FR2794371A1 - New polyepitopic fragments from human papilloma virus E6 and E7 proteins, useful for treatment or prevention of e.g. cervical neoplasia and cancer - Google Patents
New polyepitopic fragments from human papilloma virus E6 and E7 proteins, useful for treatment or prevention of e.g. cervical neoplasia and cancer Download PDFInfo
- Publication number
- FR2794371A1 FR2794371A1 FR9912511A FR9912511A FR2794371A1 FR 2794371 A1 FR2794371 A1 FR 2794371A1 FR 9912511 A FR9912511 A FR 9912511A FR 9912511 A FR9912511 A FR 9912511A FR 2794371 A1 FR2794371 A1 FR 2794371A1
- Authority
- FR
- France
- Prior art keywords
- type
- stably
- fragment
- hla molecules
- peptide sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 239000012634 fragment Substances 0.000 title claims abstract description 173
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 62
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 62
- 241000701806 Human papillomavirus Species 0.000 title claims abstract description 7
- 230000002265 prevention Effects 0.000 title claims description 6
- 206010028980 Neoplasm Diseases 0.000 title description 4
- 201000011510 cancer Diseases 0.000 title description 2
- 230000009826 neoplastic cell growth Effects 0.000 title 1
- 150000001413 amino acids Chemical class 0.000 claims abstract description 46
- 229960005486 vaccine Drugs 0.000 claims abstract description 15
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 12
- 238000006467 substitution reaction Methods 0.000 claims abstract description 8
- 229930182852 proteinogenic amino acid Natural products 0.000 claims abstract description 7
- 238000012217 deletion Methods 0.000 claims abstract description 4
- 230000037430 deletion Effects 0.000 claims abstract description 4
- 230000004048 modification Effects 0.000 claims abstract description 4
- 238000012986 modification Methods 0.000 claims abstract description 4
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 177
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 49
- 239000002773 nucleotide Substances 0.000 claims description 19
- 125000003729 nucleotide group Chemical group 0.000 claims description 19
- 239000013598 vector Substances 0.000 claims description 18
- 108010028921 Lipopeptides Proteins 0.000 claims description 17
- 101710132594 Protein E6 Proteins 0.000 claims description 11
- 101710132595 Protein E7 Proteins 0.000 claims description 8
- 241000700605 Viruses Species 0.000 claims description 7
- 239000000693 micelle Substances 0.000 claims description 7
- 230000007170 pathology Effects 0.000 claims description 7
- 238000002360 preparation method Methods 0.000 claims description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 5
- 239000003814 drug Substances 0.000 claims description 5
- 210000002443 helper t lymphocyte Anatomy 0.000 claims description 5
- 206010008263 Cervical dysplasia Diseases 0.000 claims description 4
- 208000007951 cervical intraepithelial neoplasia Diseases 0.000 claims description 4
- 208000018777 Vulvar intraepithelial neoplasia Diseases 0.000 claims description 3
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 2
- 101710154606 Hemagglutinin Proteins 0.000 claims description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims description 2
- 108010033276 Peptide Fragments Proteins 0.000 claims description 2
- 102000007079 Peptide Fragments Human genes 0.000 claims description 2
- 101710176177 Protein A56 Proteins 0.000 claims description 2
- 108010055044 Tetanus Toxin Proteins 0.000 claims description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 2
- 201000010881 cervical cancer Diseases 0.000 claims description 2
- 239000000185 hemagglutinin Substances 0.000 claims description 2
- 208000015181 infectious disease Diseases 0.000 claims description 2
- 229940118376 tetanus toxin Drugs 0.000 claims description 2
- 210000004291 uterus Anatomy 0.000 claims 1
- 239000000427 antigen Substances 0.000 abstract description 2
- 108091007433 antigens Proteins 0.000 abstract description 2
- 102000036639 antigens Human genes 0.000 abstract description 2
- 150000001875 compounds Chemical class 0.000 abstract 1
- 210000000265 leukocyte Anatomy 0.000 abstract 1
- 108020004707 nucleic acids Proteins 0.000 abstract 1
- 102000039446 nucleic acids Human genes 0.000 abstract 1
- 150000007523 nucleic acids Chemical class 0.000 abstract 1
- 108010079317 prolyl-tyrosine Proteins 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 43
- 235000001014 amino acid Nutrition 0.000 description 24
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 19
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 19
- 238000000034 method Methods 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 9
- 101710192141 Protein Nef Proteins 0.000 description 8
- -1 acids amines Chemical class 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007787 solid Substances 0.000 description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Natural products CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 5
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 description 4
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 description 4
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 108010084873 Human Immunodeficiency Virus nef Gene Products Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 210000004102 animal cell Anatomy 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 210000005260 human cell Anatomy 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 150000002430 hydrocarbons Chemical group 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 125000002345 steroid group Chemical group 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 125000000266 alpha-aminoacyl group Chemical group 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 150000003573 thiols Chemical group 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- JMCRDEBJJPRTPV-UHFFFAOYSA-N 1,2-Ethenediol Chemical group OC=CO JMCRDEBJJPRTPV-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- IMROMDMJAWUWLK-UHFFFAOYSA-N Ethenol Chemical group OC=C IMROMDMJAWUWLK-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 235000020661 alpha-linolenic acid Nutrition 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 150000001841 cholesterols Chemical class 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- AEOCXXJPGCBFJA-UHFFFAOYSA-N ethionamide Chemical compound CCC1=CC(C(N)=S)=CC=N1 AEOCXXJPGCBFJA-UHFFFAOYSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 125000000717 hydrazino group Chemical group [H]N([*])N([H])[H] 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 229960004488 linolenic acid Drugs 0.000 description 1
- KQQKGWQCNNTQJW-UHFFFAOYSA-N linolenic acid Natural products CC=CCCC=CCC=CCCCCCCCC(O)=O KQQKGWQCNNTQJW-UHFFFAOYSA-N 0.000 description 1
- 150000002634 lipophilic molecules Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 125000005699 methyleneoxy group Chemical group [H]C([H])([*:1])O[*:2] 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N n-hexadecanoic acid Natural products CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- JRZJOMJEPLMPRA-UHFFFAOYSA-N olefin Natural products CCCCCCCC=C JRZJOMJEPLMPRA-UHFFFAOYSA-N 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 125000005541 phosphonamide group Chemical group 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000012429 reaction media Substances 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 150000003536 tetrazoles Chemical class 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
<Desc/Clms Page number 1> <Desc / Clms Page number 1>
FRAGMENTS PROTEIQUES POLYEPITOPIQUES, LEUR OBTENTION ET LEURS UTILISATIONS NOTAMMENT EN VACCINATION
La présente invention a pour objet des fragments protéiques polyépitopiques, leur procédé d'obtention, et leurs utilisations, notamment dans le domaine de la vaccination thérapeutique ou préventive. POLYEPITOPIC PROTEIN FRAGMENTS, THEIR OBTAINMENT AND THEIR USES IN PARTICULAR IN VACCINATION
The present invention relates to polyepitopic protein fragments, their process for obtaining, and their uses, in particular in the field of therapeutic or preventive vaccination.
L'invention a plus particulièrement pour objet l'utilisation de fragments polyépitopiques d'une protéine déterminée pour la préparation de médicaments destinés à la prévention ou au traitement de pathologies dans lesquelles ladite protéine est reconnue par le système immunitaire cellulaire. A more particular subject of the invention is the use of polyepitopic fragments of a specific protein for the preparation of medicaments intended for the prevention or treatment of pathologies in which said protein is recognized by the cellular immune system.
Avantageusement, lesdits fragments polyépitopiques sont tels que leur acide aminé N-terminal correspond à l'acide aminé N-terminal de l'épitope situé en amont d'un ou plusieurs autres épitopes d'une région polyépitopique de ladite protéine, et leur acide aminé C-terminal correspond à l'acide aminé C-terminal de l'épitope situé en aval du ou des épitopes susmentionnés de ladite région polyépitopique. Advantageously, said polyepitopic fragments are such that their N-terminal amino acid corresponds to the N-terminal amino acid of the epitope located upstream of one or more other epitopes of a polyepitopic region of said protein, and their amino acid. C-terminal corresponds to the C-terminal amino acid of the epitope located downstream of the abovementioned epitope (s) of said polyepitopic region.
Ainsi, les fragments protéiques polyépitopiques susmentionnés de la présente invention correspondent avantageusement aux régions polyépitopiques d'une protéine déterminée, à savoir aux régions contenant plusieurs épitopes reconnus par les cellules T en association avec les différentes molécules du complexe majeur d'histocompatibilité (CMH), lesdites régions étant sélectionnées parmi celles ayant la caractéristique d'être dégradées in vitro en peptides plus courts par des protéasomes, tel que le protéasome 20S, lorsque le fragment protéique testé est mis en présence dudit protéasome, notamment selon la méthode détaillée suivante. Le fragment protéique (environ 75 g lorsqu'il s'agit d'un polypeptide d'environ 30 acides aminés) est incubé à 37 C avec environ 15 g de protéasome 20S (Calbiochem Ref 539150, La Jolla, CA, USA) dans 500 (il du tampon suivant : 20 mM Tris-HCl pH8, 0,5 mM EDTA et 0,035 % SDS. Des aliquots de 50 l sont prélevés après des temps d'incubation de 24 et 48 heures, et sont analysés par chromatographie liquide haute pression (HPLC). Les produits de digestion des protéasomes sont séparés par RP-HPLC (Perkin Elmer) en utilisant une colonne C18 et un gradient acétonitrile (de 0 à 100 % contenant 0,1 % d'acide trifluoroacétique, en 90 mn, taux d'élution 0,8 ml/mn). Les produits de clivage sont détectés à 214 nm par un détecteur à absorption (759A, Applied Biosystems). Thus, the abovementioned polyepitopic protein fragments of the present invention advantageously correspond to the polyepitopic regions of a determined protein, namely to the regions containing several epitopes recognized by T cells in association with the different molecules of the major histocompatibility complex (MHC), said regions being selected from those having the characteristic of being degraded in vitro into shorter peptides by proteasomes, such as proteasome 20S, when the protein fragment tested is brought into contact with said proteasome, in particular according to the following detailed method. The protein fragment (approximately 75 g in the case of a polypeptide of approximately 30 amino acids) is incubated at 37 ° C. with approximately 15 g of 20S proteasome (Calbiochem Ref 539150, La Jolla, CA, USA) in 500 (of the following buffer: 20 mM Tris-HCl pH8, 0.5 mM EDTA and 0.035% SDS. 50 l aliquots are taken after incubation times of 24 and 48 hours, and are analyzed by high pressure liquid chromatography Proteasome digestion products are separated by RP-HPLC (Perkin Elmer) using a C18 column and an acetonitrile gradient (from 0 to 100% containing 0.1% trifluoroacetic acid, in 90 min, rate 0.8 ml / min) The cleavage products are detected at 214 nm by an absorption detector (759A, Applied Biosystems).
<Desc/Clms Page number 2> <Desc / Clms Page number 2>
Avantageusement les régions polyépitopiques définies ci-dessus possèdent la caractéristique de contenir des acides aminés hydrophobes. Advantageously, the polyepitopic regions defined above have the characteristic of containing hydrophobic amino acids.
Les différents épitopes de la région polyépitopique de la protéine déterminée, et délimitant les fragments protéiques polyépitopiques, sont avantageusement sélectionnés parmi les peptides ; - se liant à une molécule déterminée du CMH, notamment à une molécule de type HLA déterminé, et ce jusqu'à des concentrations d'environ 10-6M à environ 10-10 M en peptide pour des concentrations d'environ 10-7 M en molécule HLA, notamment dans les conditions décrites ci-après, - et formant un complexe stable avec cette molécule du CMH, à savoir notamment un complexe dans lequel ledit peptide reste lié à ladite molécule pendant au moins environ 3 heures à 37 C. The various epitopes of the polyepitopic region of the determined protein, and delimiting the polyepitopic protein fragments, are advantageously selected from among the peptides; - Binding to a specific molecule of the MHC, in particular to a molecule of the HLA type determined, and this up to concentrations of approximately 10-6M to approximately 10-10 M in peptide for concentrations of approximately 10-7 M in HLA molecule, in particular under the conditions described below, - and forming a stable complex with this MHC molecule, namely in particular a complex in which said peptide remains linked to said molecule for at least approximately 3 hours at 37 C.
A titre d'illustration, les épitopes susmentionnés de l'invention sont sélectionnés parmi les peptides susceptibles : - d'une part de s'associer avec les molécules du CMH, notamment par mise en oeuvre de la méthode suivante : . incubation (notamment pendant environ 2 heures à 25 C, puis environ 15 heures à 4 C) du peptide en présence de molécules du CMH, provenant de la lyse de cellules humaines ou animales, ou purifiées notamment par chromatographie d'affinité à partir de lignées cellulaires humaines ou animales, . piégeage des complexes formés lors de l'étape précédente sur un support solide recouvert d'un premier anticorps, notamment monoclonal, reconnaissant spécifiquement les molécules du CMH dans leur conformation dépendante de leur liaison audit peptide, . addition sur le support solide précédent d'un deuxième anticorps marqué, notamment par couplage à un marqueur radioactif, enzymatique ou fluorescent, ledit anticorps marqué reconnaissant spécifiquement soit les chaînes lourdes du CMH dans leur conformation dépendante de leur liaison au peptide, soit la chaîne légère du CMH ou la p2-microglobuline se liant spécifiquement aux différentes chaînes lourdes du CMH dans leur conformation susmentionnée, . détection, après rinçage du support solide, de l'éventuelle présence du deuxième anticorps marqué resté fixé sur le support solide, témoignant d'un effet d'association entre les molécules du CMH et le peptide étudié, By way of illustration, the abovementioned epitopes of the invention are selected from the peptides capable of: - on the one hand, being associated with the MHC molecules, in particular by implementing the following method:. incubation (in particular for approximately 2 hours at 25 ° C., then approximately 15 hours at 4 ° C.) of the peptide in the presence of MHC molecules, originating from the lysis of human or animal cells, or purified in particular by affinity chromatography from lines human or animal cells,. trapping of the complexes formed during the previous step on a solid support covered with a first antibody, in particular monoclonal, specifically recognizing the MHC molecules in their conformation dependent on their binding to said peptide,. addition to the previous solid support of a second labeled antibody, in particular by coupling to a radioactive, enzymatic or fluorescent marker, said labeled antibody specifically recognizing either the heavy chains of the MHC in their conformation dependent on their binding to the peptide, or the light chain MHC or p2-microglobulin specifically binding to the different heavy chains of MHC in their aforementioned conformation,. detection, after rinsing of the solid support, of the possible presence of the second labeled antibody which remains fixed on the solid support, testifying to an association effect between the MHC molecules and the peptide studied,
<Desc/Clms Page number 3><Desc / Clms Page number 3>
- et, d'autre part, de former un complexe avec lesdites molécules du CMH, dont la stabilité peut être évaluée par mise en oeuvre d'une méthode de suivi dans le temps de la liaison établie entre le peptide et les molécules du CMH, cette méthode étant avantageusement effectuée selon un protocole identique à la méthode précédente, mais dans laquelle l'étape d'incubation du peptide en présence des molécules du CMH sur le support solide recouvert dudit premier anticorps, est précédée par une étape préalable d'élimination du peptide libre susceptible d'être présent dans le milieu réactionnel, notamment par lavage du support solide, ladite étape d'incubation étant effectuée (avantageusement à une température de 37 C) pendant des temps variables de lh, 3h, 5h, 24h et 48h. - and, on the other hand, to form a complex with said MHC molecules, the stability of which can be evaluated by implementing a method over time of the bond established between the peptide and the MHC molecules, this method being advantageously carried out according to a protocol identical to the previous method, but in which the step of incubating the peptide in the presence of the MHC molecules on the solid support covered with said first antibody, is preceded by a prior step of elimination of the free peptide capable of being present in the reaction medium, in particular by washing the solid support, said incubation step being carried out (advantageously at a temperature of 37 ° C.) for variable times of 1 h, 3 h, 5 h, 24 h and 48 h.
Comme mentionné ci-dessus, les épitopes de l'invention doivent être reconnus par les cellules T en association avec les molécules du CMH et s'associer à ces dernières, notamment dans le cadre de la mise en oeuvre du test de reconnaissance décrit cidessus. Cette association peut être faible (détectable à des concentrations en analogues peptidiques de l'ordre de 10-4 à 10-5 M), intermédiaire (détectable à des concentrations en analogues peptidiques de l'ordre de 10-6 à 10-7 M), ou forte (détectable à des concentrations en analogues peptidiques de l'ordre de 10-8 à 10-9 M). Les peptides associés aux molécules du CMH dans le cadre de la présente invention sont de préférence susceptibles de se lier pendant au moins environ 3 heures auxdites molécules du CMH. As mentioned above, the epitopes of the invention must be recognized by the T cells in association with the MHC molecules and be associated with the latter, in particular within the framework of the implementation of the recognition test described above. This association can be weak (detectable at concentrations of peptide analogs of the order of 10-4 to 10-5 M), intermediate (detectable at concentrations of peptide analogs of the order of 10-6 to 10-7 M ), or strong (detectable at concentrations of peptide analogues of the order of 10-8 to 10-9 M). The peptides associated with MHC molecules in the context of the present invention are preferably capable of binding for at least about 3 hours to said MHC molecules.
L'invention a plus particulièrement pour objet les épitopes (encore désignés peptides ci-dessus et ci-après) tels que décrits ci-dessus et caractérisés en ce qu'ils sont sélectionnés parmi ceux susceptibles : - d'induire in vitro la cytolyse par des lymphocytes T cytotoxiques, de cellules cibles présentant à leur surface le peptide susmentionné associé aux molécules du CMH, lesdits lymphocytes T cytotoxiques étant avantageusement prélevés sur un patient atteint d'une pathologie dans laquelle est impliqué le peptide étudié, - et d'induire in vitro la sécrétion de cytokines (ou interleukines) par les lymphocytes T cytotoxiques susmentionnés, notamment IL-2, IL-4 ou l'interféron y. A more particular subject of the invention is the epitopes (also designated peptides above and below) as described above and characterized in that they are selected from those capable of: - inducing cytolysis in vitro by cytotoxic T lymphocytes, of target cells having on their surface the above-mentioned peptide associated with MHC molecules, said cytotoxic T lymphocytes being advantageously taken from a patient suffering from a pathology in which the studied peptide is involved, - and inducing in in vitro the secretion of cytokines (or interleukins) by the aforementioned cytotoxic T lymphocytes, in particular IL-2, IL-4 or interferon y.
Le cas échéant, les épitopes susmentionnés sont choisis parmi ceux capables d'induire in vitro l'apparition et la croissance de lymphocytes T cytotoxiques à partir de cellules humaines ou animales, notamment à partir de cellules mononucléées issues du Where appropriate, the above-mentioned epitopes are chosen from those capable of inducing in vitro the appearance and growth of cytotoxic T lymphocytes from human or animal cells, in particular from mononuclear cells derived from
<Desc/Clms Page number 4><Desc / Clms Page number 4>
sang périphérique (PBMC), en présence de facteurs nécessaires à la croissance et la différenciation des cellules T cytotoxiques. peripheral blood (PBMC), in the presence of factors necessary for the growth and differentiation of cytotoxic T cells.
Les fragments protéiques polyépitopiques de l'invention sont davantage caractérisés en ce qu'ils sont susceptibles de contenir des épitopes CD4 reconnus par les cellules T auxiliaires en association avec les molécules du CMH de classe II, cette propriété favorisant l'induction et le maintien des cellules T CD8+ reconnaissant les épitopes compris dans lesdits fragments. The polyepitopic protein fragments of the invention are further characterized in that they are capable of containing CD4 epitopes recognized by helper T cells in association with MHC class II molecules, this property promoting the induction and maintenance of CD8 + T cells recognizing the epitopes included in said fragments.
L'invention a plus particulièrement pour objet les fragments polyépitopiques de la protéine E6 de HPV, choisis parmi ceux comprenant : - le fragment délimité par les acides aminés situés aux positions 15 et 44 de la séquence peptidique de la protéine E6, et caractérisé par la séquence peptidique suivante : (15)RPRKLPQLCTELQTTIHDIILECVYCKQQL(44) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A11, A29, B7, B8, B35, B44, ou B51, - le fragment délimité par les acides aminés situés aux positions 46 et 62, ou aux positions 46 et 67, ou aux positions 46 et 77 de la séquence peptidique de la protéine E6, ce dernier fragment étant caractérisé par la séquence peptidique suivante: (46)RREVYDFAFRDLCIVYRDGNPYAVCDKCLKFY(77) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A3, A11, A24, A29, B7, B27, B35, B44, ou B51, - le fragment délimité par les acides aminés situés aux positions 80 et 108 de la séquence peptidique de la protéine E6, et caractérisé par la séquence peptidique suivante : (80)ISEYRHYCYRLYGTTLEQQYNKPLCDLLI(108) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type Al, A3, A11, A24, A29, B7, B18, B35, B44, ou B51, - le fragment délimité par les acides aminés situés aux positions 118 et 139 de la séquence peptidique de la protéine E6, et caractérisé par la séquence peptidique suivante : (118)CPEEKQRHLDKKQRFHNIRGRW(139) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A24, B8, B18, B27, B35, B44, ou B51. The subject of the invention is more particularly the polyepitopic fragments of the protein E6 of HPV, chosen from those comprising: - the fragment delimited by the amino acids located at positions 15 and 44 of the peptide sequence of the protein E6, and characterized by following peptide sequence: (15) RPRKLPQLCTELQTTIHDIILECVYCKQQL (44) said fragment containing peptides stably binding to HLA molecules of type A2, A11, A29, B7, B8, B35, B44, or B51, - the fragment delimited by acids amines located at positions 46 and 62, or at positions 46 and 67, or at positions 46 and 77 of the peptide sequence of the E6 protein, the latter fragment being characterized by the following peptide sequence: (46) RREVYDFAFRDLCIVYRDGNPYAVCDKCLKFY (77) said fragment containing peptides which bind stably to HLA molecules of type A2, A3, A11, A24, A29, B7, B27, B35, B44, or B51, - the fragment delimited by amino acids located at the positions 80 and 108 of the peptide sequence of the E6 protein, and characterized by the following peptide sequence: (80) ISEYRHYCYRLYGTTLEQQYNKPLCDLLI (108) said fragment containing peptides which bind stably to HLA molecules of type A1, A3, A11, A24, A29, B7, B18, B35, B44, or B51, - the fragment delimited by the amino acids located at positions 118 and 139 of the peptide sequence of the E6 protein, and characterized by the following peptide sequence: (118) CPEEKQRHLDKKQRFHNIRGRW (139 ) said fragment containing peptides which bind stably to HLA molecules of type A24, B8, B18, B27, B35, B44, or B51.
<Desc/Clms Page number 5> <Desc / Clms Page number 5>
L'invention a également pour objet les fragments polyépitopiques de la protéine E7 de HPV, choisis parmi ceux comprenant : - le fragment délimité par les acides aminés situés aux positions 2 et 25 de la séquence peptidique de la protéine E7, et caractérisé par la séquence peptidique suivante : (2)GGDTPTLHEYMLDLQPETTDLYCY(25) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type Al, A2, B18, B35, B44, ou B62, - le fragment délimité par les acides aminés situés aux positions 44 et 60 de la séquence peptidique de la protéine E7, et caractérisé par la séquence peptidique suivante : (44)QAEPDRAHYNIVTFCCK(60) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type Al, A3, A11, A29, B7, B18, B35, B44, ou B51, - le fragment délimité par les acides aminés situés aux positions 79 et 97 de la séquence peptidique de la protéine E7, ce dernier fragment étant caractérisé par la séquence peptidique suivante: (79)LEDLLMGTLGIVCPICSQK(97) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A3, A11, A29, ou B44. The subject of the invention is also the polyepitopic fragments of the E7 protein of HPV, chosen from those comprising: - the fragment delimited by the amino acids located at positions 2 and 25 of the peptide sequence of the E7 protein, and characterized by the sequence following peptide: (2) GGDTPTLHEYMLDLQPETTDLYCY (25) said fragment containing peptides which bind stably to HLA molecules of Al, A2, B18, B35, B44, or B62 type, - the fragment delimited by amino acids located at positions 44 and 60 of the peptide sequence of the E7 protein, and characterized by the following peptide sequence: (44) QAEPDRAHYNIVTFCCK (60) said fragment containing peptides which bind stably to HLA molecules of type A1, A3, A11, A29, B7 , B18, B35, B44, or B51, - the fragment delimited by the amino acids located at positions 79 and 97 of the peptide sequence of the E7 protein, this last fragment being characterized by the peptide sequence following: (79) LEDLLMGTLGIVCPICSQK (97) said fragment containing peptides which bind stably to HLA molecules of type A2, A3, A11, A29, or B44.
L'invention concerne également les fragments polyépitopiques de la protéine p53 humaine, surexprimée dans de nombreux type de cancers, choisis parmi ceux comprenant : - le fragment délimité par les acides aminés situés aux positions 106 et 137, ou aux positions 102 et 137 de la séquence peptidique de la protéine p53, ce dernier fragment étant caractérisé par la séquence peptidique suivante: (1020TYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQL(137) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A24, ou B62, - le fragment délimité par les acides aminés situés aux positions 149 et 169 de la séquence peptidique de la protéine p53, et caractérisé par la séquence peptidique suivante : (149)STPPPGTRVRAMAIYKQSQHM(169) The invention also relates to the polyepitopic fragments of the human p53 protein, overexpressed in many types of cancer, chosen from those comprising: - the fragment delimited by the amino acids located at positions 106 and 137, or at positions 102 and 137 of the peptide sequence of the p53 protein, the latter fragment being characterized by the following peptide sequence: (1020TYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQL (137) said fragment containing peptides which bind stably to HLA molecules of type A2, A24, or B62, - the fragment delimited by the amino acids located at positions 149 and 169 of the peptide sequence of the p53 protein, and characterized by the following peptide sequence: (149) STPPPGTRVRAMAIYKQSQHM (169)
<Desc/Clms Page number 6><Desc / Clms Page number 6>
ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A3, A24, B27, B35, ou B62, - le fragment délimité par les acides aminés situés aux positions 187 et 212, ou aux positions 187 et 220 de la séquence peptidique de la protéine p53, ce dernier fragment étant caractérisé par la séquence peptidique suivante: (187)GLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPY(220) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A24, B27, ou B44, - le fragment délimité par les acides aminés situés aux positions 226 et 243 de la séquence peptidique de la protéine p53, et caractérisé par la séquence peptidique suivante : (226)GSDCTTIHYNYMCNSSCM(243) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type Al, A24, ou B44, - le fragment délimité par les acides aminés situés aux positions 249 et 273 de la séquence peptidique de la protéine p53, et caractérisé par la séquence peptidique suivante : (249)RPILTnTLEDSSGNLLGRNSFEVR(273) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, B27, B35, B44, ou B62. said fragment containing peptides which bind stably to HLA molecules of type A2, A3, A24, B27, B35, or B62, - the fragment delimited by the amino acids located at positions 187 and 212, or at positions 187 and 220 of the peptide sequence of the p53 protein, the latter fragment being characterized by the following peptide sequence: (187) GLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPY (220) said fragment containing peptides which bind stably to HLA molecules of type A2, A24, B27, or B44, the fragment delimited by the amino acids located at positions 226 and 243 of the peptide sequence of the p53 protein, and characterized by the following peptide sequence: (226) GSDCTTIHYNYMCNSSCM (243) said fragment containing peptides stably binding to molecules HLA type A1, A24, or B44, - the fragment delimited by the amino acids located at positions 249 and 273 of the peptide sequence of the p53 protein, and characterized by the sequenc e following peptide: (249) RPILTnTLEDSSGNLLGRNSFEVR (273) said fragment containing peptides which bind stably to HLA molecules of type A2, B27, B35, B44, or B62.
L'invention a également pour objet les fragments polyépitopiques de la protéine Nef de HIV, choisis parmi ceux comprenant : - le fragment délimité par les acides aminés situés aux positions 68 et 97 de la séquence peptidique de la protéine Nef, et étant caractérisé par la séquence peptidique suivante : (68)FPVTPQVPLRPMTYKAAVDLSHFLKEKGGL(97) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type A2, A3, A11, B7, B8, B14, B35, B62, ou Cw8, - le fragment délimité par les acides aminés situés aux positions 116 et 145, ou aux positions 105 et 145 de la séquence peptidique de la protéine Nef, et étant caractérisé par la séquence peptidique suivante: (105)RRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKL(145) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type Al, A2, A24, A32, B7, B18, B27, B35, B37, B49, B57/58, ou B62, The subject of the invention is also the polyepitopic fragments of the HIV Nef protein, chosen from those comprising: - the fragment delimited by the amino acids located at positions 68 and 97 of the peptide sequence of the Nef protein, and being characterized by following peptide sequence: (68) FPVTPQVPLRPMTYKAAVDLSHFLKEKGGL (97) said fragment containing peptides which bind stably to HLA molecules of type A2, A3, A11, B7, B8, B14, B35, B62, or Cw8, - the fragment delimited by the amino acids located at positions 116 and 145, or at positions 105 and 145 of the peptide sequence of the Nef protein, and being characterized by the following peptide sequence: (105) RRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKL (145) said fragment containing peptides which bind so stable to HLA molecules of type A1, A2, A24, A32, B7, B18, B27, B35, B37, B49, B57 / 58, or B62,
<Desc/Clms Page number 7><Desc / Clms Page number 7>
- le fragment délimité par les acides aminés situés aux positions 180 et 203 de la séquence peptidique de la protéine Nef, et étant caractérisé par la séquence peptidique suivante : (180)VLEWRFDSRLAFHHVARELHPEY(202) ledit fragment contenant des peptides se liant de façon stable aux molécules HLA de type Al, A2, A3, B8, B35, ou B52. the fragment delimited by the amino acids located at positions 180 and 203 of the peptide sequence of the Nef protein, and being characterized by the following peptide sequence: (180) VLEWRFDSRLAFHHVARELHPEY (202) said fragment containing peptides which bind stably to HLA molecules of type Al, A2, A3, B8, B35, or B52.
L'invention a également pour objet les séquences peptidiques dérivées des fragments polyépitopiques susmentionnés, notamment ; - par substitution, et/ou suppression, et/ou addition d'un ou plusieurs acides aminés, des fragments susmentionnés, et/ou - par modification d'au moins une liaison peptidique -CO-NH- de la chaîne peptidique des fragments susmentionnés, notamment par introduction d'une liaison du type rétro, ou rétro-inverso, et/ou - par substitution d'au moins un acide aminé de la chaîne peptidique de la séquence ou du fragment susmentionnés, par un acide aminé non protéinogénique, lesdites séquences dérivées contenant des peptides ou pseudopeptides se liant spécifiquement à la ou aux mêmes molécules du CMH que celles se liant aux peptides contenus dans les fragments polyépitopiques susmentionnés dont elles dérivent. The subject of the invention is also the peptide sequences derived from the above-mentioned polyepitopic fragments, in particular; - by substitution, and / or deletion, and / or addition of one or more amino acids, of the abovementioned fragments, and / or - by modification of at least one peptide bond -CO-NH- of the peptide chain of the abovementioned fragments , in particular by introducing a link of the retro type, or retro-inverso, and / or - by substitution of at least one amino acid of the peptide chain of the above-mentioned sequence or fragment, by a non-proteinogenic amino acid, said derived sequences containing peptides or pseudopeptides specifically binding to the same MHC molecule (s) as those binding to the peptides contained in the aforementioned polyepitopic fragments from which they are derived.
Par séquence dérivée par introduction d'une liaison rétro-inverso, il faut entendre tout analogue peptidique d'un fragment susmentionné, ledit analogue étant constitué d'une chaîne peptidique dans laquelle l'un au moins des résidus d'une part est lié à au moins un résidu voisin par une liaison-NH-CO-, et d'autre part, est de chiralité opposée à celle de ce même résidu aminoacyle dans la chaîne peptidique du peptide parent (à savoir du fragment susmentionné dont elle dérive). By sequence derived by the introduction of a retro-inverso bond, is meant any peptide analog of a aforementioned fragment, said analog consisting of a peptide chain in which at least one of the residues on the one hand is linked to at least one residue neighboring by a NH-CO- bond, and on the other hand, is of opposite chirality to that of this same aminoacyl residue in the peptide chain of the parent peptide (namely of the aforementioned fragment from which it derives).
Par séquence dérivée par introduction d'une liaison rétro, il faut entendre tout analogue peptidique d'un fragment susmentionné, ledit analogue étant constitué d'une chaîne peptidique dans laquelle l'un au moins des résidus, est lié à au moins un résidu voisin par une liaison-NH-CO-, la chiralité de la totalité des résidus aminoacyles impliqués dans au moins une liaison-NH-CO- étant conservée par rapport aux résidus correspondant de la chaîne peptidique du peptide parent. By sequence derived by the introduction of a retro bond, is meant any peptide analog of a aforementioned fragment, said analog consisting of a peptide chain in which at least one of the residues is linked to at least one neighboring residue by a NH-CO- bond, the chirality of all the aminoacyl residues involved in at least one NH-CO- bond being preserved with respect to the corresponding residues of the peptide chain of the parent peptide.
Il va de soi que les liaisons-CO-NH- et-NH-CO- doivent être prises en compte dans ce qui précède, dans le sens de la chaîne peptidique parente allant de l'extrémité aminoterminale (N-terminale) vers l'extrémité carboxyterminale (C-terminale). It goes without saying that the bonds -CO-NH- and -NH-CO- must be taken into account in the above, in the direction of the parent peptide chain going from the amino terminal end (N-terminal) towards the carboxyterminal end (C-terminal).
<Desc/Clms Page number 8> <Desc / Clms Page number 8>
Par "acide aminé protéinogénique", on entend, dans ce qui précède, tout acide aminé entrant dans la constitution d'une protéine ou d'un peptide naturel. By "proteinogenic amino acid" is meant, in the above, any amino acid used in the constitution of a natural protein or peptide.
Par "acide aminé non protéinogénique", on entend par opposition à la définition précédente, tout acide aminé n'entrant pas dans la constitution d'une protéine ou d'un peptide naturel. On entend plus particulièrement par "acide aminé non protéinogénique", tout acide aminé dont le carbone portant la chaîne latérale R, à savoir le groupe-CHR-, situé entre-CO- et-NH- dans la chaîne peptidique naturelle, est remplacé par un motif n'entrant pas dans la constitution d'une protéine ou d'un peptide naturel. By "non-proteinogenic amino acid" means, as opposed to the preceding definition, any amino acid not forming part of a natural protein or peptide. The term “non-proteinogenic amino acid” is understood more particularly to mean any amino acid whose carbon carrying the side chain R, namely the group — CHR-, located between-CO- and-NH- in the natural peptide chain, is replaced by a motif which does not form part of a natural protein or peptide.
L'invention a plus particulièrement pour objet les séquences dérivées telles que décrites ci-dessus, caractérisés en ce que l'une au moins des liaisons peptidiques-CO- NH- de la chaîne peptidique du peptide parent est remplacée par une liaison différente de la liaison-CO-NH-, ladite liaison différente étant notamment choisie parmi les suivantes : -CH2-NH- (méthylène amino) ; -CH2-CH2- (carba) ; -CO-CH2- (cétométhylène) ; -CH2-O- (méthylène-oxy) ; -CHOH-CH2- (hydroxyéthylène) ; -CHOH-CHOH- (di-hydroxyéthylène) ; -CH=CH- (E ou Z oléfine) ; -CHCN-NH- (cyanométhylène amino) ; -S-CH2- (thiométhylène) ; -CH2-S- (méthylène thio) ; -CS-NH- (thioamide) ; -P02-NH- (phosphonamide) ; -CHOH- (hydroxyméthylène) ; -NH-CO-NH- (urée) ; -CH-CH- (oxirane) ; # # A more particular subject of the invention is the derivative sequences as described above, characterized in that at least one of the peptide-CO-NH- bonds of the peptide chain of the parent peptide is replaced by a bond different from the bond-CO-NH-, said different bond being chosen in particular from the following: -CH2-NH- (methylene amino); -CH2-CH2- (carba); -CO-CH2- (ketomethylene); -CH2-O- (methylene-oxy); -CHOH-CH2- (hydroxyethylene); -CHOH-CHOH- (di-hydroxyethylene); -CH = CH- (E or Z olefin); -CHCN-NH- (cyanomethylene amino); -S-CH2- (thiomethylene); -CH2-S- (methylene thio); -CS-NH- (thioamide); -PO2-NH- (phosphonamide); -CHOH- (hydroxymethylene); -NH-CO-NH- (urea); -CH-CH- (oxirane); # #
<Desc/Clms Page number 9><Desc / Clms Page number 9>
-C#N- (tétrazole) ;
1/ \ N N -CH2-CO-NH- (p-homologation) ; -CHOH-CH2-NH- (hydroxyéthylène amino) ; -CO-NH-NH- (hydrazino). -C # N- (tetrazole);
1 / \ NN -CH2-CO-NH- (p-approval); -CHOH-CH2-NH- (hydroxyethylene amino); -CO-NH-NH- (hydrazino).
L'invention concerne également les séquences nucléotidiques codant pour les fragments protéiques polyépitopiques ou pour les séquences peptidiques dérivées susmentionnés. The invention also relates to the nucleotide sequences coding for the polyepitopic protein fragments or for the abovementioned derived peptide sequences.
L'invention a également pour objet tout vecteur, notamment plasmide, cosmide ou phage, contenant au moins une séquence nucléotidique susmentionnée placée sous le contrôle des éléments nécessaires à la transcription de ladite séquence, notamment sous le contrôle d'un promoteur et d'un terminateur de transcription. The subject of the invention is also any vector, in particular plasmid, cosmid or phage, containing at least one aforementioned nucleotide sequence placed under the control of the elements necessary for the transcription of said sequence, in particular under the control of a promoter and of a transcription terminator.
L'invention concerne également les cellules hôtes, notamment bactéries, virus, levures, cellules eucaryotes, transformées à l'aide d'un vecteur susmentionné selon l'invention, de manière à intégrer de façon stable dans leur génome ou à maintenir de manière stable dans leur cytoplasme, au moins une séquence nucléotidique selon l' invention. The invention also relates to host cells, in particular bacteria, viruses, yeasts, eukaryotic cells, transformed using a vector mentioned above according to the invention, so as to integrate stably into their genome or to maintain stably in their cytoplasm, at least one nucleotide sequence according to the invention.
L' invention concerne également tout vecteur comprenant un ou plusieurs fragments polypépitopiques et/ou une ou plusieurs séquences peptidiques dérivées tels que définis ci-dessus, ou tout vecteur comprenant une ou plusieurs séquences nucléotidiques susmentionnées, lesdits vecteurs étant choisis parmi ceux capables d'assurer une protection desdits fragments ou séquences nucléotidiques dans l'organisme et/ou leur pénétration dans les cellules de l'organisme. The invention also relates to any vector comprising one or more polypepitopic fragments and / or one or more peptide sequences derived as defined above, or any vector comprising one or more nucleotide sequences mentioned above, said vectors being chosen from those capable of ensuring protection of said fragments or nucleotide sequences in the organism and / or their penetration into the cells of the organism.
Dans le cas de l'utilisation de fragments polyépitopiques et/ou de séquences peptidiques dérivées susmentionnés, de tels vecteurs sont choisis parmi les acides gras (dans le cadre de la préparation de lipopeptides), les liposomes etc. In the case of the use of polyepitopic fragments and / or of peptide sequences derived from the abovementioned, such vectors are chosen from fatty acids (in the context of the preparation of lipopeptides), liposomes etc.
A ce titre, l'invention a plus particulièrement pour objet tout lipopeptide caractérisé en ce qu'il comprend : As such, the invention more particularly relates to any lipopeptide characterized in that it comprises:
<Desc/Clms Page number 10><Desc / Clms Page number 10>
- une partie peptidique comprenant un ou plusieurs fragments protéiques polyépitopiques choisis parmi ceux définis ci-dessus, ou toute séquence peptidique dérivée desdits fragments telle que définie ci-dessus, - et une ou plusieurs parties lipophiles, avantageusement choisies parmi celles comprenant : * une chaîne hydrocarbonée en C4 à C20, saturée ou insaturée, linéaire ou ramifiée, * ou un groupe stéroïde, le cas échéant lié à la chaîne hydrocarbonée susmentionnée, lesdites parties lipophiles étant éventuellement associées à un court peptide vecteur (pour former ainsi des motifs lipopeptidiques vecteurs) comportant une ou plusieurs fonctions ionisées à pH physiologique, et une fonction permettant la fixation covalente de ladite chaîne hydrocarbonée et/ou dudit groupe stéroïde. - a peptide part comprising one or more polyepitopic protein fragments chosen from those defined above, or any peptide sequence derived from said fragments as defined above, - and one or more lipophilic parts, advantageously chosen from those comprising: * a chain C4 to C20 hydrocarbon, saturated or unsaturated, linear or branched, * or a steroid group, optionally linked to the aforementioned hydrocarbon chain, said lipophilic parts being optionally associated with a short vector peptide (to thus form vector lipopeptide units) comprising one or more ionized functions at physiological pH, and a function allowing the covalent fixing of said hydrocarbon chain and / or of said steroid group.
Par partie lipophile, dans ce qui précède et ce qui suit, on entend toute molécule lipophile, insoluble dans l'eau, permettant, lorsqu'elle est liée à la partie peptidique définie ci-dessus, un passage intracellulaire passif du lipopeptide obtenu, grâce aux propriétés hydrophobes de ladite molécule. Avantageusement le lipopeptide résultant de la liaison de la partie lipophile à la partie peptidique, est soluble dans l'eau. By lipophilic part, in what precedes and what follows, one understands any lipophilic molecule, insoluble in water, allowing, when it is linked to the peptide part defined above, a passive intracellular passage of the lipopeptide obtained, thanks hydrophobic properties of said molecule. Advantageously, the lipopeptide resulting from the binding of the lipophilic part to the peptide part, is soluble in water.
De préférence, la chaîne hydrocarbonée des parties lipophiles, est choisie parmi celles de : - l'acide palmitique, - l'acide oléique, - l'acide linoléique, - l'acide linolénique. Preferably, the hydrocarbon chain of the lipophilic parts is chosen from those of: - palmitic acid, - oleic acid, - linoleic acid, - linolenic acid.
De préférence également, le groupe stéroïde de la ou des parties lipophiles, est choisi parmi les dérivés du cholestérol tel que l'acide cholest-5-ényl-3-oxy acétique, ou l'acide cholest-5-ényl-3-oxycarbonique. Preferably also, the steroid group of the lipophilic part or parts is chosen from cholesterol derivatives such as cholest-5-enyl-3-oxy acetic acid, or cholest-5-enyl-3-oxycarbonic acid .
L'invention a plus particulièrement pour objet tout lipopeptide tel que décrit cidessus, caractérisé en ce que la ou les parties lipophiles sont liées de façon covalente à un ou plusieurs acides aminés de la partie peptidique. The invention more particularly relates to any lipopeptide as described above, characterized in that the lipophilic part or parts are covalently linked to one or more amino acids of the peptide part.
Avantageusement, la ou les parties lipophiles sont liées de façon covalente à la fonction [alpha]NH2 ou #NH2 d'une lysine située en position N-terminale ou C-terminale de Advantageously, the lipophilic part or parts are covalently linked to the [alpha] NH2 or # NH2 function of a lysine located in the N-terminal or C-terminal position of
<Desc/Clms Page number 11><Desc / Clms Page number 11>
la partie peptidique, ou à la fonction thiol d'une cystéine, ou à toute fonction amino, alcool ou thiol éventuellement ajoutée au peptide avec un espaceur simple. the peptide part, or with the thiol function of a cysteine, or with any amino, alcohol or thiol function possibly added to the peptide with a simple spacer.
A ce titre, l'invention a plus particulièrement pour objet tout lipopeptide tel que défini ci-dessus, dans lequel la ou les parties lipophiles sont représentées par un groupe Na-acétyl-Lysine NE(palmitoyl) (encore désigné par l'abréviation Ac-K(Pam)). As such, the invention more particularly relates to any lipopeptide as defined above, in which the lipophilic part or parts are represented by a group Na-acetyl-Lysine NE (palmitoyl) (also designated by the abbreviation Ac -K (Pam)).
La présente invention a également pour objet, des micelles ou micro-agrégats d'un ou plusieurs lipopeptides différents définis ci-dessus. The present invention also relates to micelles or micro-aggregates of one or more different lipopeptides defined above.
Avantageusement, lesdits micelles ou micro-agrégats ont une taille inférieure à environ 1 m. Advantageously, said micelles or micro-aggregates have a size less than about 1 m.
De préférence, les micelles ou micro-agrégats selon l'invention, sont tels qu'obtenus par dispersion desdits lipopeptides dans une solution d'acide acétique concentrée à environ 80%, ou tout autre solvant capable d'assurer une dispersion moléculaire des lipopeptides en solution. Preferably, the micelles or micro-aggregates according to the invention are as obtained by dispersing said lipopeptides in a solution of acetic acid concentrated to about 80%, or any other solvent capable of ensuring molecular dispersion of the lipopeptides in solution.
Dans le cas de l'utilisation de séquences nucléotidiques définies ci-dessus selon l'invention, les vecteurs susmentionnés sont choisis parmi les virus, notamment les rétrovirus, les adénovirus et les virus associés (AAV Adeno Associated Virus). In the case of the use of nucleotide sequences defined above according to the invention, the above-mentioned vectors are chosen from viruses, in particular retroviruses, adenoviruses and associated viruses (AAV Adeno Associated Virus).
L'invention a également pour objet l'utilisation : - d'au moins un fragment polyépitopique de la protéine E6 d'HPV, et/ou d'au moins un fragment polyépitopique de la protéine E7 d'HPV, tels que définis ci-dessus, - et/ou d'au moins une séquence peptidique dérivée de ces fragments, telle que définie ci-dessus, - ou d'au moins une séquence nucléotidique, telle que définie ci-dessus, codant pour un fragment polyépitopique de la protéine E6 d'HPV, et/ou pour un fragment polyépitopique de la protéine E7 d'HPV, et/ou pour une séquence peptidique dérivée de ces fragments, tels que définis ci-dessus, pour la préparation d'un médicament ou vaccin destiné à la prévention ou au traitement de pathologies liées à l'infection d'individus par les papillomavirus humains, lesdites pathologies étant notamment les suivantes : les néoplasies cervicales intraépithéliales (CIN), le cancer invasif du col de l'utérus, les néoplasies vulvaires intraépithéliales (VIN). A subject of the invention is also the use: of at least one polyepitopic fragment of the protein E6 of HPV, and / or of at least one polyepitopic fragment of the protein E7 of HPV, as defined above. above, - and / or at least one peptide sequence derived from these fragments, as defined above, - or at least one nucleotide sequence, as defined above, coding for a polyepitopic fragment of the protein HPV E6, and / or for a polyepitopic fragment of the HPV E7 protein, and / or for a peptide sequence derived from these fragments, as defined above, for the preparation of a medicament or vaccine intended for prevention or treatment of pathologies linked to the infection of individuals by human papillomaviruses, said pathologies being in particular the following: cervical intraepithelial neoplasia (CIN), invasive cervical cancer, vulvar intraepithelial neoplasia ( WINE).
A ce titre, l'invention concerne également les compositions pharmaceutiques, ou les vaccins, caractérisés en ce qu'ils comprennent : As such, the invention also relates to pharmaceutical compositions, or vaccines, characterized in that they comprise:
<Desc/Clms Page number 12><Desc / Clms Page number 12>
- au moins un fragment polyépitopique de la protéine E6 d'HPV, et/ou au moins un fragment polyépitopique de la protéine E7 d'HPV, tels que définis ci-dessus, - et/ou au moins une séquence peptidique dérivée de ces fragments, telle que définie ci-dessus, - et/ou au moins un vecteur approprié susmentionné, notamment des lipopeptides et/ou micelles définis ci-dessus, contenant au moins un fragment polyépitopique susmentionné de la protéine E6 ou E7 d'HPV, et/ou au moins une séquence dérivée susmentionnée de ces fragments, en association avec un véhicule physiologiquement acceptable, ledit fragment protéique polyépitopique et/ou sa séquence dérivée étant le cas échéant associés à un ou plusieurs autres épitopes exogènes reconnus par des cellules T auxiliaires (encore désignés épitopes CD4 ou T helper), lesdits épitopes étant choisis notamment parmi les suivants : - le fragment peptidique délimité par les acides aminés situés aux positions 830 et 846 de la séquence peptidique de la toxine tétanique, ledit fragment répondant à la formule suivante : QYIKANSKFIGITELKK, - l'hémagglutinine (Prevost-Blondel et al., 1995, J. Virol., 62, n 12, pp 8046- 8055), - l'épitope PADRE (Alexander et al., 1994, Immunity, 1, 751). - at least one polyepitopic fragment of the E6 protein of HPV, and / or at least one polyepitopic fragment of the protein E7 of HPV, as defined above, - and / or at least one peptide sequence derived from these fragments , as defined above, - and / or at least one suitable vector mentioned above, in particular lipopeptides and / or micelles defined above, containing at least one polyepitopic fragment mentioned above of the protein E6 or E7 of HPV, and / or at least one aforementioned derivative sequence of these fragments, in association with a physiologically acceptable vehicle, said polyepitopic protein fragment and / or its derived sequence being optionally associated with one or more other exogenous epitopes recognized by helper T cells (still designated CD4 or T helper epitopes), said epitopes being chosen in particular from the following: - the peptide fragment delimited by the amino acids located at positions 830 and 846 of the tetanus toxin peptide sequence, said fragment corresponding to the following formula: QYIKANSKFIGITELKK, - hemagglutinin (Prevost-Blondel et al., 1995, J. Virol., 62, n 12, pp 8046- 8055), - the PADRE epitope (Alexander et al., 1994, Immunity, 1, 751).
L'invention concerne également les compositions pharmaceutiques, ou les vaccins, caractérisés en ce qu'ils comprennent : - au moins une séquence nucléotidique codant pour un fragment polyépitopique de la protéine E6 d'HPV, et/ou pour un fragment polyépitopique de la protéine E7 d'HPV, telle que définie ci-dessus, - et/ou au moins une séquence nucléotidique codant pour une séquence peptidique dérivée de ces fragments, telle que définie ci-dessus, - et/ou au moins un vecteur approprié susmentionné, choisi notamment parmi les virus définis ci-dessus, contenant au moins une séquence nucléotidique susmentionnée, en association avec un véhicule physiologiquement acceptable. The invention also relates to the pharmaceutical compositions, or the vaccines, characterized in that they comprise: - at least one nucleotide sequence coding for a polyepitopic fragment of the E6 protein of HPV, and / or for a polyepitopic fragment of the protein HPV E7, as defined above, - and / or at least one nucleotide sequence coding for a peptide sequence derived from these fragments, as defined above, - and / or at least one suitable vector mentioned above, chosen in particular among the viruses defined above, containing at least one abovementioned nucleotide sequence, in association with a physiologically acceptable vehicle.
Avantageusement les compositions pharmaceutiques, ou vaccins, susmentionnés, se présentent sous une forme administrable par voie sous-cutanée, notamment à raison de plusieurs injections (avantageusement 3 injections) d'environ 500 g du fragment polyépitopique sous forme lipopeptidique, à environ un mois d'intervalle. Advantageously, the pharmaceutical compositions, or vaccines, mentioned above, are in a form which can be administered subcutaneously, in particular at the rate of several injections (advantageously 3 injections) of approximately 500 g of the polyepitopic fragment in lipopeptide form, approximately one month after 'interval.
L'invention a également pour objet l'utilisation : The invention also relates to the use:
<Desc/Clms Page number 13><Desc / Clms Page number 13>
- d'au moins un fragment polyépitopique de la protéine p53, choisi parmi ceux définis ci-dessus, - et/ou d'au moins une séquence peptidique dérivée de ce fragment, telle que définie ci-dessus, - ou d'au moins une séquence nucléotidique, telle que définie ci-dessus, codant pour un fragment polyépitopique de la protéine p53, et/ou pour une séquence peptidique dérivée de ce fragment, tels que définis ci-dessus, pour la préparation d'un médicament ou vaccin destiné à la prévention ou au traitement des cancers, notamment les cancers du sein, du colon, du poumon, ou de la vessie. - at least one polyepitopic fragment of the p53 protein, chosen from those defined above, - and / or at least one peptide sequence derived from this fragment, as defined above, - or at least a nucleotide sequence, as defined above, coding for a polyepitopic fragment of the p53 protein, and / or for a peptide sequence derived from this fragment, as defined above, for the preparation of a medicament or vaccine intended prevention or treatment of cancers, in particular breast, colon, lung and bladder cancers.
A ce titre, l'invention concerne également les compositions pharmaceutiques, ou les vaccins, caractérisés en ce qu'ils comprennent : - au moins un fragment polyépitopique de la protéine p53, tel que défini ci-dessus, - et/ou au moins une séquence peptidique dérivée de ce fragment, telle que définie ci-dessus, - et/ou au moins un vecteur approprié, notamment des lipopeptides et/ou micelles définis ci-dessus, contenant au moins un fragment polyépitopique susmentionné de la protéine p53, et/ou au moins une séquence dérivée susmentionnée de ce fragment, en association avec un véhicule physiologiquement acceptable, ledit fragment protéique polyépitopique et/ou sa séquence dérivée étant le cas échéant associés à un ou plusieurs autres épitopes exogènes reconnus par des cellules T auxiliaires choisis notamment parmi ceux décrits ci-dessus. As such, the invention also relates to pharmaceutical compositions, or vaccines, characterized in that they comprise: - at least one polyepitopic fragment of the p53 protein, as defined above, - and / or at least one peptide sequence derived from this fragment, as defined above, - and / or at least one suitable vector, in particular lipopeptides and / or micelles defined above, containing at least one polyepitopic fragment mentioned above of the protein p53, and / or at least one aforementioned derivative sequence of this fragment, in association with a physiologically acceptable vehicle, said polyepitopic protein fragment and / or its derived sequence being if necessary associated with one or more other exogenous epitopes recognized by T helper cells chosen in particular from those described above.
L'invention concerne également les compositions pharmaceutiques, ou les vaccins, caractérisés en ce qu'ils comprennent : - au moins une séquence nucléotidique codant pour un fragment polyépitopique de la protéine p53, telle que définie ci-dessus, - et/ou au moins une séquence nucléotidique codant pour une séquence peptidique dérivée de ces fragments, telle que définie ci-dessus, - et/ou au moins un vecteur approprié susmentionné, choisi notamment parmi les virus définis ci-dessus, contenant au moins une séquence nucléotidique susmentionnée, en association avec un véhicule physiologiquement acceptable. The invention also relates to pharmaceutical compositions, or vaccines, characterized in that they comprise: - at least one nucleotide sequence coding for a polyepitopic fragment of the p53 protein, as defined above, - and / or at least a nucleotide sequence coding for a peptide sequence derived from these fragments, as defined above, - and / or at least one suitable vector mentioned above, chosen in particular from the viruses defined above, containing at least one nucleotide sequence mentioned above, association with a physiologically acceptable vehicle.
Avantageusement les compositions pharmaceutiques, ou vaccins, susmentionnés, se présentent sous une forme administrable par voie sous-cutanée ou intra-musculaire, notamment à raison de plusieurs injections (avantageusement 3 injections) d'environ Advantageously, the pharmaceutical compositions, or vaccines, mentioned above, are in a form which can be administered by the subcutaneous or intramuscular route, in particular at the rate of several injections (advantageously 3 injections) of approximately
<Desc/Clms Page number 14><Desc / Clms Page number 14>
500 g du fragment polyépitopique sous forme lipopeptidique, à environ un mois d'intervalle. 500 g of the polyepitopic fragment in lipopeptide form, approximately one month apart.
L'invention a également pour objet l'utilisation : - d'au moins un fragment polyépitopique de la protéine Nef de HIV, choisi parmi ceux définis ci-dessus, le cas échéant en association avec un ou plusieurs fragments polyépitopiques d'autres protéines, que la protéine Nef, du virus HIV, notamment d'un ou plusieurs fragments polyépitopiques de la protéine GAG et/ou POL et/ou ENV et/ou RT, - et/ou d'au moins une séquence peptidique dérivée de ce fragment, telle que définie ci-dessus, le cas échéant en association avec un ou plusieurs fragments polyépitopiques d'autres protéines susmentionnées, - ou d'au moins une séquence nucléotidique, telle que définie ci-dessus, codant pour un fragment polyépitopique de la protéine Nef de HIV, et/ou pour une séquence peptidique dérivée de ce fragment, tels que définis ci-dessus, pour la préparation d'un médicament ou vaccin destiné à la prévention ou au traitement du SIDA. The subject of the invention is also the use: of at least one polyepitopic fragment of the HIV Nef protein, chosen from those defined above, where appropriate in combination with one or more polyepitopic fragments of other proteins, that the protein Nef, of the HIV virus, in particular of one or more polyepitopic fragments of the protein GAG and / or POL and / or ENV and / or RT, - and / or at least one peptide sequence derived from this fragment, as defined above, where appropriate in combination with one or more polyepitopic fragments of other above-mentioned proteins, - or at least one nucleotide sequence, as defined above, coding for a polyepitopic fragment of the protein Nef of HIV, and / or for a peptide sequence derived from this fragment, as defined above, for the preparation of a medicament or vaccine intended for the prevention or treatment of AIDS.
A ce titre, l'invention concerne également les compositions pharmaceutiques, ou les vaccins, caractérisés en ce qu'ils comprennent : - au moins un fragment polyépitopique de la protéine Nef, tel que défini ci-dessus, - et/ou au moins une séquence peptidique dérivée de ce fragment, telle que définie ci-dessus, - et/ou au moins un vecteur approprié, notamment des lipopeptides et/ou micelles définis ci-dessus, contenant au moins un fragment polyépitopique susmentionné de la protéine Nef, et/ou au moins une séquence dérivée susmentionnée de ce fragment, en association avec un véhicule physiologiquement acceptable, ledit fragment protéique polyépitopique et/ou sa séquence dérivée étant le cas échéant associés à un ou plusieurs autres épitopes exogènes reconnus par des cellules T auxiliaires choisis notamment parmi ceux décrits ci-dessus. As such, the invention also relates to pharmaceutical compositions, or vaccines, characterized in that they comprise: - at least one polyepitopic fragment of the protein Nef, as defined above, - and / or at least one peptide sequence derived from this fragment, as defined above, - and / or at least one suitable vector, in particular lipopeptides and / or micelles defined above, containing at least one polyepitopic fragment mentioned above of the protein Nef, and / or at least one aforementioned derivative sequence of this fragment, in association with a physiologically acceptable vehicle, said polyepitopic protein fragment and / or its derived sequence being if necessary associated with one or more other exogenous epitopes recognized by T helper cells chosen in particular from those described above.
L'invention concerne également les compositions pharmaceutiques, ou les vaccins, caractérisés en ce qu'ils comprennent : - au moins une séquence nucléotidique codant pour un fragment polyépitopique de la protéine Nef, telle que définie ci-dessus, - et/ou au moins une séquence nucléotidique codant pour une séquence peptidique dérivée de ces fragments, telle que définie ci-dessus, The invention also relates to pharmaceutical compositions, or vaccines, characterized in that they comprise: - at least one nucleotide sequence coding for a polyepitopic fragment of the Nef protein, as defined above, - and / or at least a nucleotide sequence coding for a peptide sequence derived from these fragments, as defined above,
<Desc/Clms Page number 15><Desc / Clms Page number 15>
- et/ou au moins un vecteur approprié susmentionné, choisi notamment parmi les virus définis ci-dessus, contenant au moins une séquence nucléotidique susmentionnée, en association avec un véhicule physiologiquement acceptable. - And / or at least one suitable vector mentioned above, chosen in particular from the viruses defined above, containing at least one nucleotide sequence mentioned above, in association with a physiologically acceptable vehicle.
Avantageusement, les compositions pharmaceutiques, ou vaccins, susmentionnés, se présentent sous une forme administrable par voie sous-cutanée ou intra-musculaire, notamment à raison de plusieurs injections (avantageusement 3 injections) d'environ
500 g du fragment polyépitopique sous forme lipopeptidique, à environ un mois d'intervalle. Advantageously, the pharmaceutical compositions, or vaccines, mentioned above, are in a form which can be administered subcutaneously or intramuscularly, in particular at the rate of several injections (advantageously 3 injections) of approximately
500 g of the polyepitopic fragment in lipopeptide form, approximately one month apart.
L'invention a également pour objet les peptides de la protéine E6 d'HPV choisis parmi les suivants : - (19)LPQLCTEL(26) se liant de façon stable aux molécules HLA de type B51, - (21)QLCTELQTTI(30) se liant de façon stable aux molécules HLA de type A2, - (24) TELQTTIHDI(33) se liant de façon stable aux molécules HLA de type A29 et B44, - (33) IILECVYCK(41) se liant de façon stable aux molécules HLA de type A11, - (35)LECVYCKQQL(44) se liant de façon stable aux molécules HLA de type A29 et B44, - (37) CVYCKQQL(44) se liant de façon stable aux molécules HLA de type B8, - (46)RREVYDFAFR(55) se liant de façon stable aux molécules HLA de type B27, - (49) VYDFAFRDL(57) se liant de façon stable aux molécules HLA de type A24, - (50) YDFAFRDL(57) se liant de façon stable aux molécules HLA de type A29, B44, - (52)FAFRDLCIV(60) se liant de façon stable aux molécules HLA de type A2, B35, B51, - (54)FRDLCIVYR(62) se liant de façon stable aux molécules HLA de type A3, A11, - (59) IVYRDGNPY(67) se liant de façon stable aux molécules HLA de type A3, A11, - (81)SEYRHYCY(88) se liant de façon stable aux molécules HLA de type A29, B44, - (87)CYRLYGTTL(95) se liant de façon stable aux molécules HLA de type A24, - (94)TLEQQYNK(lOI) se liant de façon stable aux molécules HLA de type A3, A11, - (95)LEQQYNKPL(103) se liant de façon stable aux molécules HLA de type A29, B44, - (101)KPLCDLLI(108) se liant de façon stable aux molécules HLA de type B7, B35, B51, - (118)CPEEKQRHL(126) se liant de façon stable aux molécules HLA de type B8, B18, B35, B51, - (119)PEEKQRHL(126) se liant de façon stable aux molécules HLA de type B44, - (127)DKKQRFHNI(135) se liant de façon stable aux molécules HLA de type B8, - (128)KKQRFHNIR(136) se liant de façon stable aux molécules HLA de type B27, - (130)QRFHNIRGRW(139) se liant de façon stable aux molécules HLA de type B27, - (131)RFHNIRGRW(139) se liant de façon stable aux molécules HLA de type A24. The subject of the invention is also the peptides of the HPV E6 protein chosen from the following: - (19) LPQLCTEL (26) which bind stably to HLA molecules of type B51, - (21) QLCTELQTTI (30) stably binding to HLA molecules of type A2, - (24) TELQTTIHDI (33) binding stably to HLA molecules of type A29 and B44, - (33) IILECVYCK (41) binding stably to HLA molecules of type A11, - (35) LECVYCKQQL (44) binding stably to HLA molecules of type A29 and B44, - (37) CVYCKQQL (44) binding stably to HLA molecules of type B8, - (46) RREVYDFAFR (55) binds stably to HLA molecules of type B27, - (49) VYDFAFRDL (57) binds stably to molecules HLA of type A24, - (50) YDFAFRDL (57) binds stably to molecules HLA type A29, B44, - (52) FAFRDLCIV (60) binds stably to HLA molecules type A2, B35, B51, - (54) FRDLCIVYR (62) binds stably to HLA molecules type A3 , A11, - ( 59) IVYRDGNPY (67) binding stably to HLA molecules of type A3, A11, - (81) SEYRHYCY (88) binding stably to HLA molecules of type A29, B44, - (87) CYRLYGTTL (95) binds stably to HLA molecules of type A24, - (94) TLEQQYNK (lOI) binds stably to HLA molecules of type A3, A11, - (95) LEQQYNKPL (103) binds stably to HLA molecules type A29, B44, - (101) KPLCDLLI (108) binding stably to HLA molecules type B7, B35, B51, - (118) CPEEKQRHL (126) binding stably to HLA molecules type B8, B18, B35, B51, - (119) PEEKQRHL (126) binds stably to HLA molecules of type B44, - (127) DKKQRFHNI (135) binds stably to HLA molecules of type B8, - (128) KKQRFHNIR (136) binding stably to HLA molecules of type B27, - (130) QRFHNIRGRW (139) binding stably of molecules HLA of type B27, - (131) RFHNIRGRW (139) binding stably to HLA type A24 molecules.
<Desc/Clms Page number 16> <Desc / Clms Page number 16>
L'invention concerne également les peptides de la protéine E7 d'HPV choisis parmi les suivants : - (2)GGDTPTLHEY(11) se liant de façon stable aux molécules HLA de type Al, - (3)GDTPTLHEY(11) se liant de façon stable aux molécules HLA de type B44, - (5)TPTLHEYML(13) se liant de façon stable aux molécules HLA de type B35, - (15)LQPETTDLY(23) se liant de façon stable aux molécules HLA de type B62, - (16)QPETTDLYCY(25) se liant de façon stable aux molécules HLA de type Al, B18, - (45) AEPDRAHY(52) se liant de façon stable aux molécules HLA de type A29, B44, - (53)NIVTFCCK(60) se liant de façon stable aux molécules HLA de type A3, A11, - (79)LEDLLMGTL(87) se liant de façon stable aux molécules HLA de type A29, B44, - (89)IVCPICSQK(97) se liant de façon stable aux molécules HLA de type A3, Al 1. The invention also relates to the peptides of the E7 protein of HPV chosen from the following: - (2) GGDTPTLHEY (11) binding in a stable manner to HLA molecules of Al type, - (3) GDTPTLHEY (11) binding of Stably to HLA molecules of type B44, - (5) TPTLHEYML (13) binding stably to HLA molecules of type B35, - (15) LQPETTDLY (23) binding stably to HLA molecules of type B62, - (16) QPETTDLYCY (25) binding stably to HLA molecules of type A1, B18, - (45) AEPDRAHY (52) binding stably to HLA molecules of type A29, B44, - (53) NIVTFCCK (60 ) binding stably to HLA molecules of type A3, A11, - (79) LEDLLMGTL (87) binding stably to HLA molecules of type A29, B44, - (89) IVCPICSQK (97) binding stably to HLA molecules of type A3, Al 1.
L'invention a également pour objet les peptides de la protéine p53 choisis parmi les suivants : - (102)TYQGSYGFRL(111) se liant de façon stable aux molécules HLA de type A24, - (106)SYGFRLGFL(l 14) se liant de façon stable aux molécules HLA de type A24, - (118)TAKSVTCTY(126) se liant de façon stable aux molécules HLA de type B62, - (125)TYSPALNKMF(134) se liant de façon stable aux molécules HLA de type A24, - (152)PPGTRVRAM(160) se liant de façon stable aux molécules HLA de type B35, - (155)TRVRAMAIYK(164) se liant de façon stable aux molécules HLA de type B27, - (1 56)RVRAMAIY(l 63) se liant de façon stable aux molécules HLA de type B62, - (162)IYKQSQHM(169) se liant de façon stable aux molécules HLA de type A24, - (197)VEGNLRVEY(205) se liant de façon stable aux molécules HLA de type B44, - (201)LRVEYLDDR(209) se liant de façon stable aux molécules HLA de type B27, - (203)VEYLDDRNTF(212) se liant de façon stable aux molécules HLA de type B44, - (204) EYLDDRNTF(212) se liant de façon stable aux molécules HLA de type A24, - (211)TFRHSVVV(218) se liant de façon stable aux molécules HLA de type A24, - (212)FRHSVVVPY(220) se liant de façon stable aux molécules HLA de type B27, - (226) GSDCTTIHY(234) se liant de façon stable aux molécules HLA de type Al, - (227) SDCTTIHYNY(236) se liant de façon stable aux molécules HLA de type B44, - (235) NYMCNSSCM(243) se liant de façon stable aux molécules HLA de type A24, - (249) RPILTIITL(257) se liant de façon stable aux molécules HLA de type B35, - (257)LEDSSGNLL(265) se liant de façon stable aux molécules HLA de type B44, - (263)NLLGRNSF(270) se liant de façon stable aux molécules HLA de type B62, - (266)GRNSFEVR(273) se liant de façon stable aux molécules HLA de type B27. A subject of the invention is also the peptides of the p53 protein chosen from the following: - (102) TYQGSYGFRL (111) which binds stably to HLA molecules of type A24, - (106) SYGFRLGFL (l 14) which binds stably to HLA molecules of type A24, - (118) TAKSVTCTY (126) binding stably to HLA molecules of type B62, - (125) TYSPALNKMF (134) binding stably to HLA molecules of type A24, - (152) PPGTRVRAM (160) binds stably to HLA molecules of type B35, - (155) TRVRAMAIYK (164) binds stably to HLA molecules of type B27, - (1 56) RVRAMAIY (l 63) se stably binding to HLA type B62 molecules, - (162) IYKQSQHM (169) binding stably to HLA type A24 molecules, - (197) VEGNLRVEY (205) stably binding to HLA type B44 molecules , - (201) LRVEYLDDR (209) binding stably to HLA molecules of type B27, - (203) VEYLDDRNTF (212) binding stably to HLA molecules of type B44, - (204) EYLDDRNTF (212) binds stably to HLA molecules of type A24, - (211) TFRHSVVV (218) binds stably to molecules HLA of type A24, - (212) FRHSVVVPY (220) binds stably to molecules HLA type B27, - (226) GSDCTTIHY (234) binding stably to HLA molecules type A1, - (227) SDCTTIHYNY (236) binding stably to HLA molecules type B44, - (235) NYMCNSSCM (243) binds stably to HLA molecules of type A24, - (249) RPILTIITL (257) binds stably to HLA molecules of type B35, - (257) LEDSSGNLL (265) binds stably to molecules HLA type B44, - (263) NLLGRNSF (270) binding stably to HLA molecules type B62, - (266) GRNSFEVR (273) binding stably to HLA molecules type B27.
<Desc/Clms Page number 17> <Desc / Clms Page number 17>
L'invention concerne également les peptides de la protéine Nef d'HIV choisis parmi les suivants : - (71) TPQVPLRPM(79) se liant de façon stable aux molécules HLA de type B35, - (86) DLSHFLKEK(94) se liant de façon stable aux molécules HLA de type A3, - (90)FLKEKGGL(97) se liant de façon stable aux molécules HLA de type A2, B8, - (133)VRYPLTFGW(141) se liant de façon stable aux molécules HLA de type A32, B27, - (188)RLAFHHVAR(196) se liant de façon stable aux molécules HLA de type A3. The invention also relates to the peptides of the HIV Nef protein chosen from the following: - (71) TPQVPLRPM (79) binding stably to HLA molecules of type B35, - (86) DLSHFLKEK (94) binding of Stably to HLA molecules of type A3, - (90) FLKEKGGL (97) binding stably to HLA molecules of type A2, B8, - (133) VRYPLTFGW (141) binding stably of HLA molecules of type A32 , B27, - (188) RLAFHHVAR (196) binding stably to HLA molecules of type A3.
L'invention concerne également les séquences peptidiques dérivées des peptides susmentionnés, lesdites séquences dérivées, ou analogues, étant telles que définies ci- dessus dans le cadre des séquences dérivées des fragments protéiques polyépitopiques susmentionnés. The invention also relates to the peptide sequences derived from the abovementioned peptides, the said derived sequences, or the like, being as defined above within the framework of the sequences derived from the polyepitopic protein fragments mentioned above.
L'invention a également pour objet les anticorps dirigés contre les fragments protéiques polyépitopiques ou les épitopes ou leurs analogues tels que définis ci-dessus, lesdits anticorps étant tels qu'obtenus par immunisation d'un animal avec au moins un des complexes susmentionnés, lesdits anticorps étant susceptibles de former un complexe avec ces fragments polyépitopiques ou ces épitopes ou leurs analogues. The subject of the invention is also the antibodies directed against the polyepitopic protein fragments or the epitopes or their analogs as defined above, the said antibodies being as obtained by immunization of an animal with at least one of the above-mentioned complexes, the said antibodies being capable of forming a complex with these polyepitopic fragments or these epitopes or their analogs.
Les anticorps selon l'invention sont des anticorps polyclonaux ou monoclonaux. The antibodies according to the invention are polyclonal or monoclonal antibodies.
Les anticorps polyclonaux susmentionnés sont obtenus par immunisation d'un animal avec au moins un fragment protéique polyépitopique ou un épitope ou un analogue selon l'invention, suivie de la récupération des anticorps recherchés sous forme purifiée, par prélèvement du sérum dudit animal, et séparation desdits anticorps des autres constituants du sérum, notamment par chromatographie d'affinité sur une colonne sur laquelle est fixée un antigène spécifiquement reconnu par les anticorps, notamment un fragment protéique polyépitopique ou un épitope ou un analogue selon l'invention. The aforementioned polyclonal antibodies are obtained by immunization of an animal with at least one polyepitopic protein fragment or an epitope or an analog according to the invention, followed by the recovery of the desired antibodies in purified form, by removal of the serum from said animal, and separation said antibodies from the other constituents of the serum, in particular by affinity chromatography on a column on which is fixed an antigen specifically recognized by the antibodies, in particular a polyepitopic protein fragment or an epitope or an analog according to the invention.
Les anticorps monoclonaux selon l'invention peuvent être obtenus par la technique des hybridomes dont le principe général est rappelé ci-après. The monoclonal antibodies according to the invention can be obtained by the hybridoma technique, the general principle of which is recalled below.
Dans un premier temps, on immunise un animal, généralement une souris, (ou des cellules en culture dans le cadre d'immunisations in vitro) avec un fragment protéique polyépitopique ou un épitope ou un analogue selon l'invention, contre lesquels les lymphocytes B de l'animal sont alors capables de produire des anticorps. Ces lymphocytes producteurs d'anticorps sont ensuite fusionnés avec des cellules myélomateuses "immortelles" (notamment murines) pour donner lieu à des hybridomes. Firstly, an animal, generally a mouse, (or cells in culture in the context of in vitro immunizations) is immunized with a polyepitopic protein fragment or an epitope or the like according to the invention, against which the B lymphocytes of the animal are then able to produce antibodies. These antibody-producing lymphocytes are then fused with "immortal" (especially murine) myeloma cells to give rise to hybridomas.
A partir du mélange hétérogène des cellules ainsi obtenu, on effectue alors une sélection From the heterogeneous mixture of cells thus obtained, a selection is then made
<Desc/Clms Page number 18><Desc / Clms Page number 18>
des cellules capables de produire un anticorps particulier et de se multiplier indéfiniment. Chaque hybridome est multiplié sous la forme de clones, chacun conduisant à la production d'un anticorps monoclonal dont les propriétés de reconnaissance vis-à-vis du fragment protéique polyépitopique ou épitope ou analogue de l'invention pourront être testées par exemple en ELISA, par immunotransfert en une ou deux dimensions, en immunofluorescence, ou à l'aide d'un biocapteur. Les anticorps monoclonaux ainsi sélectionnés, sont par la suite purifiés notamment selon la technique de chromatographie d'affinité décrite ci-dessus. cells capable of producing a particular antibody and multiplying indefinitely. Each hybridoma is multiplied in the form of clones, each leading to the production of a monoclonal antibody whose recognition properties with respect to the polyepitopic protein fragment or epitope or analog of the invention can be tested for example by ELISA, by immunoblotting in one or two dimensions, in immunofluorescence, or using a biosensor. The monoclonal antibodies thus selected are subsequently purified in particular according to the affinity chromatography technique described above.
L'invention a également pour objet toute composition pharmaceutique, caractérisée en ce qu'elle comprend un ou plusieurs anticorps tels que définis ci-dessus, en association avec un véhicule physiologiquement acceptable, ainsi que leur utilisation dans le cadre du traitement des pathologies susmentionnées. The subject of the invention is also any pharmaceutical composition, characterized in that it comprises one or more antibodies as defined above, in association with a physiologically acceptable vehicle, as well as their use in the context of the treatment of the abovementioned pathologies.
L'invention concerne également l'utilisation d'un ou plusieurs anticorps susmentionnés pour la mise en #uvre d'une méthode de diagnostic in vitro des pathologies susmentionnées. The invention also relates to the use of one or more of the abovementioned antibodies for the implementation of a method of in vitro diagnosis of the abovementioned pathologies.
A ce titre l'invention a également pour objet des trousses ou kits comprenant lesdits anticorps, pour la mise en #uvre d'une méthode de diagnostic telle que définie ci-dessus. As such, the invention also relates to kits or kits comprising said antibodies, for the implementation of a diagnostic method as defined above.
L'invention a également pour objet tout procédé de préparation de fragments polyépitopiques, d'épitopes simples (peptides susmentionnés), ou de séquences dérivées, par synthèse peptidique classique en phase liquide ou en phase solide. The subject of the invention is also any process for the preparation of polyepitopic fragments, of simple epitopes (peptides mentioned above), or of derived sequences, by conventional peptide synthesis in liquid phase or in solid phase.
En variante, les fragments polyépitopiques, épitopes simples, ou séquences peptidiques dérivées, tels que définis ci-dessus selon l'invention, peuvent être obtenus sous forme de polypeptides recombinants par transformation de cellules hôtes appropriées telles que définies ci-dessus à l'aide de vecteurs contenant une séquence nucléotidique recombinante telle que définie ci-dessus selon l'invention, et récupération, le cas échéant après purification, du polypeptide recombinant codé par ladite séquence nucléotidique et produit par les cellules hôtes susmentionnées. As a variant, the polyepitopic fragments, simple epitopes, or derived peptide sequences, as defined above according to the invention, can be obtained in the form of recombinant polypeptides by transformation of appropriate host cells as defined above using vectors containing a recombinant nucleotide sequence as defined above according to the invention, and recovery, if necessary after purification, of the recombinant polypeptide encoded by said nucleotide sequence and produced by the abovementioned host cells.
Claims (7)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR9912511A FR2794371B1 (en) | 1999-10-07 | 1999-10-07 | POLYEPITOPIC PROTEIN FRAGMENTS, THEIR OBTAINMENT AND THEIR USES IN PARTICULAR IN VACCINATION |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR9912511A FR2794371B1 (en) | 1999-10-07 | 1999-10-07 | POLYEPITOPIC PROTEIN FRAGMENTS, THEIR OBTAINMENT AND THEIR USES IN PARTICULAR IN VACCINATION |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| FR2794371A1 true FR2794371A1 (en) | 2000-12-08 |
| FR2794371B1 FR2794371B1 (en) | 2004-06-18 |
Family
ID=9550666
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| FR9912511A Expired - Fee Related FR2794371B1 (en) | 1999-10-07 | 1999-10-07 | POLYEPITOPIC PROTEIN FRAGMENTS, THEIR OBTAINMENT AND THEIR USES IN PARTICULAR IN VACCINATION |
Country Status (1)
| Country | Link |
|---|---|
| FR (1) | FR2794371B1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002055542A2 (en) * | 2001-01-16 | 2002-07-18 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Hpv-specific peptides, which block the binding of hpv to the host cell |
| FR2839072A1 (en) * | 2002-04-24 | 2003-10-31 | Neovacs | PRODUCT FOR EXPRESSION OF DNA ENCODING HPV-16 MUTETED E7 PROTEIN, IMMUNOGENIC COMPOSITION CONTAINING SAID EXPRESSION PRODUCT AND PROCESS FOR PREPARING THE SAME |
| WO2011101122A1 (en) * | 2010-02-16 | 2011-08-25 | Österreichische Akademie der Wissenschaften | Anti-hpv e7 antibodies |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0257754A2 (en) * | 1986-07-10 | 1988-03-02 | The Board Of Trustees Of The Leland Stanford Junior University | Synthetic peptides of human Papilloma virus |
| EP0375555A1 (en) * | 1988-12-23 | 1990-06-27 | Medgenix Group, S.A. | Peptides, antibodies against them, and methods for the detection and dosage of the papilloma virus |
| EP0451550A2 (en) * | 1990-03-20 | 1991-10-16 | BEHRINGWERKE Aktiengesellschaft | Seroreactive epitopes of human Papillomavirus (HPV) 16 proteins |
| EP0523391A1 (en) * | 1991-07-13 | 1993-01-20 | BEHRINGWERKE Aktiengesellschaft | Use of HPV-16 E6 and E7-gene derived peptides for the diagnostic purpose |
| WO1993022338A1 (en) * | 1992-05-05 | 1993-11-11 | Rijksuniversiteit Leiden | Peptides of human papilloma virus for use in human t cell response inducing compositions |
| WO1998023635A1 (en) * | 1996-11-29 | 1998-06-04 | The University Of Queensland | Novel promiscuous t helper cell epitopes |
-
1999
- 1999-10-07 FR FR9912511A patent/FR2794371B1/en not_active Expired - Fee Related
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0257754A2 (en) * | 1986-07-10 | 1988-03-02 | The Board Of Trustees Of The Leland Stanford Junior University | Synthetic peptides of human Papilloma virus |
| EP0375555A1 (en) * | 1988-12-23 | 1990-06-27 | Medgenix Group, S.A. | Peptides, antibodies against them, and methods for the detection and dosage of the papilloma virus |
| EP0451550A2 (en) * | 1990-03-20 | 1991-10-16 | BEHRINGWERKE Aktiengesellschaft | Seroreactive epitopes of human Papillomavirus (HPV) 16 proteins |
| EP0523391A1 (en) * | 1991-07-13 | 1993-01-20 | BEHRINGWERKE Aktiengesellschaft | Use of HPV-16 E6 and E7-gene derived peptides for the diagnostic purpose |
| WO1993022338A1 (en) * | 1992-05-05 | 1993-11-11 | Rijksuniversiteit Leiden | Peptides of human papilloma virus for use in human t cell response inducing compositions |
| WO1998023635A1 (en) * | 1996-11-29 | 1998-06-04 | The University Of Queensland | Novel promiscuous t helper cell epitopes |
Non-Patent Citations (2)
| Title |
|---|
| MÜLLER M ET AL: "IDENTIFICATION OF SEROREACTIVE REGIONS OF THE HUMAN PAPILLOMAVIRUS TYPE 16 PROTEINS E4, E6, E7 AND L1", JOURNAL OF GENERAL VIROLOGY,GB,SOCIETY FOR GENERAL MICROBIOLOGY, READING, vol. 71, 1 January 1990 (1990-01-01), pages 2709 - 2717, XP000318453, ISSN: 0022-1317 * |
| RUPPERT J ET AL: "CLASS I MHC-PEPTIDE INTERACTION: STRUCTURAL AND FUNCTIONAL ASPECTS", BEHRING INSTITUTE: MITTEILUNGEN,DE,MARBURG, no. 94, 1 July 1994 (1994-07-01), pages 48 - 60, XP000604845 * |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002055542A2 (en) * | 2001-01-16 | 2002-07-18 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Hpv-specific peptides, which block the binding of hpv to the host cell |
| WO2002055542A3 (en) * | 2001-01-16 | 2002-12-19 | Deutsches Krebsforsch | Hpv-specific peptides, which block the binding of hpv to the host cell |
| FR2839072A1 (en) * | 2002-04-24 | 2003-10-31 | Neovacs | PRODUCT FOR EXPRESSION OF DNA ENCODING HPV-16 MUTETED E7 PROTEIN, IMMUNOGENIC COMPOSITION CONTAINING SAID EXPRESSION PRODUCT AND PROCESS FOR PREPARING THE SAME |
| WO2003090667A2 (en) * | 2002-04-24 | 2003-11-06 | Neovacs | Non-immunosuppressive imunogenic or vaccine composition comprising a mutated e7 protein of the hpv-16 virus |
| WO2003090667A3 (en) * | 2002-04-24 | 2004-04-01 | Neovacs | Non-immunosuppressive imunogenic or vaccine composition comprising a mutated e7 protein of the hpv-16 virus |
| US7314629B2 (en) | 2002-04-24 | 2008-01-01 | Neovacs | Non-immunosuppressive immunogenic or vaccine composition comprising a mutated E7 protein of the HPV-16 virus |
| WO2011101122A1 (en) * | 2010-02-16 | 2011-08-25 | Österreichische Akademie der Wissenschaften | Anti-hpv e7 antibodies |
| US9249212B2 (en) | 2010-02-16 | 2016-02-02 | Osterreichische Akademie Der Wissenchaften | Anti-HPV E7 antibodies |
| EP2993183A1 (en) * | 2010-02-16 | 2016-03-09 | Österreichische Akademie der Wissenschaften | Anti-hpv e7 antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| FR2794371B1 (en) | 2004-06-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1183368B1 (en) | Proteinfragmente die verschiedene epitope der hpv proteine e6 und e7 umfassen, ihre herstellung und verwendungen insbesondere zur impfung | |
| EP1383535A2 (en) | Mixture of peptides derived from e6 and/or e7 papillomavirus proteins and uses thereof | |
| FR2773156A1 (en) | NOVEL ANTI-RETROVIRAL IMMUNOGENS (TOXOIDS), NOVEL PREPARATION METHODS AND APPLICATION TO AIDS PREVENTION AND TREATMENT | |
| JP2003529319A (en) | Methods of eliciting broadly neutralizing antibodies targeting HIV-1 gp41 | |
| US20120028887A1 (en) | Lipopeptide inhibitors of hiv-1 | |
| EP0814834B2 (en) | Non-toxic immunogens derived from a retroviral regulatory protein, antibodies directed against said immunogens, preparation method therefor, and pharmaceutical compositions containing the same | |
| EP1169057B1 (en) | Anti-hiv 1 vaccine comprising the entire or part of the tat hiv-1 protein | |
| FR2794371A1 (en) | New polyepitopic fragments from human papilloma virus E6 and E7 proteins, useful for treatment or prevention of e.g. cervical neoplasia and cancer | |
| EP1068226A1 (en) | Lipopeptides inducing t lymphocytic cytotoxicity bearing at least one auxiliary t epitope, and uses for vaccination | |
| EP0550691B1 (en) | Antibody inductor peptides inhibiting retroviruses of the hiv type and antibodies specific for said peptides | |
| FR2794368A1 (en) | New polyepitopic fragments from the p53 protein, useful for treatment or prevention of cancer, e.g. of breast or colon | |
| EP1487484B1 (en) | Use of mixtures of lipopeptides for vaccine production | |
| EP1368478B1 (en) | Polypeptide inducing hiv-neutralising antibodies | |
| EP0439601B1 (en) | Composition containing a b epitope of the envelope glycoprotein of a retrovirus and a t epitope of a distinct protein from this virus | |
| WO2002020052A1 (en) | Use of lipopeptides for immunotherapy of hiv-positive subjects | |
| WO2018141089A1 (en) | Hiv inhibiting broad-spectrum lipopeptide, derivatives thereof, pharmaceutical compositions thereof, and use thereof | |
| FR2731355A1 (en) | NOVEL IMMUNOGENS, NEW ANTIBODIES, PREPARATION METHOD AND PHARMACEUTICAL COMPOSITIONS COMPRISING THE SAME | |
| CA2289110A1 (en) | Peptide analogues, and their uses in particular in pharmaceutical compositions and for diagnosis | |
| FR2821556A1 (en) | Vaccine for controlling viral rebound after cessation of antiretroviral therapy in HIV patients, containing lipopeptides derived from CTL epitopes of HIV proteins | |
| FR2698271A1 (en) | Vaccine against bovine leukaemia virus - contg. peptide(s), derived from the viral gp 51 glyco:protein, esp. useful for booster vaccination. | |
| OA19487A (en) | Potent HIV inhibiting lipopeptide, derivative thereof, pharmaceutical composition thereof and use thereof. | |
| FR2830534A1 (en) | New polypeptide based on human immune deficiency virus gp41, useful in preventative or therapeutic vaccine, induces neutralizing antibodies against primary isolates |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| TQ | Partial transmission of property | ||
| RM | Correction of a material error | ||
| TQ | Partial transmission of property | ||
| ST | Notification of lapse |
Effective date: 20140228 |