that it is transformed by a vector according to one of claims 31 to 33.   35. Plant or animal, except humans, comprising a transformed cell according to claim 34.   36. Process for the preparation of a polypeptide, characterized in that a cell transformed with a vector according to one of Claims 31 to 33 is cultured under conditions permitting the expression of said polypeptide and that said polypeptide is recovered. recombinant.   37. A recombinant polypeptide obtainable by a process according to claim 36.   38. Process for preparing a synthetic polypeptide according to one of claims 5 to 7, 16 to 22, characterized in that one carries out a chemical synthesis of said polypeptide.   39. Hybrid polypeptide, characterized in that it comprises at least the sequence of a polypeptide according to one of Claims 20 and 21, and a sequence of a polypeptide capable of inducing an immune response in humans or in humans. 'animal.   40. Nucleotide sequence encoding a hybrid polypeptide according to claim 39.   41. Vector characterized in that it contains a nucleotide sequence according to claim 40.   42. Monoclonal or polyclonal antibody, its fragments, or chimeric antibody, characterized in that it is capable of specifically recognizing a polypeptide according to   one of claims 5 to 7, 16 to 22.   43. Antibody according to claim 42, characterized in that it is a labeled antibody.   44. Process for the detection and / or identification of a bacterium of the genus Legionella, or a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, in a biological sample, characterized in that it comprises the following steps a) bringing the biological sample into contact with a antibody according to one of the claims 42 and 43;   b) highlighting the antigen-antibody complex that may be formed.   45. A method for detecting and / or quantifying the expression of a gene specific for a bacterium of the genus Legionella, or a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or of a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris with respect to the Philadelphia strain, in a sample, characterized in that a bacterium of the genus is brought into contact with Legionella, with an antibody according to claim 42 or 43 and detecting the antigen / antibody complex possibly formed.   46. Kit or kit for carrying out a method according to claim 44 or 45, characterized in that it comprises the following elements: a) an antibody according to one of claims 42 and 43; b) optionally, the reagents for the constitution of the environment conducive to the immunological reaction; c) optionally, the reagents making it possible to demonstrate the antigen-antibody complexes produced by the immunological reaction.   47. Protein chip, characterized in that it contains at least one polypeptide according to one of Claims 5 to 7, 16 to 22, and 37, or at least one antibody according to one of Claims 42 and 43, immobilized on the support of said chip.   48. Protein chip according to claim 47, characterized in that it further contains at least one microorganism polypeptide other than Legionella pneumophila strain Paris or at least one antibody directed against a microorganism compound other than Legionella pneumophila strain Paris, immobilized on the support of said chip.   49. Kit or kit for the detection and / or identification of a bacterium of the genus Legionella, or a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris compared to the Philadelphia strain, characterized in that it comprises a protein chip according to one claims 47 and 48.   50. A method for detecting and / or identifying a specific bacterium or detecting and / or identifying and / or quantifying the expression of a gene specific for the genus Legionella, or a pathogenic bacterium of the genus Legionella and / or the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris with respect to the Philadelphia strain, in a biological sample, characterized in that it implements a nucleotide sequence according to one of claims 1 to 4, 8 to 15, 23 and 24.   51. Method according to claim 50, characterized in that it comprises the following steps: a) optionally, isolation of the DNA from the biological sample to be analyzed, or obtaining a cDNA from the RNA the biological sample; b) amplification of the DNA of the bacteria present in the sample using at least one primer according to one of claims 23 and 24; c) highlighting and / or quantifying the amplification products.   52. Process according to claim 50, characterized in that it comprises the following steps: a) bringing a nucleotide probe according to one of claims 23 and 24 into contact with a biological sample, the nucleic acid contained in the biological sample having, where appropriate, previously been made accessible to hybridization, under conditions permitting the hybridization of the probe to the nucleic acid of a bacterium of the genus Legionella possibly present in said sample; b) demonstration of the hybrid possibly formed between the nucleotide probe and the nucleic acid of the biological sample.   53. Method according to claim 50, characterized in that it comprises the following steps: a) contacting a nucleotide probe according to claim 23 or 24 immobilized on a support with a biological sample, the nucleic acid of sample having, where appropriate, been previously made accessible to hybridization, under conditions permitting hybridization of the probe to the nucleic acid of a bacterium of the genus Legionella possibly present in said sample; b) contacting the hybrid formed between the nucleotide probe immobilized on a support and the nucleic acid contained in the biological sample, where appropriate after removal of the nucleic acid from the biological sample which has not hybridized with the probe, with a labeled nucleotide probe according to claim 24; c) highlighting the new hybrid formed in step b).   54. The method according to claim 53, characterized in that, prior to step a), the DNA of the biological sample or the cDNA possibly obtained by reverse transcription of the RNA of the sample, is amplified at using at least one primer according to one of claims 23 and 24.   55. Kit or kit for the detection and / or identification of a bacterium of the genus Legionella, or a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, in a biological sample, characterized in that it comprises the following elements: a) a nucleotide probe according to one claims 23 and 24; b) optionally, the reagents necessary for carrying out a hybridization reaction; c) optionally, at least one primer according to one of claims 23 and 24 as well as the reagents necessary for an amplification reaction of the DNA.   56. Kit or kit for the detection and / or identification of a bacterium of the genus Legionella, or of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, in a biological sample, characterized in that it comprises the following elements: a) a nucleotide probe, called a probe of capture according to claim 23; b) an oligonucleotide probe, called a revealing probe, according to claim 24; c) optionally, at least one primer according to one of claims 23 and 24 as well as the reagents necessary for an amplification reaction of the DNA.   57. Kit or kit for the detection and / or identification of a bacterium of the genus Legionella, or of a pathogenic bacterium of the genus Legionella and / or of the species Legionella pneumophila, or a bacterium of the species Legionella pneumophila strain Paris, or a bacterium of the species Legionella pneumophila strain Paris relative to the Philadelphia strain, in a biological sample, characterized in that it comprises the following elements: a) at least one primer according to the one of claims 23 and 24; b) optionally, the reagents necessary to perform a DNA amplification reaction; c) optionally, a component for verifying the sequence of the amplified fragment, more particularly an oligonucleotide probe according to one of claims 23 and 24.   58. Process according to claims 50 to 54, or kit or kit according to claims 55 to 57 for the detection and / or identification of a bacterium of the species Legionella pneumophila strain Paris with respect to the Philadelphia strain, characterized in that said primer and / or said probe are chosen from the nucleotide sequences according to claim 14, in that said polypeptides are chosen from the polypeptides according to claim 21 and in that said antibodies are chosen from the antibodies according to one of the claims 42 and 43 directed against a polypeptide according to claim 21.   59. A method for selecting a compound capable of inhibiting the expression of genes involved in the biosynthesis of cell envelope polysaccharides of the bacterium of the species Legionella pneumophila strain Paris, characterized in that it comprises the following steps: ) contacting said compound with a bacterium of said strain Paris, said bacterium being under conditions and in a medium suitable for its culture; b) determination of the ability of said compound to inhibit the expression of the genes encoding the proteins of sequence SEQ ID Nos. 1126, 3218, 288, 632, 917, 1503, 1555, 1877, 1928, 1963, 2204, 2212, 2243, 2324, 2378, 2410, 2411 using a method according to claim 45 wherein said antibody is directed specifically against a polypeptide according to claim 22, or using a method according to one of claims 50 and 51 wherein the probes or primers are specific for a nucleic acid sequence according to claim 15.   60. Vaccine or immunogenic composition, characterized in that it comprises one or more polypeptides according to one of claims 20 and 21, and / or one or more hybrid polypeptides according to claim 39.   61. Vaccine or immunogenic composition, characterized in that it contains a vector according to one of claims 32, 33 and 41.   62. Use of a composition according to claim 60 or 61 for the preparation of a vaccine or immunogenic composition for the prevention or treatment of a pathogenic bacterial infection belonging to the genus Legionella, preferably to the Legionella pneumophila species, especially the Paris strain, in association with a pharmaceutically acceptable carrier and, optionally, one or more suitable immunity adjuvants.   63. A genomic DNA library of a bacterium of the species Legionella pneumophila strain Paris, characterized in that it is the bank deposited at the CNCM on November 19, 2003, under the serial number I-3138 .   64. Vector or host cell according to claim 31 or 34, characterized in that it is the vector or the cell deposited at the CNCM November 19, 2003, under the serial number I-3137.   65. Method for the isolation of a polynucleotide of interest present in a bacterium of the genus Legionella and absent in a bacterium of another genus, or present in a pathogenic bacterium of the genus Legionella and absent in a non-pathogenic bacterium of the genus Legionella, or present in a bacterium of the species Legionella pneumophila and absent in a bacterium of any other species of the genus Legionella, or present in a bacterium of the species Legionella pneumophila strain Paris and absent in a bacterium of the species Legionella pneumophila of any other strain, characterized in that it uses at least the library according to claim 63.   66. Method according to claim 65, characterized in that it comprises the following steps: a) isolating at least one polynucleotide contained in a clone of said DNA library deposited at the CNCM on November 19, 2003, under the number of order I-3138; b) isolating: at least one genomic polynucleotide or cDNA of a second bacterium of another genus or of the genus Legionella, said second bacterium of the genus Legionella belonging to a strain different from the Paris strain or, alternatively, at least a polynucleotide contained in a clone of a DNA library based on a BAC prepared from the genome of a second bacterium of another genus or the genus Legionella, said second bacterium of the genus Legionella belonging to a strain different from the strain Paris; c) hybridizing the polynucleotide of step a) to the polynucleotide of step b); d) selecting the polynucleotides of step a) which did not form a hybridization complex with the polynucleotides of step b); and e) characterizing the selected polynucleotide.