EP3630160A1 - Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence - Google Patents

Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence

Info

Publication number
EP3630160A1
EP3630160A1 EP18731359.8A EP18731359A EP3630160A1 EP 3630160 A1 EP3630160 A1 EP 3630160A1 EP 18731359 A EP18731359 A EP 18731359A EP 3630160 A1 EP3630160 A1 EP 3630160A1
Authority
EP
European Patent Office
Prior art keywords
fgf21
promoter
nucleotide sequence
mofgf21
aav8
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP18731359.8A
Other languages
German (de)
French (fr)
Inventor
Veronica JIMÉNEZ CENZANO
Fatima Bosch Tubert
Claudia JAMBRINA PALLARES
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universitat Autonoma de Barcelona UAB
Original Assignee
Universitat Autonoma de Barcelona UAB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universitat Autonoma de Barcelona UAB filed Critical Universitat Autonoma de Barcelona UAB
Publication of EP3630160A1 publication Critical patent/EP3630160A1/en
Pending legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C07K14/50—Fibroblast growth factor [FGF]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18—Growth factors; Growth regulators
    • A61K38/1825—Fibroblast growth factor [FGF]
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027—New or modified breeds of vertebrates
    • A01K67/0275—Genetically modified vertebrates, e.g. transgenic
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66—Microorganisms or materials therefrom
    • A61K35/76—Viruses; Subviral particles; Bacteriophages
    • A61K35/761—Adenovirus
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2207/00—Modified animals
    • A01K2207/25—Animals on a special diet
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00—Animals characterised by species
    • A01K2227/10—Mammal
    • A01K2227/105—Murine
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00—Animals characterised by purpose
    • A01K2267/03—Animal model, e.g. for test or diseases
    • A01K2267/035—Animal model for multifactorial diseases
    • A01K2267/0362—Animal model for lipid/glucose metabolism, e.g. obesity, type-2 diabetes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
    • C12N2015/8518—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic expressing industrially exogenous proteins, e.g. for pharmaceutical use, human insulin, blood factors, immunoglobulins, pseudoparticles
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
    • C12N2310/141—MicroRNAs, miRNAs
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2799/00—Uses of viruses
    • C12N2799/02—Uses of viruses as vector

Definitions

  • Viral expression construct comprising a Fibroblast Growth Factor 21 (FGF21) coding sequence
  • the invention pertains to the medical field, comprising gene therapy compositions for use in the treatment of a metabolic disorder, use in the treatment of liver inflammation and/or fibrosis, use in the treatment of cancer and/or use in extending healthy lifespan in mammals, particularly in human beings. Background of the invention
  • liver fibrosis is an excessive accumulation of extracellular matrix proteins, e.g. collagen, resulting predominantly from chronic liver inflammation. Advanced liver fibrosis will lead to liver cirrhosis, portal hypertension and liver failure. Thus, novel and safe antifibrotic therapeutics are required.
  • Fibroblast growth factor 21 (FGF21 ), a growth factor predominantly secreted by the liver, but also by adipose tissue and pancreas (Muise, E. S. et al, 2008. Mol. Pharmacol. 74:403-412), has been shown to increase brown adipose tissue (BAT) growth and expression of thermogenic genes in BAT and white adipose tissue (WAT), stimulating energy expenditure (Coskun, T. et al, 2008. Endocrinology 149:6018-6027; Fisher, F. M. et al., 2012. Genes Dev. 26:271-281; Kharitonenkov, A. et al., 2005. J. Clin.
  • Native FGF21 protein exhibits poor pharmacokinetic characteristics. It has a short half- life, and it is susceptible to in vivo proteolytic degradation and in vitro aggregation (Huang, J. et al, 2013. J Pharmacol Exp Ther. 346(2 :270-80; So, W. Y. and Leung, P.S. 2016. Med Res Rev. 36(4 :672-704; Zhang, J. and Li, Y. 2015. Front Endocrinol (Lausanne). 6: 168).
  • Various engineering approaches have been developed to extend the half-life and to improve the stability and solubility of FGF21.
  • two engineered FGF21 mimetics LY2405319 and PF-05231023 are being tested in humans.
  • FGF21 mimetics require multiple administrations, which poses a significant burden to the patients.
  • engineered FGF21 mimetics/analogs may exhibit a higher risk of immunogenicity than native FGF21, e.g. patients treated with LY2405319 developed injection site reactions, anti-drug antibodies and a serious hypersensitivity reaction (Gaich, G. et al, 2013. Cell Metab. 18 ⁇ 3):333-40).
  • the inventors designed improved gene therapy strategies based on adeno-associated viral (AAV) vector-mediated FGF21 gene transfer to liver, adipose tissue and/or skeletal muscle to counteract metabolic disorders, preferably diabetes and/or obesity.
  • AAV adeno-associated viral
  • the gene therapy of the invention may also be used to counteract liver inflammation and/or fibrosis. Additionally, the gene therapy of the invention may also be used for the extension of healthy lifespan by counteracting metabolic disorders associated with aging, preferably diabetes and/or obesity. Additionally, the gene therapy of the invention may also be used to counteract cancer, preferably liver cancer.
  • a viral expression construct suitable for expression in a mammal and comprising a nucleotide sequence encoding a Fibroblast growth factor 21 (FGF21) to be expressed in liver, adipose tissue and/or skeletal muscle.
  • FGF21 Fibroblast growth factor 21
  • a preferred nucleotide sequence encoding a FGF21 present in the viral expression construct of the invention has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • a more preferred nucleotide sequence encoding a human FGF21 present in the viral expression construct of the invention has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6 or 7.
  • SEQ ID NO: 4 is a nucleotide sequence encoding human FGF21.
  • SEQ ID NO: 5 is a codon optimized nucleotide sequence encoding human FGF21, variant 1.
  • SEQ ID NO: 6 is a codon optimized nucleotide sequence encoding human FGF21, variant 2.
  • SEQ ID NO: 7 is a codon optimized nucleotide sequence encoding human FGF21, variant 3.
  • Variant 1, variant 2 and variant 3 encode for the same human FGF21 protein and were obtained by different algorithms of codon optimization.
  • nucleotide sequence encoding canine FGF21 present in the viral expression construct of the invention has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 10 or 11. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • SEQ ID NO: 10 is a nucleotide sequence encoding canine FGF21.
  • SEQ ID NO: 11 is a codon optimized nucleotide sequence encoding canine FGF21.
  • nucleotide sequence that has at least 60% sequence identity with the nucleotide sequence of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11.
  • a preferred nucleotide sequence encoding a FGF21 suitable for expression in a mammal encodes a polypeptide comprising an amino acid sequence that has at least 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 1, 2 or 3. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • SEQ ID NO: 1 is an amino acid sequence of human FGF21.
  • SEQ ID NO: 2 is an amino acid sequence of murine FGF21.
  • SEQ ID NO: 3 is an amino acid sequence of canine FGF21.
  • a viral expression construct as described above comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and at least one of elements a), b), c), d) and e):
  • a "target sequence of a microRNA expressed in the heart” or “target sequence of a miRNA expressed in the heart” or “binding site of a microRNA expressed in the heart” refers to a nucleotide sequence which is complementary or partially complementary to at least a portion of a microRNA expressed in the heart.
  • a portion of a microRNA expressed in the liver or a portion of a microRNA expressed in the heart, as defined herein, means a nucleotide sequence of at least five or at least six consecutive nucleotides of said microRNA.
  • the binding site sequence can have perfect complementarity to at least a portion of an expressed microRNA, meaning that the sequences can be a perfect match, no mismatch may occur.
  • the binding site sequence can be partially complementary to at least a portion of an expressed microRNA, meaning that one mismatch/five, six consecutive nucleotides may occur.
  • Partially complementary binding sites preferably contain perfect or near perfect complementarity to the seed region of the microRNA, meaning that no mismatch (perfect complementarity) or one mismatch/five, six consecutive nucleotides (near perfect complementarity) may occur between the seed region of the microRNA and its binding site.
  • the seed region of the microRNA consists of the 5' region of the microRNA from about nucleotide 2 to about nucleotide 8 of the microRNA (i.e. 6 nucleotides).
  • the portion as defined herein is preferably the seed region of said microRNA.
  • Degradation of the messenger RNA (mRNA) containing the target sequence for a microRNA expressed in the liver or a microRNA expressed in the heart may be through the RNA interference pathway or via direct translational control (inhibition) of the mRNA.
  • the invention is not limited by the pathway ultimately utilized by the miRNA in inhibiting expression of the transgene or encoded protein.
  • the nucleotide sequence encoding a target sequence of a microRNA expressed in the liver may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 12.
  • a more preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 12.
  • at least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the liver, as defined in SEQ ID NO: 12 or 14-23, is present in the viral expression construct of the invention.
  • two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding a target sequence of a liver-specific microRNA, as defined in SEQ ID NO: 12 or 14-23, are present in the viral expression construct of the invention.
  • one, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding miRT122a (SEQ ID NO: 12) are present in the viral expression construct of the invention.
  • a target sequence of a microRNA expressed in the liver as used herein exerts at least a detectable level of activity of a target sequence of a microRNA expressed in the liver as known to the skilled person.
  • An activity of a target sequence of a microRNA expressed in the liver is to bind to its cognate, microRNA expressed in the liver and, when operatively linked to a transgene, to mediate detargeting of transgene expression in the liver. This activity may be assessed by measuring the levels of transgene expression in the liver by qPCR, as described in the experimental part.
  • the nucleotide sequence encoding a target sequence of a microRNA expressed in the heart may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 13.
  • a preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 13.
  • two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding a target sequence of a heart-specific microRNA, as defined in SEQ ID NO: 13 or 23-30 are present in the viral expression construct of the invention.
  • one, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding miRTl (SEQ ID NO: 13) are present in the viral expression construct of the invention.
  • An activity of a target sequence of a microRNA expressed in the heart is to bind to its cognate, microRNA expressed in the heart and, when operatively linked to a transgene, to mediate detargeting of transgene expression in the heart. This activity may be assessed by measuring the levels of transgene expression in the heart by qPCR, as described in the experimental part.
  • nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and the nucleotide sequence encoding a target sequence of a microRNA expressed in the heart is selected from a group consisting of sequences SEQ ID NO: 12 to 30 and/or combinations thereof.
  • At least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the liver, as defined in SEQ ID NO: 12 or 14-23, and at least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, as defined in SEQ ID NO: 13 or 23-30, are present in the viral expression construct of the invention.
  • one, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding miRTl 22a (SEQ ID NO: 12) and one, two, three, four, five, six, seven or eight copies nucleotide sequence encoding miRTl (SEQ ID NO: 13) are combined in the viral expression construct of the invention.
  • four copies of a nucleotide sequence encoding miRTl 22a (SEQ ID NO: 12) and four copies of nucleotide sequence encoding miRTl (SEQ ID NO: 13) are combined in the viral expression construct of the invention.
  • promoter liver-specific promoter
  • adipose tissue-specific promoter ubiquitous promoter
  • skeletal muscle promoter skeletal muscle promoter
  • a nucleotide sequence of a CAG promoter may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 44.
  • a preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 44. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • CMV cytomegalovirus
  • a nucleotide sequence of a CMV promoter may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60%> sequence identity or similarity with SEQ ID NO: 45.
  • a preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 45. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • an intronic sequence may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 43.
  • a preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 43. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • a preferred liver-specific promoter is a human a 1 -antitrypsin (hAAT) promoter.
  • a nucleotide sequence of a hAAT promoter may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 47.
  • a preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 47. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
  • hAAT promoter is used together with an intronic sequence.
  • a preferred intronic sequence is a hepatocyte control region (HCR) enhancer from apo lipoprotein E.
  • HCR hepatocyte control region
  • a most preferred intronic sequence is the HCR enhancer from apolipoprotein E as defined in SEQ ID NO: 53.
  • an intronic sequence may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60%> sequence identity or similarity with SEQ ID NO: 53.
  • a preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 53.
  • said hAAT promoter is used together with one, two, three, four or five copies of an intronic sequence.
  • said hAAT promoter is used together with one, two, three, four or five copies of the HCR enhancer from apolipoprotein E as defined in SEQ ID NO: 53.
  • liver-specific promoters are the albumin promoter, the major urinary protein promoter, the phosphoenolpyruvate carboxykinase (PEPCK) promoter, the liver- enriched protein activator promoter, the transthyretin promoter, the thyroxine binding globulin promoter, the apolipoprotein Al promoter, the liver fatty acid binding protein promoter and the phenylalanine hydroxylase promoter .
  • PPCK phosphoenolpyruvate carboxykinase
  • Adipose tissue-specific promoters are the adipocyte protein 2 (aP2, also known as fatty acid binding protein 4 (FABP4)) promoter, the PPARy promoter, the adiponectin promoter, the phosphoenolpyruvate carboxykinase (PEPCK) promoter, the promoter derived from human aromatase cytochrome p450 (p450arom) the mini/aP2 promoter (composed of the adipose-specific aP2 enhancer and the basal aP2 promoter), the uncoupling protein 1 (UCP1) promoter, the mini/UCPl promoter (composed of the adipose-specific UCP1 enhancer and the basal UCP1 promoter), the adipsin promoter, the leptin promoter, or the Foxa-2 promoter.
  • ABP2 fatty acid binding protein 4
  • PPCK phosphoenolpyruvate carboxykinase
  • Preferred skeletal muscle promoters are the myosin light-chain promoter, the myosin heavy-chain promoter, the desmin promoter, the muscle creatine kinase (MCK) promoter, the smooth muscle alpha-actin promoter, the CK6 promoter, the Unc-45 Myosin Chaperone B promoter, the basal MCK promoter in combination with copies of the MCK enhancer, the Enh358MCK promoter (combination of the MCK enhancer with the 358 bp proximal promoter of the MCK gene).
  • a most preferred skeletal muscle promoter is the C5-12 promoter as defined in SEQ ID NO: 56.
  • a viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element a),
  • a viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element b),
  • a viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element d),
  • a viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element e),
  • a viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element b) and a nucleotide sequence of element c),
  • a viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element e) and a nucleotide sequence of element c).
  • liver-specific promoter is the human a 1 -antitrypsin (hAAT) promoter and/or the adipose tissue-specific promoter is the mini/ap2 promoter and/or the mini/UCPl promoter and/or the skeletal muscle promoter is the C5-12 promoter and/or the ubiquitous promoter is the cytomegalovirus (CMV) promoter and/or the CAG promoter.
  • hAAT human a 1 -antitrypsin
  • adipose tissue-specific promoter is the mini/ap2 promoter and/or the mini/UCPl promoter
  • the skeletal muscle promoter is the C5-12 promoter and/or the ubiquitous promoter is the cytomegalovirus (CMV) promoter and/or the CAG promoter.
  • CMV cytomegalovirus
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element a) wherein said construct is AAV8-hAAT-moFGF21.
  • This construct for example contains a viral expression construct as depicted in Figure 6A: ITR2-hAAT-moFGF21- polyA-ITR2; the sequence of this expression construct is comprised in SEQ ID NO:34.
  • Example 3 surprisingly reveals high and stable liver-specific expression after intravenous administration. Expression was shown to be stable for up to 1 year (Example 12).
  • Examples 3 and 11 Extensive beneficial therapeutic effects for the reversion and treatment of obesity and diabetes are shown in ob/ob mice (Examples 3 and 11), high fat diet (HFD)-fed mice (Examples 4, 12-14) and old HFD-fed mice (Examples 5, 12-14).
  • Examples 11 and 16 also reveal marked improvement of hepatic steatosis, hepatic inflammation and hepatic fibrosis.
  • Example 15 shows improvement of the inflammation of WAT associated to obesity.
  • Example 17 indicates the long-term safety of the therapy.
  • Example 18 reveals a beneficial effect in preventing liver tumors.
  • Example 19 shows therapeutic potential in a model for type I diabetes.
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element b), wherein the adipose tissue-specific promoter is a mini/aP2 promoter (SEQ ID NO: 54) and/or a mini/UCPl promoter (SEQ ID NO 55).
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element c), wherein the ubiquitous promoter is a CAG Promoter (SEQ ID NO: 44) and wherein the at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver is selected from the group consisting of SEQ ID NO: 12 or 14-23 and the at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart is selected from the group consisting of SEQ ID NO: 13 or 23-30.
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element c) wherein said construct is AAV9-CAG-moFGF21 -dmiRT or AAV8-CAG-moFGF21- dmiRT.
  • the notations dmiRT and doublemiRT are equivalent.
  • These constructs for example contain a viral expression construct as depicted in Figure 1A: ITR2-CAG- moFGF21-4x miRT122a-4x miRTl-polyA-ITR2; the sequence of this expression construct is comprised in SEQ ID NO:32.
  • Examples 1 -2 surprisingly reveal high and stable adipose-specific expression after intra-eWAT administration. Extensive beneficial therapeutic effects for the prevention, reversion and treatment of obesity and diabetes are shown in normal mice (Example 1) and ob/ob mice (Examples 2 and 10). Example 10 also reveals improvement of hepatic steatosis.
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element d), wherein the skeletal muscle promoter is a C5-12 promoter (SEQ ID NO: 56).
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element e), wherein the ubiquitous promoter is a CMV promoter (SEQ ID NO: 45) and the AAV serotype is AAV1.
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element e) wherein said construct is AAV 1 -CMV-moFGF21.
  • This construct for example contains a viral expression construct as depicted in Figure 11 A: ITR2-CMV-moFGF21-polyA- ITR2; the sequence of this expression construct is comprised in SEQ ID NO:36.
  • Example 20 reveals high and stable skeletal muscle-specific expression after intramuscular administration. Extensive beneficial therapeutic effects for the prevention, reversion and treatment of obesity and diabetes are shown in HFD- fed mice (Examples 6 and 21). Example 20 reveals a beneficial effect in extending healthy lifespan by preventing obesity and diabetes.
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element b) and a nucleotide sequence of element c), wherein the adipose tissue-specific promoter is a mini/aP2 promoter (SEQ ID NO : 54) and/or the mini/UCP 1 promoter (SEQ ID NO 55).
  • a viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element e) and a nucleotide sequence of element c), wherein the ubiquitous promoter is a CMV promoter (SEQ ID NO: 45) and the AAV serotype is AAV1.
  • Zhang et al. discloses wild type murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183). This construct was compared with constructs of the invention in Examples 23 and 24. In all the in vitro and in vivo experiments, all expression cassettes and AAV vectors of the invention mediated higher expression of FGF21 in the target tissue or cell type and lower expression of FGF21 in off-target tissues, demonstrating higher efficiency of the expression cassettes and AAV vectors of the invention as well as higher tissue-specificity.
  • EFla elongation factor la
  • constructs CMV-moFGF21 and C AG-moFGF21 -double miRT also mediated higher protein production and secretion to the culture media in HEK293 cells in comparison to EFla-mFGF21.
  • hAAT-moFGF21 and AAV8-hAAT-moFGF21 also mediated higher secretion of FGF21 to the bloodstream than EF 1 a-mFGF21 and AAV8-EF 1 a-mFGF21.
  • Additional sequences may be present in the viral expression construct of the invention as explained in detail in the part of the description entitled "general definitions".
  • Preferred additional sequences include inverted terminal repeats (ITRs), a SV40 polyadenylation signal (SEQ ID NO: 50), a rabbit ⁇ -globin polyadenylation signal (SEQ ID NO: 51), a CMV enhancer sequence (SEQ ID NO: 46) and a HCR enhancer from apolipoprotein E (SEQ ID NO: 53).
  • ITRs is intended to encompass one 5'ITR and one 3'ITR, each being derived from the genome of an AAV.
  • Preferred ITRs are from AAV2 and are represented by SEQ ID NO: 48 (5' ITR) and SEQ ID NO: 49 (3' ITR). Within the context of the invention, it is encompassed to use the CMV enhancer sequence (SEQ ID NO: 46) and the CMV promoter sequence (SEQ ID NO: 45) as two separate sequences or as a single sequence (SEQ ID NO: 52).
  • the viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and at least one of elements a) and/or b) and/or c) and/or d) and/or e) as earlier defined further comprises:
  • the viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and at least one of elements a) and/or b) and/or c) and/or d) and/or e) as earlier defined further comprises ITRs that flank the expression cassette of said construct and optionally
  • an additional sequence may be present selected from the group consisting of: ITRs, SV40 polyadenylation signal, rabbit ⁇ -globin polyadenylation signal, CMV enhancer sequence, HCR enhancer sequence from apolipoprotein E.
  • the viral expression construct comprises a nucleotide sequence encoding FGF21 suitable for expression in a mammal and at least one of elements a) and/or b) and/or c) and/or d) and/or e), wherein an additional sequence is present which is selected from the group consisting of: ITRs, SV40 polyadenylation signal, rabbit ⁇ -globin polyadenylation signal, CMV enhancer sequence, HCR enhancer sequence.
  • ITRs are those of AAV2 which are represented by SEQ ID NO: 48 (5' ITR) and SEQ ID NO: 49 (3' ITR).
  • Preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR.
  • Other preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR.
  • SV40 polyadenylation signals are present.
  • kits comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR.
  • rabbit ⁇ -globin polyadenylation signals are present.
  • kits comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR.
  • CMV enhancer sequence is present.
  • kits comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR.
  • HCR enhancer sequence from apolipoprotein E is present.
  • Construct B (represented by a nucleotide sequence comprising SEQ ID NO: 32), Construct D (represented by a nucleotide sequence comprising SEQ ID NO: 34), Construct F (represented by a nucleotide sequence comprising SEQ ID NO: 36), Construct G (represented by a nucleotide sequence comprising SEQ ID NO: 37), Construct H (represented by a nucleotide sequence comprising SEQ ID NO: 38), Construct I (represented by a nucleotide sequence comprising SEQ ID NO: 39), Construct J (represented by a nucleotide sequence comprising SEQ ID NO: 40), Construct K (represented by a nucleotide sequence comprising SEQ ID NO: 41).
  • Construct L (represented by a nucleotide sequence comprising SEQ ID NO: 42).
  • each of these viral expression constructs already comprise two ITRs from AAV2 (i.e. SEQ ID NO: 48 (5' ITR) and SEQ ID NO: 49 (3' ITR)).
  • Constructs B and G comprise a rabbit ⁇ -globin polyadenylation signal.
  • Construct F comprises a SV40 polyadenylation signal, a CMV enhancer sequence and a nucleotide sequence of a chimeric intron (composed of introns from human ⁇ -globin and immunoglobulin heavy chain genes).
  • Constructs D, H-L comprise a SV40 polyadenylation signal, a HCR enhancer sequence and a nucleotide sequence of chimeric intron (composed of introns from human ⁇ -globin and immunoglobulin heavy chain genes).
  • nucleotide sequence the sequence of which differs from the sequence of a nucleic acid molecule of (i) due to the degeneracy of the genetic code.
  • sequence identity is determined by comparing the whole length of the sequences as identified herein. Unless otherwise indicated herein, identity with a given SEQ ID NO means identity or similarity based on the full length of said sequence (i.e. over its whole length or as a whole).
  • a construct defined by its minimum identity (i.e. at least 60%) to a given SEQ ID NO as identified above is encompassed within the scope of the invention when this construct or a viral expression construct or a viral vector comprising this construct or a composition comprising this construct or vector is able to induce the expression of FGF21 in a cell, preferably in a liver cell, cell of adipose tissue or in a cell of skeletal muscle.
  • the expression of FGF21 could be assessed using techniques known to the skilled person. In a preferred embodiment, said expression is assessed as carried out in the experimental part.
  • a viral expression construct is such that the construct is represented by a nucleotide sequence comprising SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11 or a sequence having at least 60% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11 or a sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11.
  • a viral vector comprising a viral expression construct as defined above, wherein said viral vector is an adenovirus vector, an adeno-associated virus vector, a retrovirus vector or a lentivirus vector, preferably an adeno-associated virus vector selected from the group consisting of an adeno-associated virus 1 (AAV1) vector, an adeno-associated virus 8 (AAV8) vector, and an adeno-associated virus 9 (AAV9) vector.
  • AAV1 adeno-associated virus 1
  • AAV8 adeno-associated virus 8
  • AAV9 adeno-associated virus 9
  • an AAV vector comprising each of the elements defined earlier herein and a recombinant AAV (rAAV) based genome comprising a ITR or a part thereof.
  • Preferred ITRs are those of AAV2 which are represented by SEQ ID NO: 48 (5 ' ITR) and SEQ ID NO: 49 (3' ITR).
  • the subject treated may be a higher mammal, e.g. cats, rodents, (preferably mice, rats, gerbils and guinea pigs, and more preferably mice and rats), or dogs, or human beings.
  • rodents preferably mice, rats, gerbils and guinea pigs, and more preferably mice and rats
  • dogs or human beings.
  • composition comprising a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above, together with one or more pharmaceutically acceptable excipients or vehicles.
  • Such pharmaceutically acceptable carrier, filler, preservative, solubilizer, diluent and/or excipient may for instance be found in Remington: The Science and Practice of Pharmacy, 20th Edition. Baltimore, MD: Lippincott Williams & Wilkins, 2000.
  • said composition is for use as a medicament, preferably for preventing, delaying, curing, reverting and/or treating a metabolic disorder, preferably a diabetes and/or obesity.
  • Diabetes may be Type 1 Diabetes, Type 2 Diabetes or Monogenic Diabetes.
  • the medicament is for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis.
  • the medicament is for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity.
  • the medicament is for preventing, delaying, curing, reverting and/or treating cancer, preferably liver cancer.
  • the subject treated may be a higher mammal, e.g. cats, rodent, (preferably mice, rats, gerbils and guinea pigs, and more preferably mice and rats), or dogs, or a human being.
  • Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for preventing, delaying, reverting, curing and/or treating a metabolic disorder, preferably a diabetes and/or obesity, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-diabetes effect and/or an anti-obesity effect.
  • Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-fibrotic effect.
  • Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-diabetes effect and/or an anti-obesity effect during aging.
  • Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for preventing, delaying, curing, reverting and/or treating cancer, preferably liver cancer, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-cancer effect.
  • An anti-diabetes effect may be reached when glucose disposal in blood is increased and/or when glucose tolerance is improved and/or when insulin sensitivity is increased. This could be assessed using techniques known to the skilled person or as done in the experimental part, preferably as assessed in example 8 or 9.
  • increase means at least a detectable increase (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part, such as measurement of glycaemia, insulinemia and/or performance of an insulin tolerance test and/or of a glucose tolerance test.
  • the increase may be an increase of at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 100%) using assays such as the measurement of glycaemia, insulinemia and/or performance of an insulin tolerance test and/or of a glucose tolerance test.
  • An anti-obesity effect may be reached when body weight, body weight gain and/or body fat percentage is decreased.
  • An anti-obesity effect may also be reached when body mass index (BMI), waist circumference, waist-to-hip ratio (WHR) and/or waist-to-height ratio (WHtR) is decreased. This could be assessed using techniques known to the skilled person or as done in the experimental part.
  • “decrease” means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
  • Anti-obesity effects include both prevention of obesity and reversion of obesity, as evaluated by measurement of body weight of the individual, the BMI and/or weight of the tissues.
  • an anti-inflammatory effect in the liver may be reached by a decrease in macrophage infiltration, decreased pro-inflammatory cytokines. This could be assessed using techniques known to the skilled person or as done in the experimental part.
  • “decrease” means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
  • a healthy lifespan-extending effect may be reached when an anti-diabetes and/or anti- obesity effect as defined earlier herein is used to prevent, delay, cure, reverse or treat the onset or progression of a metabolic disorder associated with aging, preferably of a diabetes and/or obesity.
  • a healthy lifespan-extending effect may also be reached by an increase in the healthy lifespan, wherein symptoms associated with metabolic disorders, preferably of a diabetes and/or obesity, are absent or reduced.
  • a healthy-lifespan extending effect may also be reached by improved coordination and balance (assessed by Rota-Rod test), memory (assessed by Object Recognition Test), and/or neuromuscular coordination (assessed by Tightrope Test), decreased mitochondrial and metabolic deterioration (assessed by measurement of expression levels of genes involved in metabolism and mitochondrial function such as PGC-1 alpha, ATP synthase and ERRalpha). This could be assessed using techniques known to the skilled person or as done in the experimental part.
  • “increase” means at least a detectable increase (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
  • an anti-cancer effect may be reached by a decrease in the cumulative incidence of cancer over the lifetime. This could be assessed using techniques known to the skilled person or as done in the experimental part.
  • “decrease” means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
  • An anti-fibrotic effect in the liver may also be observed when the progression of a typical symptom (e.g. liver stifness, jaundice, appetite loss, difficulty thinking clearly, fluid buildup in the legs or stomach, nausea, unexplained weight loss, weakness) has been slowed down as assessed by a physician.
  • a decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms.
  • Symptoms, and thus also a decrease in symptoms can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of liver fibrosis, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, imaging methods (elastography, X-rays, MRI, CT, ultrasonography, angiography), biochemical, immunohistochemical and others.
  • An healthy lifespan-extending effect may also be observed when the progression of a typical symptom of metabolic disorders associated with aging (e.g. insulin resistance, glucose intolerance, increase of body weight) has been slowed down as assessed by a physician.
  • a decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms.
  • Symptoms, and thus also a decrease in symptoms can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of diabetes and/or obesity, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, X-rays, biochemical, immunohistochemical and others.
  • An anti-cancer effect may also be observed when the progression of a typical symptom (e.g. tumor size, unexplained weight loss, loss of appetite, feeling very full after a small meal, nausea or vomiting, enlarged liver, enlarged spleen, pain in the abdomen or near the right shoulder blade, swelling or fluid build-up in the abdomen, itching, jaundice) has been slowed down as assessed by a physician.
  • a decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms.
  • Symptoms, and thus also a decrease in symptoms can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of cancer, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, imaging methods (X-rays, MRI, CT, ultrasonography, angiography), biochemical, immunohistochemical and others.
  • a medicament as defined herein is preferably able to alleviate one symptom or one characteristic of a patient or of a cell, tissue or organ of said patient if after at least one week, one month, six months, one year or more of treatment using a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention, said symptom or characteristic has decreased (e.g. is no longer detectable or has slowed down), as defined above.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for use according to the invention may be suitable for administration to a cell, tissue and/or an organ in vivo of individuals affected by or at risk of developing a metabolic disorder, such as a diabetes and/or obesity, liver inflammation and/or fibrosis, a metabolic disorder associated with aging, and/or cancer, and may be administered in vivo, ex vivo or in vitro.
  • a metabolic disorder such as a diabetes and/or obesity, liver inflammation and/or fibrosis, a metabolic disorder associated with aging, and/or cancer
  • An administration mode may be intravenous, subcutaneous, intramuscular, intrathecal, intraarticular, intraventricular, intraperitoneal, intra-adipose tissue, via inhalation, oral, intranasal, intrahepatic, intrasplanchnic, intra-ocular, intra-ear, topic administration and/or via retrograde intraductal pancreatic administration.
  • a preferred administration mode is intramuscular, intravenous or intra-adipose tissue, as described in the "General procedures to the Examples" as part of this application.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention may be directly or indirectly administered using suitable means known in the art. Improvements in means for providing an individual or a cell, tissue, organ of said individual with a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention are anticipated, considering the progress that has already thus far been achieved. Such future improvements may of course be incorporated to achieve the mentioned effect of the invention.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition can be delivered as is to an individual, a cell, tissue or organ of said individual.
  • a cell, tissue or organ of said individual may be as earlier defined herein.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention it is preferred that such viral expression construct and/or vector and/or nucleic acid and/or composition is dissolved in a solution that is compatible with the delivery method.
  • a therapeutically effective dose of a viral expression construct, vector, nucleic acid molecule and/or composition as mentioned above is preferably administered in a single and unique dose hence avoiding repeated periodical administration. More preferably, the single dose is administered to skeletal muscle, to adipose tissue or intravenously.
  • a further compound may be present in a composition of the invention.
  • Said compound may help in delivery of the composition.
  • suitable compounds compounds capable of forming complexes, nanoparticles, micelles and/or liposomes that deliver each constituent as defined herein, complexed or trapped in a vesicle or liposome through a cell membrane. Many of these compounds are known in the art.
  • Suitable compounds comprise polyethylenimine (PEI), or similar cationic polymers, including polypropyleneimine or polyethylenimine copolymers (PECs) and derivatives, synthetic amphiphiles (SAINT-18), lipofectinTM, DOTAP.
  • a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above, for use as a medicament.
  • said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in the treatment and/or prevention of liver inflammation and/or fibrosis. Complications of liver inflammation and/or fibrosis may also be encompassed.
  • said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity.
  • said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in the treatment and/or prevention of cancer, preferably liver cancer. Complications of a cancer may also be encompassed.
  • a method for preventing, delaying, reverting, curing and/or treating a metabolic disorder comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above.
  • Such a method is preferably for alleviating one or more symptom(s) of a metabolic disorder, such as a diabetes and/or obesity, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein.
  • a metabolic disorder such as a diabetes and/or obesity
  • a method for preventing, delaying, reverting, curing and/or treating liver inflammation and/or fibrosis and its complications comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above.
  • Such a method is preferably for alleviating one or more symptom(s) of liver inflammation and/or fibrosis, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein.
  • a method for extending healthy lifespan preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity, comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above.
  • a method for preventing, delaying, reverting, curing and/or treating cancer, preferably liver cancer and its complications comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above.
  • Such a method is preferably for alleviating one or more symptom(s) of cancer, such as liver cancer, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating a metabolic disorder, preferably a diabetes and/or obesity.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity.
  • a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating cancer, preferably liver cancer.
  • Metabolic disorders include metabolic syndrome, diabetes, obesity, obesity-related comorbidities, diabetes-related comorbidities, hyperglycaemia, insulin resistance, glucose intolerance, hepatic steatosis, alcoholic liver diseases (ALD), non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), coronary heart disease (CHD), hyperlipidemia, atherosclerosis, endocrinophaties, osteosarcopenic obesity syndrome (OSO), diabetic nephropaty, chronic kidney disease (CKD), cardiac hypertrophy, diabetic retinopathy, diabetic nephropathy, diabetic neuropathy, arthritis, sepsis, ocular neovascularization, neurodegeneration, dementia, and may also include depression, adenoma, carcinoma.
  • ALD alcoholic liver diseases
  • NAFLD non-alcoholic fatty liver disease
  • NASH non-alcoholic steatohepatitis
  • CVD coronary heart disease
  • CHD hyperlipidemia
  • Diabetes includes prediabetes, hyperglycaemia, Type 1 diabetes, Type 2 diabetes, maturity-onset diabetes of the young (MODY), monogenic diabetes, neonatal diabetes, gestational diabetes, brittle diabetes, idiopathic diabetes, drug- or chemical-induced diabetes, Stiff-man syndrome, lipoatrophic diabetes, latent autoimmune diabetes in adults (LADA).
  • MODY maturity-onset diabetes of the young
  • monogenic diabetes neonatal diabetes
  • gestational diabetes gestational diabetes
  • brittle diabetes idiopathic diabetes
  • drug- or chemical-induced diabetes Stiff-man syndrome
  • lipoatrophic diabetes latent autoimmune diabetes in adults
  • Obesity includes overweight, central/upper body obesity, peripheral/lower body obesity, morbid obesity, osteosarcopenic obesity syndrome (OSO), pediatric obesity, Mendelian (monogenic) syndromic obesity, Mendelian non-syndromic obesity, polygenic obesity. Metabolic disorders, diabetes, obesity and the type of subject treated have been earlier defined herein.
  • Liver inflammation and/or fibrosis includes automimmune hepatitis, viral hepatitis including hepatitis A, B, C, D and E, alcoholic hepatitis, non-alcoholic steatohepatitis (NASH) and liver cirrhosis.
  • Cancer includes astrocytoma, glioma, leukemia, lymphoma, melanoma, myeloma, neuroblastoma, sarcoma (including chondrosarcoma, fibrosarcoma, rhabdomyoscaroma, and osteosarcoma), schwannoma, seminoma, and carcinomas of the bladder, breast, cervix, colon, endometrium, esophagus, gallbladder, kidney, liver, lung, ovary, prostate, pancreas, rectum, skin, stomach and thyroid.
  • a preferred cancer is liver cancer, preferably hepatocellular carcinoma.
  • said method or use is performed in vitro, for instance using a cell culture.
  • said method or use is in vivo.
  • a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for treating liver inflammation and/or fibrosis.
  • a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for extending healthy lifespan.
  • a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for treating cancer, preferably liver cancer.
  • a treatment in a use or in a method according to the invention does not have to be repeated.
  • said administration of the viral expression construct or of said composition may be repeated each year or each 2, 3, 4, 5, 6 years.
  • a protein fragment or a polypeptide or a peptide or a derived peptide as Fibroblast growth factor 21 is represented by an amino acid sequence.
  • nucleic acid molecule as a nucleic acid molecule encoding a FGF21 is represented by a nucleic acid or nucleotide sequence which encodes a protein fragment or a polypeptide or a peptide or a derived peptide.
  • a nucleic acid molecule may comprise a regulatory region.
  • each nucleic acid molecule or protein fragment or polypeptide or peptide or derived peptide or construct as identified herein by a given Sequence Identity Number is not limited to this specific sequence as disclosed.
  • Each coding sequence as identified herein encodes a given protein fragment or polypeptide or peptide or derived peptide or construct or is itself a protein fragment or polypeptide or construct or peptide or derived peptide.
  • SEQ ID NO see SEQ ID NO: X as example
  • nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: X;
  • nucleotide sequence the sequence of which differs from the sequence of a nucleic acid molecule of (i) due to the degeneracy of the genetic code;
  • nucleotide sequence that encodes an amino acid sequence that has at least 60% amino acid identity or similarity with an amino acid sequence encoded by a nucleotide sequence SEQ ID NO: X.
  • each nucleotide sequence or amino acid sequence described herein by virtue of its identity or similarity percentage (at least 60%) with a given nucleotide sequence or amino acid sequence respectively has in a further preferred embodiment an identity or a similarity of at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more identity or similarity with the given nucleotide or amino acid sequence respectively.
  • sequence identity or similarity is determined by comparing the whole length of the sequences as identified herein. Unless otherwise indicated herein, identity or similarity with a given SEQ ID NO means identity or similarity based on the full length of said sequence (i.e. over its whole length or as a whole).
  • Each non-coding nucleotide sequence i.e. of a promoter or of another regulatory region
  • a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with a specific nucleotide sequence SEQ ID NO (take SEQ ID NO: A as example).
  • a preferred nucleotide sequence has at least 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: A. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained herein.
  • such non-coding nucleotide sequence such as a promoter exhibits or exerts at least an activity of such a non-coding nucleotide sequence such as an activity of a promoter as known to the skilled person.
  • Similarity between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide.
  • Identity and “similarity” can be readily calculated by known methods, including but not limited to those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H.
  • Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Preferred computer program methods to determine identity and similarity between two sequences include e.g. the GCG program package (Devereux, J., et al, Nucleic Acids Research 12 (1): 387 (1984)), BestFit, BLASTP, BLASTN, and FASTA (Altschul, S. F. et al, J. Mol. Biol. 215:403-410 (1990).
  • Preferred conservative amino acids substitution groups are: valine - leucine-isoleucine, phenylalanine -tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
  • Substitutional variants of the amino acid sequence disclosed herein are those in which at least one residue in the disclosed sequences has been removed and a different residue inserted in its place.
  • the amino acid change is conservative.
  • Preferred conservative substitutions for each of the naturally occurring amino acids are as follows: Ala to Ser; Arg to Lys; Asn to Gin or His; Asp to Glu; Cys to Ser or Ala; Gin to Asn; Glu to Asp; Gly to Pro; His to Asn or Gin; He to Leu or Val; Leu to He or Val; Lys to Arg; Gin or Glu; Met to Leu or He; Phe to Met, Leu or Tyr; Ser to Thr; Thr to Ser; Trp to Tyr; Tyr to Trp or Phe; and, Val to He or Leu.
  • promoter refers to a nucleic acid fragment that functions to control the transcription of one or more genes (or coding sequence), located upstream with respect to the direction of transcription of the transcription initiation site of the gene, and is structurally identified by the presence of a binding site for DNA-dependent R A polymerase, transcription initiation sites and any other DNA sequences, including, but not limited to transcription factor binding sites, repressor and activator protein binding sites, and any other sequences of nucleotides known to one of skill in the art to act directly or indirectly to regulate the amount of transcription from the promoter.
  • a "constitutive" promoter is a promoter that is active under most physiological and developmental conditions.
  • an “inducible” promoter is a promoter that is regulated depending on physiological or developmental conditions.
  • a “organ-specific” or “tissue-specific” promoter is a promoter that is active in a specific type of organ or tissue, respectively.
  • Organ-specific and tissue-specific promoters regulate expression of one or more genes (or coding sequence) primarily in one organ or tissue, but can allow detectable level (“leaky”) expression in other organs or tissues as well.
  • Leaky expression in other organs or tissues means at least one-fold, at least two-fold, at least three-fold, at least four-fold or at least five-fold lower, but still detectable expression as compared to the organ- specific or tissue-specific expression, as evaluated by standard assays known to the skilled person (e.g.
  • adipose tissue-specific promoter is a promoter that is capable of initiating transcription in the adipose tissue, whilst still allowing for any leaky expression in other (maximum five, six, seven or eight) organs and parts of the body. Transcription in the adipose tissue can be detected in adipose tissue and adipose cells, such as white adipocytes, brown adipocytes, beige adipocytes, preadipocytes, stromal vascular cells.
  • a “liver-specific promoter” is a promoter that is capable of initiating transcription in the liver, whilst still allowing for any leaky expression in other (maximum five, six, seven or eight) organs and parts of the body. Transcription in the liver can be detected in liver tissue and liver cells, such as hepatocytes, Kupffer cells and/or oval cells.
  • a “skeletal muscle promoter” is a promoter that is capable of initiating transcription in skeletal muscle, whilst still allowing for any leaky expression in other (maximum five, six, seven or eight) organs and parts of the body. Transcription in the skeletal muscle can be detected in skeletal muscle cells, such as myocytes, myoblasts, satellite cells.
  • a "ubiquitous promoter” is active in substantially all tissues, organs and cells of an organism.
  • operably linked is defined herein as a configuration in which a control sequence such as a promoter sequence or regulating sequence is appropriately placed at a position relative to the nucleotide sequence of interest, preferably coding for a FGF21 such that the promoter or control or regulating sequence directs or affects the transcription and/or production or expression of the nucleotide sequence of interest, preferably encoding a FGF21 in a cell and/or in a subject.
  • a promoter is operably linked to a coding sequence if the promoter is able to initiate or regulate the transcription or expression of a coding sequence, in which case the coding sequence should be understood as being "under the control of the promoter.
  • An expression construct carries a genome that is able to stabilize and remain episomal in a cell.
  • a cell may mean to encompass a cell used to make the construct or a cell wherein the construct will be administered.
  • a construct is capable of integrating into a cell's genome, e.g. through homologous recombination or otherwise.
  • a particularly preferred expression construct is one wherein a nucleotide sequence encoding a FGF21 as defined herein is operably linked to a promoter as defined herein wherein said promoter is capable of directing expression of said nucleotide sequence ⁇ i.e. coding sequence) in a cell.
  • a FGF21 to be expressed in the liver, adipose tissue or skeletal muscle refers to the preferential or predominant (at least 10% higher, at least 20% higher, at least 30% higher, at least 40% higher, at least 50% higher, at least 60% higher, at least 70% higher, at least 80% higher, at least 90% higher, at least 100% higher, at least 150% higher, at least 200% higher or more) expression of FGF21 in the liver, adipose tissue or skeletal muscle as compared to other organs or tissues.
  • the viral expression constructs of the invention comprise a nucleotide sequence in a form "suitable for expression in a mammal", which means that the viral expression constructs include one or more regulatory sequences, selected on the basis of the mammalian host cells to be used for expression, that is operatively linked to the nucleotide sequence to be expressed.
  • said mammalian host cells to be used for expression are human, murine or canine cells.
  • the viral expression constructs of the invention comprise a nucleotide sequence to be expressed in liver, adipose tissue and/or skeletal muscle.
  • adipose tissue refers to tissue composed of mature adipocytes (i.e. fat cells) and a combination of small blood vessels, nerve tissue, lymph nodes and the stromal vascular fraction (SVF).
  • SVF is composed of endothelial cells, fibroblasts, adipocyte precursor cells (i.e. preadipocytes), and immune cells such as macrophages and T cells.
  • WAT white adipose tissue
  • BAT brown adipose tissue
  • the adipose tissue is contained in a multi-depot organ.
  • Adipose depots include but are not limited to epidydymal WAT (eWAT), inguinal WAT (iWAT), retroperitoneal WAT (rWAT), mesenteric WAT (mWAT), interscapular BAT (iBAT).
  • liver refers to the tissue composed of hepatocytes. Hepatocytes represent about 50-70% of the cells in the liver. In addition to hepatocytes, the liver is composed of endothelial cells, perisinusoidal cells, oval cells, Kupffer cells and stellate cells (Ito cells). When activated by Kupffer cells, the stellate cells transform into myofibroblasts.
  • Central veins and portal tracks (portal triads) that contain preterminal branches of the hepatic artery, the hepatic portal vein, bile ductules and lymphatic vessels are also found in the liver.
  • An expression cassette as used herein comprises or consists of a nucleotide sequence encoding a FGF21 , being operably linked to a promoter wherein said promoter is capable of directing expression of said nucleotide sequence.
  • an expression cassette as used herein comprises or consists of a nucleotide sequence encoding a FGF21 , a promoter and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart.
  • the described expression cassettes contain nucleotide sequences encoding target sequences for a microRNA expressed in the liver and/or a microRNA expressed in the heart with perfect complementarity to their cognate microRNAs.
  • the described expression cassettes contain one or more nucleotide sequence(s) encoding microRNA binding sites with imperfect complementarity (one mismatch/five consecutive nucleotides).
  • the expression cassettes may contain both nucleotide sequences encoding perfect and imperfect microRNA binding sites. Expression cassettes can therefore be tailored to result in varying levels of regulation by using nucleotide sequences encoding single perfect, multiple perfect, single imperfect, multiple imperfect or a combination of perfect and imperfect target sites for microRNAs.
  • nucleotide sequence encoding target sites for different microRNAs may be used, therefore permitting a gene to be regulated by multiple microRNAs.
  • a preferred location for the nucleotide sequence encoding a target sequence of a microRNA is the 3'UTR.
  • nucleotide sequences (encoding target sequences) inserted into either a coding sequence or 5 'UTR sequences may also be used.
  • nucleotide sequence encoding a target sequence of a microRNA is determined by the desired expression pattern.
  • the presence of an endogenous microRNA in a cell will inhibit expression of a gene or coding sequence from an expression construct which contains a nucleotide sequence encoding a target sequence for said microRNA.
  • a nucleotide sequence encoding a target sequence that is recognized by a microRNA present in that cell-type is chosen.
  • a nucleic acid or nucleotide sequence encoding a FGF21 is used in an expression construct or expression vector.
  • expression vector or “vector” generally refers to a nucleotide sequence that is capable of effecting expression of a gene or a coding sequence in a host compatible with such sequences.
  • These expression vectors typically include at least suitable promoter sequences and optionally, transcription termination signals. An additional factor necessary or helpful in effecting expression can also be used as described herein.
  • a nucleic acid or DNA or nucleotide sequence encoding a FGF21 is incorporated into a DNA construct capable of introduction into and expression in an in vitro cell culture.
  • a DNA construct is suitable for replication in a prokaryotic host, such as bacteria, e.g., E. coli, or can be introduced into a cultured mammalian, plant, insect, (e.g., Sf9), yeast, fungi or other eukaryotic cell lines.
  • a DNA construct prepared for introduction into a particular host may include a replication system recognized by the host, an intended DNA segment encoding a desired polypeptide, and transcriptional and translational initiation and termination regulatory sequences operably linked to the polypeptide-encoding segment.
  • operably linked has already been defined herein.
  • a promoter or enhancer is operably linked to a coding sequence if it stimulates the transcription of the sequence.
  • DNA for a signal sequence is operably linked to DNA encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of a polypeptide.
  • a DNA sequence that is operably linked are contiguous, and, in the case of a signal sequence, both contiguous and in reading frame.
  • enhancers need not be contiguous with a coding sequence whose transcription they control. Linking is accomplished by ligation at convenient restriction sites or at adapters or linkers inserted in lieu thereof, or by gene synthesis.
  • an appropriate promoter sequence generally depends upon the host cell selected for the expression of a DNA segment.
  • suitable promoter sequences include prokaryotic, and eukaryotic promoters well known in the art (see, e.g. Sambrook and Russell, 2001, supra).
  • a transcriptional regulatory sequence typically includes a heterologous enhancer or promoter that is recognised by the host.
  • the selection of an appropriate promoter depends upon the host, but promoters such as the trp, lac and phage promoters, tRNA promoters and glycolytic enzyme promoters are known and available (see, e.g. Sambrook and Russell, 2001, supra).
  • An expression vector includes the replication system and transcriptional and translational regulatory sequences together with the insertion site for the polypeptide encoding segment.
  • suitable expression vectors can be expressed in, yeast, e.g. S.cerevisiae, e.g., insect cells, e.g., Sf9 cells, mammalian cells, e.g., CHO cells and bacterial cells, e.g., E. coli.
  • yeast e.g. S.cerevisiae
  • insect cells e.g., Sf9 cells
  • mammalian cells e.g., CHO cells
  • bacterial cells e.g., E. coli.
  • a cell may thus be a prokaryotic or eukaryotic host cell.
  • a cell may be a cell that is suitable for culture in liquid or on solid media.
  • a host cell is a cell that is part of a multicellular organism such as a transgenic plant or animal.
  • a viral vector or a viral gene therapy vector is a vector that comprises a viral expression construct as defined above.
  • a viral vector or a viral gene therapy vector is a vector that is suitable for gene therapy.
  • Vectors that are suitable for gene therapy are described in Anderson 1998, Nature 392: 25-30; Walther and Stein, 2000, Drugs 60: 249-71; Kay et al, 2001, Nat. Med. 7: 33-40; Russell, 2000, J. Gen. Virol. 81 : 2573-604; Amado and Chen, 1999, Science 285: 674- 6; Federico, 1999, Curr. Opin. Biotechnol.10: 448-53; Vigna and Naldini, 2000, J. Gene Med. 2: 308-16; Marin et al, 1997, Mol. Med. Today 3: 396-403; Peng and Russell, 1999, Curr. Opin. Biotechnol. 10: 454-7; Sommerfelt, 1999, J. Gen. Virol. 80: 3049-64; Reiser, 2000, Gene Ther. 7: 910-3; and references cited therein.
  • adenoviral vectors are modified to reduce the host response as reviewed by Russell (2000, supra).
  • Method for gene therapy using AAV vectors are described by Wang et al, 2005, J Gene Med. March 9 (Epub ahead of print), Mandel et al, 2004, Curr Opin Mol Ther. 6(5):482-90, and Martin et al, 2004, Eye 18(11): 1049-55, Nathwani et al, N Engl J Med. 2011 Dec 22;365(25):2357- 65, Apparailly et al, Hum Gene Ther. 2005 Apr;16(4):426-34.
  • a suitable gene therapy vector includes a retroviral vector.
  • a preferred retroviral vector for application in the present invention is a lentiviral based expression construct. Lentiviral vectors have the ability to infect and to stably integrate into the genome of dividing and non-dividing cells (Amado and Chen, 1999 Science 285: 674-6). Methods for the construction and use of lentiviral based expression constructs are described in U.S. Patent No.'s 6,165,782, 6,207,455, 6,218,181, 6,277,633 and 6,323,031 and in Federico (1999, Curr Opin Biotechnol 10: 448-53) and Vigna et al (2000, J Gene Med 2000; 2: 308-16).
  • Suitable gene therapy vectors include an adenovirus vector, a herpes virus vector, a polyoma virus vector or a vaccinia virus vector.
  • a gene therapy vector comprises a nucleotide sequence encoding a FGF21 to be expressed, whereby said nucleotide sequence is operably linked to the appropriate regulatory sequences.
  • Such regulatory sequence will at least comprise a promoter sequence.
  • Suitable promoters for expression of a nucleotide sequence encoding a FGF21 from a gene therapy vector include e.g.
  • CMV promoter viral long terminal repeat promoters (LTRs), such as those from murine moloney leukaemia virus (MMLV) rous sarcoma virus, or HTLV-1, the simian virus 40 (SV 40) early promoter, the CAG promoter, the a 1 -antitrypsin promoter, the mini/aP2 promoter, the mini/UCPl promoter, the C5-12 promoter and the herpes simplex virus thymidine kinase promoter.
  • LTRs viral long terminal repeat promoters
  • MMLV murine moloney leukaemia virus
  • HTLV-1 HTLV-1
  • SV 40 simian virus 40
  • tTAER system that is based on the multi-chimeric transactivator composed of a tetR polypeptide, as activation domain of VP 16, and a ligand binding domain of an estrogen receptor (Yee et al, 2002, US 6,432,705).
  • a gene therapy vector may optionally comprise a further nucleotide sequence coding for a further polypeptide.
  • a gene therapy vector is preferably formulated in a composition or pharmaceutical composition as defined herein.
  • a composition or pharmaceutical composition may comprise a suitable pharmaceutical carrier as earlier defined herein.
  • Adeno-associated virus vector AAV vector
  • Preferred ITRs are those of AAV2 which are represented by sequences comprising or consisting of SEQ ID NO: 48 (5 ' ITR) and SEQ ID NO: 49 (3' ITR).
  • the invention also preferably encompasses the use of a sequence having at least 80% (or at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identity with SEQ ID NO: 48 as 5 'ITR and a sequence having at least 80% identity with SEQ ID NO: 49 as 3 'ITR.
  • Protein shell comprised of capsid protein may be derived from an AAV serotype such as AAV1 , 2, 3, 4, 5 and others.
  • a preferred AAV capsid is an AAV1 , AAV3, AAV8, AAV9 capsid.
  • a preferred ITR is from the AAV2.
  • a protein shell may also be named a capsid protein shell.
  • rAAV vector may have one or preferably all wild type AAV genes deleted, but may still comprise functional ITR nucleic acid sequences. Functional ITR sequences are necessary for the replication, rescue and packaging of AAV virions.
  • the ITR sequences may be wild type sequences or may have at least 80%>, 85%, 90%>, 95%, 97%, 98%), 99% or 100% sequence identity with wild type sequences or may be altered by for example in insertion, mutation, deletion or substitution of nucleotides, as long as they remain functional.
  • functionality refers to the ability to direct packaging of the genome into the capsid shell and then allow for expression in the host cell to be infected or target cell.
  • a capsid protein shell may be of a different serotype than the rAAV vector genome ITR.
  • AAV helper functions generally refers to the corresponding AAV functions required for rAAV replication and packaging supplied to the rAAV vector in trans.
  • AAV helper functions complement the AAV functions which are missing in the rAAV vector, but they lack AAV ITRs (which are provided by the rAAV vector genome).
  • AAV helper functions include the two major ORFs of AAV, namely the rep coding region and the cap coding region or functional substantially identical sequences thereof. Rep and Cap regions are well known in the art, see e.g. Chiorini et al. (1999, J. of Virology, Vol 73(2): 1309-1319) or US 5,139,941, incorporated herein by reference.
  • a “transgene” is herein defined as a gene or a coding sequence or a nucleic acid molecule (i.e. a molecule encoding a FGF21) that has been newly introduced into a cell, i.e. a gene that may be present but may normally not be expressed or expressed at an insufficient level in a cell.
  • "insufficient” means that although said FGF21 is expressed in a cell, a condition and/or disease as defined herein could still be developed.
  • the invention allows the over-expression of a FGF21.
  • the transgene may comprise sequences that are native to the cell, sequences that naturally do not occur in the cell and it may comprise combinations of both.
  • a transgene may contain sequences coding for a FGF21 and/or additional proteins as earlier identified herein that may be operably linked to appropriate regulatory sequences for expression of the sequences coding for a FGF21 in the cell.
  • the transgene is not integrated into the host cell's genome.
  • Transduction refers to the delivery of a FGF21 into a recipient host cell by a viral vector.
  • transduction of a target cell by a rAAV vector of the invention leads to transfer of the rAAV genome contained in that vector into the transduced cell.
  • Home cell or “target cell” refers to the cell into which the DNA delivery takes place, such as the muscle cells of a subject.
  • AAV vectors are able to transduce both dividing and non- dividing cells.
  • the rAAV genome present in a rAAV vector comprises at least the nucleotide sequences of the inverted terminal repeat regions (ITRs) of one of the AAV serotypes (preferably the ones of serotype AAV2 as disclosed earlier herein), or nucleotide sequences substantially identical thereto or nucleotide sequences having at least 60% identity thereto, and nucleotide sequence encoding a FGF21 (under control of a suitable regulatory element) inserted between the two ITRs.
  • ITRs inverted terminal repeat regions
  • the complete genome of several AAV serotypes and corresponding ITR has been sequenced (Chiorini et al. 1999, J. of Virology Vol. 73, No.2, pl309-1319). They can be either cloned or made by chemical synthesis as known in the art, using for example an oligonucleotide synthesizer as supplied e.g. by Applied Biosystems Inc. (Fosters, CA, USA) or by standard molecular biology techniques.
  • the ITRs can be cloned from the AAV viral genome or excised from a vector comprising the AAV ITRs.
  • the ITR nucleotide sequences can be either ligated at either end to the nucleotide sequence encoding one or more therapeutic proteins using standard molecular biology techniques, or the AAV sequence between the ITRs can be replaced with the desired nucleotide sequence.
  • the rAAV genome as present in a rAAV vector does not comprise any nucleotide sequences encoding viral proteins, such as the rep (replication) or cap (capsid) genes of AAV.
  • This rAAV genome may further comprise a marker or reporter gene, such as a gene for example encoding an antibiotic resistance gene, a fluorescent protein ⁇ e.g. gfp) or a gene encoding a chemically, enzymatically or otherwise detectable and/or selectable product ⁇ e.g. lacZ, aph, etc.) known in the art.
  • the rAAV genome as present in said rAAV vector further comprises a promoter sequence operably linked to the nucleotide sequence encoding a FGF21.
  • Preferred promoter sequences are promoters which confer expression in skeletal muscle cells and/or skeletal muscle, in liver cells and/or liver and in adipose cells and /or adipose tissue. Examples of such promoters include a CMV, a CAG, a mini/aP2, a mini/UCPl, a C5-12 and a hAAT promoter as earlier defined herein.
  • Codon optimization refers to the processes employed to modify an existing coding sequence, or to design a coding sequence, for example, to improve translation in an expression host cell or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence.
  • Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism. For example, to suit the codon preference of mammalians, preferably of murine, canine or human expression hosts. Codon optimization also eliminates elements that potentially impact negatively RNA stability and/or translation (e. g. termination sequences, TATA boxes, splice sites, ribosomal entry sites, repetitive and/or GC rich sequences and RNA secondary structures or instability motifs).
  • indefinite article “a” or “an” does not exclude the possibility that more than one of the element is present, unless the context clearly requires that there be one and only one of the elements.
  • the indefinite article “a” or “an” thus usually means “at least one”.
  • FIG. 1 Prevention of obesity by intra-eWAT administration of AAV9-CAG- moFGF21-dmiRT vectors in C57B16 mice.
  • A Schematic representation of the AAV- CAG-moFGF21-doublemiRT vectors.
  • the expression cassette contained the CAG promoter, a murine codon-optimized FGF21 coding sequence and four tandem repeats of the miRT122a sequence and four tandems repeats of the miRTl sequence cloned in the 3' untranslated region of the expression cassette. ITRs from AAV2 flanked the expression cassette.
  • the schematic representation is not to scale.
  • CAG chicken ⁇ -actin promoter/CMV enhancer; pA: polyA.
  • B Expression levels of FGF21 in metabolic tissues.
  • D-E Expression levels of FGF21R1 (D) and ⁇ -Klotho (E) in metabolic tissues.
  • (F) Body weight evolution. Body weight was measured weekly (n 8-11 animals/group). (G) Representative image of animals.
  • FIG. 1 Histological analysis of adipose tissue and liver of C57B16 mice treated intra-eWAT with AAV9-CAG-moFGF21-doublemiRT vectors.
  • A Representative images of sections stained with hematoxylin and eosin of epididymal white adipose tissue (eWAT), inguinal white adipose tissue (iWAT) interscapular brown adipose tissue (iBAT) and liver of chow- and HFD-fed C57B16 mice treated intra-eWAT with AAV9- CAG-moFGF21-doublemiRT or AAV9-CAG-null vectors.
  • Original magnification XI 00 Original magnification XI 00.
  • UCP1 UCP1
  • Dio2 B.
  • the expression levels of the murine codon-optimized FGF21 coding sequence were measured by RTqPCR in eWAT, iWAT, iBAT and liver of ob/ob mice, and normalized with RplpO values
  • B Circulating levels of FGF21.
  • C-D Body weight
  • D body weight gain
  • Body weight was measured weekly.
  • E Weight of tissues. Weight of eWAT, iWAT, rWAT, mWAT, iBAT and liver of ob/ob mice treated intra-eWAT with AAV vectors.
  • eWAT epididymal white adipose tissue.
  • iWAT inguinal white adipose tissue.
  • rWAT retroperitoneal white adipose tissue.
  • mWAT mesenteric white adipose tissue.
  • FIG. 5 Improved insulin sensitivity in ob/ob mice treated intra-eWAT with AAV8-CAG-moFGF21-doublemiRT vectors.
  • A Intraperitoneal insulin tolerance test. Ob/ob mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 9 weeks post-AAV administration.
  • FIG. 1 Schematic representation of AAV-hAAT-moFGF21 vectors.
  • the expression cassette contained the human a 1 -antitrypsin (hAAT) promoter and a murine codon-optimized FGF21 coding sequence. ITRs from AAV2 flanked the expression cassette. The schematic representation is not to scale.
  • pA polyA.
  • B Expression levels of FGF21. The expression levels of the murine codon-optimized FGF21 coding sequence were measured by RTqPCR in the liver of ob/ob mice, and normalized with RplpO values.
  • C Circulating levels of FGF21.
  • D-E Body weight (C) and body weight gain (D) evolution. Body weight was measured weekly.
  • H Intraperitoneal insulin tolerance test. Ob/ob mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 9 weeks post-AAV administration.
  • FIG. 7 Long-term reversion of obesity by intravenous administration of AAV- h AAT-moFGF21 vectors in HFD-fed C57bl6 mice.
  • A Circulating levels of FGF21.
  • FIG. 8 Long-term increased energy expenditure and insulin sensitivity by intravenous administration of AAV-hAAT-moFGF21 vectors in HFD-fed C57B16 mice.
  • A Energy metabolism. The energy expenditure (EE) was measured with indirect open circuit calorimeter. Oxygen consumption and carbon dioxide production were monitored simultaneously. Data were taken 4 weeks post-AAV administration during the light cycle (basal state) and dark cycle (activity phase) and adjusted for body weight.
  • B Intraperitoneal insulin tolerance test. C57B16 mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 7 weeks post-AAV administration.
  • C Fasted and fed insulin circulating levels.
  • FIG. 9 Reversion of obesity by intravenous administration of AAV-hAAT- moFGF21 vectors in old HFD-fed mice.
  • A Circulating levels of FGF21.
  • FIG. 10 Increased energy expenditure and insulin sensitivity by intravenous administration of AAV-hAAT-moFGF21 vectors in old HFD-fed mice.
  • A Energy metabolism. The energy expenditure (EE) was measured with indirect open circuit calorimeter. Oxygen consumption and carbon dioxide production were monitored simultaneously. Data were taken 6 weeks post-AAV administration during the light cycle (basal state) and dark cycle (activity phase) and adjusted for body weight.
  • B Intraperitoneal insulin tolerance test. Old C57B16 mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 9 weeks post-AAV administration.
  • C Fasted and fed insulin circulating levels.
  • FIG. 11 Body weight loss by intramuscular administration of AAV-CMV- moFGF21 vectors in C57B16 mice.
  • A Schematic representation of the AAV-CMV- moFGF21 vectors. The expression cassette contained the cytomegalovirus (CMV) promoter and a murine codon-optimized FGF21 coding sequence. ITRs from AAV2 flanked the expression cassette. The schematic representation is not to scale.
  • pA polyA.
  • B Circulating FGF21 levels.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • FIG. 12 Increased FGF21 protein production by codon-optimization of nucleotide sequences encoding human FGF21.
  • A,B Representative images of the hematoxylin-eosin staining of (A) eWAT and (B) liver tissue sections obtained from ob/ob animals injected intra-eWAT either null or FGF21 -encoding AAV8 vectors at all doses tested. Scale bars: 100 ⁇ for eWAT and 200 ⁇ for liver.
  • FGF21 labels in the figure refer to moFGF21.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Data information: All values are expressed as mean ⁇ SEM. In (A, B, D) n 4-8 animals/group. *P ⁇ 0.05, **P ⁇ 0.01 and ***P ⁇ 0.001 versus null-injected ob/ob group.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Data information: All data represent the mean ⁇ SEM. In (A-C, E, G-H) n 9-10 animals/group. *P ⁇ 0.05, **P ⁇ 0.01 and ***P ⁇ 0.001 versus null-injected ob/ob group.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • AAV8-hAAT-moFGF21 treatment increases the expression of genes involved in glucose uptake and thermogenesis in adipose tissue of ob/ob mice.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • FIG. 1 AAV8-mediated liver gene transfer of FGF21 counteracts HFD-induced obesity.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Data information: All values are expressed as mean ⁇ SEM. In (A-D) « 7-10 animals/group. *P ⁇ 0.05, **P ⁇ 0.01 and ***P ⁇ 0.001 versus the chow-fed Null-injected group. ⁇ 0.05, ⁇ 0.01 and ⁇ 0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
  • FIG. 19 FGF21 gene transfer to the liver counteracts HFD-induced obesity.
  • A B Representative images of animals belonging to all experimental groups of the studies performed in young adults (A) or in adults (B).
  • the qPCR was performed with primers that specifically detected the codon-optimized murine FGF21 (coFGF21) coding sequence.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Figure 21 Energy expenditure 10 months after gene transfer to the liver.
  • a Energy expenditure was measured 10 months after AAV8-hAAT-null or AAV8- hAAT-moFGF21 vector delivery in the cohort of animals that initiated HFD- feeding at 2 months of age. Data were taken during the light and dark cycles.
  • a representative immunoblot is shown ⁇ left).
  • the graph shows the densitometric analysis of two different immunoblots ⁇ right).
  • Figure 22 AAV8-hAAT-moFGF21 -mediated reversal of islet hyperplasia.
  • FGF21 vectors as adults are the FGF21 vectors as adults.
  • FIG. 23 Treatment with AAV8-hAAT-moFGF21 improves glucose tolerance.
  • a Glucose tolerance was studied in the group of mice that initiated the HFD feeding and received FGF21 vectors as young adults after an intraperitoneal injection of glucose (2 g/kg body weight).
  • FIG. 24 Reversal of WAT hypertrophy and inflammation by AAV8-hAAT- moFGF21 treatment.
  • FIG. 26 Treatment with FGF21-encoding vectors reverses hepatic steatosis and inflammation.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Figure 27 AAV8-hAAT-moFGF21 -mediated amelioration of liver fibrosis.
  • FIG. 28 AAV8-hAAT-moFGF21 treatment improves liver fibrosis.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • FIG. 29 No bone abnormalities were observed in AAV8-hAAT-moFGF21-treated animals.
  • the long-term effects of FGF21 gene transfer on bones were studied by comparison of HFD-fed mice treated with the highest dose (5xl0 10 vg/mouse) of AAV8- hAAT-moFGF21 vectors as young adults or adults with null-injected, chow or HFD-fed animals.
  • C-0 Micro-computed tomography ⁇ CT) analysis of the epiphysis (C-J) and the diaphysis (K-O) of tibiae obtained at the time of sacrifice, i.e. when animals were 18 months of age, from HFD-fed mice administered with either null or FGF21- encoding AAV vectors.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • A, P-Q) n 7- 10 animals/group.
  • HFD High-fat diet
  • BMD bone mineral density
  • BMC bone mineral content
  • BV bone volume
  • BV/TV bone volume/tissue volume ratio
  • BS/BV bone surface/bone volume ratio
  • Tb.N trabecular number
  • Tb.Th trabecular thickness
  • Tb.Sp trabecular separation.
  • FIG. 30 Analysis of glycaemic profiles in C57B16 mice treated with AAV8-hAAT- moFGF21 vectors. Blood glucose levels were evaluated under fed conditions.
  • STZ treatment with streptozotocin (5x50mg/kg). Results shown are means + SEM. * p ⁇ 0.05; *** p ⁇ 0.001 vs AAV8-hAAT-Null.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Figure 31 Gene transfer of FGF21 to the skeletal muscle of healthy animals.
  • a Circulating levels of FGF21 measured 40 weeks after injection of 3xl0 n vg/mouse of either AAVl-CMV-Null or AAVl-CMV-moFGF21 vectors to the skeletal muscle of healthy animals fed a chow diet.
  • Insulin sensitivity assessed through intraperitoneal injection of insulin (0.75 units/kg body weight) and represented as percentage of initial blood glucose.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Figure 32 AAVl-mediated skeletal muscle gene transfer of FGF21 counteracts HFD-induced obesity and insulin resistance.
  • A B Evolution of body weight (A) and body weight gain (B) in animals treated with AAVl-CMV-moFGF21.
  • C57B16 mice were fed a HFD for -12 weeks and then administered with 3xl0 u vg/mouse of AAVl -CMV-moFGF21 vectors.
  • Control obese mice and control chow-fed mice received 3xl0 u vg of AAVl-CMV-null.
  • C Circulating levels of FGF21 at different time-points after vector administration.
  • D E Fasted blood glucose (D) and fed serum insulin (E) levels in the same groups of animals as in (A, B).
  • Insulin sensitivity was determined in all experimental groups after an intraperitoneal injection of insulin (0.75 units/kg body weight). Results were calculated as the percentage of initial blood glucose levels.
  • FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
  • Data information All values are expressed as mean ⁇ SEM.
  • FIG. 34 In vitro increased FGF21 expression levels by hAAT-moFGF21, CAG- moFGF21-doublemiRT and CMV-moFGF21 expression cassettes.
  • A Expression levels of FGF21 in HEK293 cells transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21) or of the CAG promoter in conjunction with four tandem repeats of the miRT122a sequence and four tandems repeats of the miRTl sequence (CAG-moFGF21 -doublemiRT).
  • B and C Intracellular FGF21 protein content (B) and FGF21 protein levels in the culture medium (C) in the same cells as in (A).
  • D Expression levels of FGF21 in C2C12 cells transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EF 1 a promoter (EF 1 a-mFGF21 ) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21).
  • FIG. 35 In vivo increased hepatic FGF21 expression and FGF21 circulating levels by hAAT-moFGF21 and CMV-moFGF21 expression cassettes.
  • A Expression levels of FGF21 in the liver of C57B16 mice hydrodynamically administered with plasmids encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21) or the hAAT promoter (hAAT-moFGF21).
  • EFla elongation factor la
  • CMV-moFGF21 CMV promoter
  • hAAT-moFGF21 hAAT-moFGF21
  • FIG. 36 In vivo increased hepatic FGF21 expression and FGF21 circulating levels by AAV8-h AAT-moFGF21.
  • A Expression levels of FGF21 in the liver of C57B16 mice intravenously administered with lxlO 10 vg, 2xl0 10 vg or 5xl0 10 vg of AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (AAV8-fiAAT- moFGF21).
  • EFla elongation factor la
  • AAV8-fiAAT- moFGF21 a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter
  • FIG. 37 In vivo increased adipose FGF21 expression by AAV8-CAG-moFGF21- dmiRT.
  • A-B Expression levels of FGF21 in the eWAT (A) or the liver (B) of C57B16 mice administered intra-eWAT with 2x10 10 vg, 5xl0 10 vg or lxlO 11 vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CAG promoter in conjunction with four tandem repeats of the miRT122a sequence and four tandems repeats of the miRTl sequence (AAV8-CAG-moFGF21-doublemiRT).
  • EFla elongation factor la
  • FIG 38 In vivo increased FGF21 expression in the skeletal muscle by AAV1- CMV-moFGF21.
  • A-B Expression levels of FGF21 in the quadriceps (A) or the liver (B) of C57B16 mice administered intramuscularly with 5xl0 10 vg, lxlO 11 vg or 3xl0 n vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV1 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (AAV1-CMV-FGF21).
  • EFla elongation factor la
  • AAV8-EFla-mFGF21 AAV1 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter
  • mice Male C57B1/6J mice and B6.V-Zep°*/01aHsd (ob/ob) mice were used. Mice were fed ad libitum with a standard diet (2018S Teklad Global Diets®, Harlan Labs., Inc., Madison, WI, US) or a high fat diet (TD.88137 Harlan Teklad Madison, WI, US ) and kept under a light-dark cycle of 12 h (lights on at 8:00 a.m.) and stable temperature (22°C ⁇ 2).
  • a standard diet 2018S Teklad Global Diets®, Harlan Labs., Inc., Madison, WI, US
  • TD.88137 Harlan Teklad Madison, WI, US high fat diet
  • mice were anesthetized by means of inhalational anesthetic isoflurane (IsoFlo®, Abbott Laboratories, Abbott Park, IL, US) and decapitated. Tissues of interest were excised and kept at -80°C or with formalin until analysis. All experimental procedures were approved by the Ethics Committee for Animal and Human Experimentation of the Universitat Autonoma de Barcelona. Recombinant AAV vectors
  • Single-stranded AAV vectors of serotype 1 , 8 or 9 were produced by triple transfection of HEK293 cells according to standard methods (Ayuso, E. et al, 2010. Curr Gene Ther. 10(6 ⁇ :423-36).
  • Cells were cultured in 10 roller bottles (850 cm 2 , flat; CorningTM, Sigma- Aldrich Co., Saint Louis, MO, US) in DMEM 10% FBS to 80% confluence and co- transfected by calcium phosphate method with a plasmid carrying the expression cassette flanked by the AAV2 ITRs, a helper plasmid carrying the AAV2 rep gene and the AAV of serotypes 1, 8 or 9 cap gene, and a plasmid carrying the adenovirus helper functions.
  • Transgenes used were: murine, canine or human codon-optimized or wt FGF21 coding- sequence driven by 1) the cytomegalovirus (CMV) early enhancer/chicken beta actin (CAG) promoter with the addition of four tandem repeats of the miRT122a sequence (5 'CAAACACCATTGTCACACTCCA3 ') (SEQ ID NO: 12) and four tandems repeats of the miRTl sequence (5 'TTACATACTTCTTTACATTCCA3 ') (SEQ ID NO: 13) cloned in the 3 ' untranslated region of the expression cassette; 2) the CMV promoter; or 3) the human a 1 -antitrypsin promoter (hAAT).
  • CMV cytomegalovirus
  • CAAG cytomegalovirus
  • Noncoding plasmids carrying the CAG, hAAT or CMV promoters were used to produce null vectors.
  • AAV were purified with an optimized method based on a polyethylene glycol precipitation step and two consecutive cesium chloride (CsCl) gradients. This second-generation CsCl-based protocol reduced empty AAV capsids and DNA and protein impurities dramatically (Ayuso, E. et al, 2010. Curr Gene Ther. 10(6):423-36).
  • Purified AAV vectors were dialyzed against PBS, filtered and stored at -80°C.
  • Titers of viral genomes were determined by quantitative PCR following the protocol described for the AAV2 reference standard material using linearized plasmid DNA as standard curve (Lock M, et al, Hum. Gene Ther. 2010; 21 : 1273-1285).
  • the vectors were constructed according to molecular biology techniques well known in the art.
  • mice were anesthetized with an intraperitoneal injection of ketamine (100 mg/kg) and xylazine (10 mg/kg).
  • a laparotomy was performed in order to expose the epididymal white adipose tissue.
  • AAV vectors were resuspended in PBS with 0.001% Pluronic® F68 (Gibco) and injected directly into the epididymal fat pad.
  • Each epididymal fat pad was injected twice with 50 ⁇ of the AAV solution (one injection close to the testicle and the other one in the middle of the fat pad).
  • the abdomen was rinsed with sterile saline solution and closed with a two-layer approach.
  • the appropriate amount of the AAV solution was diluted in 200 of PBS with 0.001% Pluronic® and was manually injected into the lateral tail vein without exerting pressure at the moment of delivery.
  • the animals were put under a 250 W infrared heat lamp (Philips NV, Amsterdam, NL) for a few minutes to dilate the blood vessels and facilitate viewing and easier access to the tail vein.
  • a plastic restrainer Harvard Apparatus, Holliston, MA, US was used to secure the animal for injection. No anesthesia was used since an appropriate restraining device was employed.
  • a 30-gauge needle was utilized to inject the animals.
  • mice were anesthetized with an intraperitoneal injection of ketamine (100 mg/kg) and xylazine (10 mg/kg).
  • Hind limbs were shaved and vectors were administered by intramuscular injection in a total volume of 180 ⁇ divided into six injection sites distributed in the quadriceps, gastrocnemius, and tibialis cranealis of each hind limb.
  • Tissues were fixed for 24 h in formalin (Panreac Quimica), embedded in paraffin, and sectioned. Tissue samples were stained with hematoxylin-eosin. Adipocyte area was determined in 12 hematoxylin/eosin WAT images per animal taken at 10 X with the Nikon Eclipse E800 microscope (Nikon, Tokyo, Japan) connected to a videocamera with a monitor with an image analysis software (analySIS 3.0; Soft Imaging System, Center Valley, PA, EEUU) and each adipocyte area was quantified in ⁇ 2 . Mean adipocyte area was calculated for each experimental group and distribution of adipocytes according to size categories was represented in a histogram. Four animals per group were used and at least 250 adipocytes per animal were analyzed.
  • ThermoFisher goat anti-guinea pig IgG (Alexa Fluor 488-conjugated) (1 :300; Al 1073;
  • ThermoFisher or rabbit anti-guinea pig coupled to peroxidase (1 :300; P0141; Dako) were used as secondary antibodies.
  • the ABC peroxidase kit (Pierce) was used for immunodetection, and sections were counterstained in Mayer's hematoxylin. Hoechst
  • PicroSirius Red staining and Masson's trichrome staining were used to evaluate fibrosis.
  • RNA analysis The percentage of ⁇ -cell area in the pancreas was analyzed in two insulin-stained sections 200 ⁇ apart, by dividing the area of all insulin+ cells in one section by the total pancreas area of that section, ⁇ -cell mass was calculated by multiplying pancreas weight by percentage of ⁇ -cell area, as previously described (Jimenez et al, 2011).
  • Qiagen NV agen NV
  • Tripure isolation reagent Roche Diagnostics Corp., Indianapolis, IN, US
  • RNeasy Lipid Tissue Minikit Qiagen NV, Venlo, NL
  • DNAsel Qiagen NV, Venlo, NL
  • the aqueous superior phase was eliminated using a Pasteur pipet and 1 ml of the inferior lipid phase was recuperated in a glass tube.
  • 1 ml of a chloroform and Triton X- 100 at 1 % solution was added to the glass tube and it was incubated at 90° C in a bath, to evaporate the chloroform.
  • chloroform and Triton X-100 mix any remaining aquous particle was eliminated from the lipid phase.
  • chloroform was rinsed to the walls of the tube to concentrate the sample and, it was warmed again at 90° C to evaporate the chloroform.
  • Glycemia was determined using a Glucometer EliteTM (Bayer). Glucagon levels were measured using a glucagon Radioimmunoassay (#GL-32K, EMD Millipore). Adiponectin, leptin, IGFBP1 and IGF1 were determined using the Mouse Adiponectin ELISA kit (80569, Crystal Chem), the Mouse Leptin ELISA kit (90030, Crystal Chem), the IGFBP1 (Mouse) ELISA kit (KA3054, Abnova) and the m/r IGF-I-ELISA kit (E25, Mediagnost), respectively.
  • Glucose tolerance test For insulin tolerance tests, insulin (0.75 IU/kg body wt; Humulin Regular; Eli Lilly, Indianapolis, IN) was injected intraperitoneally into awake fed mice. Glucose concentration was determined in blood samples obtained from the tail vein at the indicated time points after the insulin injection. Glucose tolerance test
  • mice were fasted overnight (16 h) and administered with an intraperitoneal injection of glucose (2 g/kg body weight). Glycemia was measured in tail vein blood samples at the indicated time points. Venous blood was collected from tail vein in tubes (Microvette® CB 300, SARSTEDT) at the same time points and immediately centrifuged to separate serum, which was used to measure insulin levels.
  • An indirect open circuit calorimeter (Oxylet, Panlab, Cornelia, Spain) was used to monitor oxygen consumption, carbon dioxide production in eight metabolic chambers simultaneously. Mice were individualized and acclimated to the metabolic chambers for 24h, and data were collected every 15min for 3min in each cage for other 24h. Data were taken from the light and dark cycle and adjusted for body weight. To calculate energy expenditure the Metabolism software provided by the manufacturer was used. Transfection of HEK293, C2C12 and HepG2 cells
  • Cells were cultured in a 24-well plate and transfected with 0.8 ⁇ g of DNA per well using Lipofectamine 2000 following the manufacturer's instructions (Thermo Fisher Scientific).
  • Bone volume and architecture were evaluated by ⁇ Mouse tibiae were fixed in neutral buffered formalin (10%) and scanned using the explore Locus CT scanner (General Electric) at 27-micron resolution. Trabeculae were analyzed in 1 mm3 of proximal tibial epiphysis and 1.8 mm3 of cortical tibial diaphysis in 4 mice/group. Bone parameters were calculated with the Micro View 3D Image Viewer & Analysis Tool. The length of the tibia was measured from the intercondilar eminence to the medial malleolus. Western blot analysis
  • iWAT and iBAT were homogenized in QIAzol Lysis Reagent (Qiagen) and the protein fraction was isolated from the organic phase following the manufacturer's instructions. Proteins were separated by 12% SDS-PAGE, and analyzed by immunob lotting with rabbit polyclonal anti-UCPl (ab 10983; Abeam) and rabbit polyclonal anti-a-tubulin (ab4074; Abeam) antibodies. Detection was performed using ECL Plus detection reagent (Amersham Biosciences).
  • the open field test was performed between 9:00 am and 1 :00 pm as previously reported(Haurigot et al, 2013). Briefly, animals were placed in the center of a brightly lit chamber (41x41x30 cm) crossed by 2 bundles of photobeams (LE 8811; Panlab) that detect horizontal and vertical movements. Motor and exploratory activities were evaluated during the first 6 minutes. The total distance covered was evaluated using a video tracking system (SMART Junior; Panlab).
  • Example 1 Prevention of obesity and diabetes by intra-eWAT administration of AAV-CAG-moFGF21-dmiRT vectors in C57B16 mice
  • Intra-eWAT eWAT: epididymal white adipose tissue
  • AAV9-CAG-moFGF21-doublemiRT-treated mice also showed overexpression of the FGF21 receptorl (FGF21R1) in eWAT (FIG ID) and ⁇ -Klotho (a FGF21 co-receptor) in adipose tissue and liver (FIG IE) in comparison with AAV9-CAG-null vectors (vectors that retain equal infectivity but do not encode any transgene).
  • FGF21R1 FGF21 receptorl
  • ⁇ -Klotho a FGF21 co-receptor
  • mice fed a chow diet showed loss of body weight (FIGs IF and 1G).
  • FFD high fat diet
  • animals overexpressing FGF21 in adipose tissue remained lean for the duration of the experiment whereas AAV9-CAG-null treated mice became progressively obese (FIGs IF and 1G).
  • FFD high fat diet
  • mice overexpressing FGF21 in adipose tissue remained lean for the duration of the experiment whereas AAV9-CAG-null treated mice became progressively obese (FIGs IF and 1G).
  • both chow- and HFD-fed AAV9-CAG-moFGF21 -doublemiRT -treated mice showed decreased weight of adipose depots and liver (FIG 1H).
  • Liver histologic sections showed decreased lipid accumulation in hepatocytes of mice overexpressing FGF21 compared with AAV9-C AG-null-treated mice both under chow or HFD (FIG 2A). Accordingly, HFD-fed AAV9-CAG-moFGF21 -doublemiRT-treated mice normalized their hepatic content of tryglycerides (TG) (FIG 3D). In parallel, circulating levels of TG, total cholesterol, HDL-cholesterol and LDL-cholesterol were normalized in HFD-fed mice overexpressing FGF21 (FIGs 3E and 3F).
  • TG tryglycerides
  • HFD-fed mice overexpressing FGF21 were more insulin sensitive than HFD-fed AAV9- null treated mice (FIG 3G) and both chow- and HFD-fed AAV9-CAG-moFGF21- doublemiRT-treated mice showed decreased insulin circulating levels in comparison with their AAV9-CAG-null treated counterparts (FIG 3H).
  • Example 2 Reversion of obesity and improvement of glucose metabolism by intra- eWAT administration of AAV-CAG-moFGF21-dmiRT vectors in ob/ob mice
  • Intra-eWAT administration of AAV8-CAG-moFGF21-doublemiRT vectors mediated specific overexpression of FGF21 in white adipose tissue as well as high secretion of the protein into the bloodstream in a dose-dependent manner (FIGs 4 A and 4B).
  • the dose of 10 12 vg of AAV8-CAG-moFGF21-doublemiRT vectors mediated a very robust overexpression of FGF21 in eWAT and iWAT (FIG 4 A) and achieved the highest circulating FGF21 levels (FIG 4B).
  • Example 3 Reversion of obesity and improvement of glucose metabolism by intravenous administration of AAV-hAAT-moFGF21 vectors in ob/ob mice
  • ob/ob animals were administered IV with 5xlO u vg of AAV8-hAAT-null vectors.
  • the hAAT-moFGF21 construct is comprised in SEQ ID NO: 34 and the hAAT -null construct is comprised in SEQ ID NO:33.
  • Intravenous administration of AAV8-hAAT-moFGF21 vectors mediated specific overexpression of FGF21 in the liver as well as high secretion of the protein into the bloodstream in a dose-dependent manner (FIGs 6B and 6C).
  • the dose of 5xlO u vg of AAV8-hAAT-moFGF21 vectors mediated a very robust overexpression of FGF21 in the liver (FIG 6B) and achieved the highest circulating FGF21 levels (FIG 6C).
  • mice treated with this dose of AAV8-hAAT-moFGF21 vectors decreased approximately 7% during the two first weeks after AAV administration and afterwards slightly increased whereas AAV8-fiAAT-null-treated mice progressively put on weight (FIGs 6D, 6E and 6F).
  • Mice administered with 10 11 vg of AAV8-hAAT- moFGF21 vectors gained markedly much less weight than AAV8 -hAAT -null-treated animals (FIGs 6D, 6E and 6F).
  • AAV8 -hAAT -null animals showed a 50% increase in their body weight at the end of the experiment in comparison with the 10% weight gain of animals treated with 10 11 vg of AAV8-hAAT-moFGF21 vectors (FIG 6E).
  • animals overexpressing FGF21 in the liver showed significant decreased adiposity, particularly in those animals treated with the highest dose of vectors, and approximately a 60% reduction of the liver weight (FIG 6G).
  • iBAT weight was similarly increased in both groups of AAV8-hAAT-moFGF21 -treated mice (FIG 6G), probably due to higher thermogenic activity in these animals in comparison with mice administered with AAV8-hAAT-null vectors.
  • Animals treated with AAV8-hAAT-moFGF21 vectors showed improved insulin sensitivity and decreased insulin circulating levels in comparison with AAV8-hAAT- null-treated mice (FIGs 6H and 61)
  • Example 4 Long-term reversion of obesity and diabetes by intravenous administration of AAV-hAAT-moFGF21 vectors in HFD-fed mice
  • mice Nine -week-old male C57B16 mice (young adults) were fed a HFD for 9 weeks and then administered IV with 10 10 vg or 5xl0 10 vg of AAV8-hAAT-moFGF21 vectors (FIG 6A). After AAV administration, AAV8-hAAT- moFGF21 -treated mice were maintained on HFD for 52 weeks. As controls, 5xl0 10 vg of AAV8-hAAT-null were administered IV to chow- and HFD-fed C57B16 mice. These two latter cohorts of mice were maintained either on chow diet or HFD thereafter.
  • Intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice mediated high secretion of FGF21 into the bloodstream in a dose-dependent manner (FIGs 7A).
  • FIGs 7B and 7C No differences in body weight were observed between HFD-fed AAV8 -null-treated mice and HFD-fed animals administered with 10 10 vg of AAV8-hAAT-moFGF21 vectors.
  • mice treated with 5xl0 10 vg of AAV8-hAAT- moFGF21 vectors during the light and dark cycles was higher than that of chow- and HFD-fed AAV8-hAAT-null mice (FIG 8A).
  • No differences in energy expenditure were observed among chow- and HFD-fed AAV8-hAAT -null-treated animals and mice administered with 10 10 vg of AAV8-hAAT-moFGF21 vectors (FIG 8 A).
  • mice treated with 5x10 10 vg of AAV8-hAAT-moFGF21 have increased thermogenic activity.
  • mice were maintained either on chow diet or HFD thereafter.
  • Intravenous administration of AAV8-hAAT-moFGF21 vectors in old HFD-fed mice mediated high secretion of FGF21 into the bloodstream in a dose-dependent manner (FIGs 9A).
  • No differences in body weight were observed between HFD-fed AAV8 -null-treated mice and HFD-fed animals administered with 10 10 vg of AAV8-hAAT-moFGF21 vectors (FIGs 9B and 9C).
  • HFD-fed animals treated with either 2x10 10 vg or 5x10 10 vg of AAV8-hAAT-moFGF21 vectors initially lost 15 and 20%, respectively, of body weight after AAV administration (FIGs 9B and 9C).
  • animals treated with 2xl0 10 vg of AAV8-hAAT-moFGF21 vectors progressively gained weight similarly to chow-fed AAV8-fiAAT-null-treated mice whereas no significant changes in body weight of animals treated with 5xl0 10 vg of AAV8-hAAT-moFGF21 vectors were observed (FIGs 9B and 9C).
  • HEK293 cells were transfected with plasmids encoding three different codon-optimized human FGF21 nucleotide sequences (SEQ ID NO's: 40-42). As control, non-transfected cells and cells transduced with wild-type hFGF21 coding sequence were used. Expression of the three codon-optimized human FGF21 sequences and the WT human FGF21 sequence was under the control of the hAAT promoter (SEQ ID NO:47).
  • HFD-fed mice are treated with AAV vectors encoding human FGF21. As controls, the same dose of AAV-null vectors is administered to chow- and HFD-fed mice.
  • serum metabolic parameters such as free fatty acids, glycerol, triglycerides, cholesterol and ketone bodies
  • Example 9 In vitro assay for assessing FGF21 activity FGF21 is expected to increase glucose uptake and GLUT1 expression in 3T3-L1 cells (Kharitonenkov, A. et al., 2005. J. Clin. Invest 115:1627-1635).
  • Example 10 Reversion of obesity and improvement of glucose metabolism by intra- eWAT administration of AAV8-CAG-moFGF21-dmiRT vectors in ob/ob mice: further observations
  • Ob/ob mice that received intra-eWAT injections of AAV8-CAG-moFGF21-dmirT vectors showed a reduction in the size of white adipocytes of the epididymal pad (FIG 13A). Circulating adiponectin levels also increased with dose (FIG 14A). eWAT inflammation, evaluated through Mac2 staining, was also reduced as a function of the dose of vector, as did the expression of the macrophage marker F4/80 (FIG 14B and C).
  • the liver of ob/ob mice injected with null vectors or the lowest dose of AAV8-CAG- moFGF21-dmirT showed accumulation of lipid droplets in hepatocytes (FIG 13B).
  • Example 11 Reversion of obesity and improvement of glucose metabolism by intravenous administration of AAV8-hAAT-moFGF21 vectors in ob/ob mice: further observations
  • ob/ob animals overexpressing FGF21 in the liver showed significantly decreased size of white adipocytes, particularly those animals treated with 5xlO u vg (FIG 15A). This was parallel with a dose-dependent increase in circulating adiponectin levels (FIG 15B) and decreased WAT inflammation, as evidenced by decreased staining for Mac2 and expression of F4/80 and TNF-a in eWAT (FIG 16A-C). Noticeably, ob/ob mice treated with 5x10 11 vg showed a remarkable reduction in "crown-like" structures in eWAT (FIG 16A).
  • Example 12 Long-term reversion of obesity and diabetes by intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice and HFD-fed old mice: decreased tissue weight and stable expression up to 1 year
  • FIG 19A-B Representative images of animals belonging to all experimental groups of the studies performed in young adults or in adults (see Examples 4 and 5) are shown in FIG 19A-B.
  • the reversion of obesity by AAV8-bAAT-moFGF21 treatment was parallel to a dose- dependent decrease in the weight of the main white adipose tissue (WAT) depots, such as the epididymal (eWAT), inguinal (iWAT) and retroperitoneal (rWAT) fat pads, both in animals treated as young adults or as adults (FIG 18A and FIG 19C).
  • WAT white adipose tissue
  • FIG 20A 1 year after AAV8- hAAT-moFGF21 delivery, treated animals travelled more distance, rested less time, and spent more time doing slow and fast movements than untreated HFD-fed controls.
  • the creatine-driven substrate cycle and sarco/endoplasmic reticulum Ca2+-ATPase 2b (Serca2b)-mediated calcium cycling can increase thermogenesis in iWAT independently of UCP1 (Kazak L. et al, 2015. Cell 163:643-655; Ikeda K. et al, 2017. Nat. Med. 23: 1454-1465).
  • phosphatase orphan 1 an enzyme involved in the creatine-driven substrate cycle, were observed in iWAT of HFD- fed mice treated with 5xl0 10 vg of AAV8-hAAT-moFGF21 when compared with age- matched, chow- and HFD-fed control groups (FIG 20E), suggesting that the activity of the creatine-driven cycle was probably increased as a result of FGF21 gene transfer.
  • Example 14 Long-term reversion of obesity and diabetes by intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice and HFD-fed old mice: glucagon levels, islet hyperplasia and glucose tolerance
  • HFD-fed animals treated as young adults with AAV8-hAAT-moFGF21 vectors showed decreased circulating levels of glucagon compared with HFD-fed null- treated mice (FIG 22A).
  • mice While AAV8-null-treated mice developed islet hyperplasia as a consequence of HFD feeding, the ⁇ -cell mass of animals treated with AAV8-hAAT-FGF21 vectors (at the doses of 2xl0 10 or 5xl0 10 vg/mouse) was similar to that of control mice fed a chow diet (FIG 22B and C). Double immunostaining for insulin and glucagon of pancreatic sections from HFD-fed AAV8-hAAT-moFGF21 -treated mice showed normal distribution of a and ⁇ cells in the islets of these animals, with localization of glucagon-expressing cells in the periphery of the islet and of insulin-expressing cells in the core (FIG 22D).
  • GTT intraperitoneal glucose tolerance test
  • Example 15 Reversion of HFD-associated WAT hypertrophy and inflammation by intravenous administration of AAV8-hAAT-moFGF21 vectors HFD-feeding induces an increase in the size of WAT adipocytes (Sattar N. & Gill J.M.R., 2014. BMC Med. 12: 123). Administration of FGF21 -encoding vectors counteracted this increase (FIG 24 A). Morphometric analysis of WAT revealed that the area of white adipocytes of animals treated as young adults with lxlO 10 or 5xl0 10 vg of vector, and of mice treated as adults with 2xl0 10 or 5xl0 10 vg of vector was similar to that of animals fed a chow diet (FIG 24B).
  • Example 16 Reversal of hepatic steatosis, inflammation and fibrosis by intravenous administration of AAV8-h AAT-moFGF21 vectors
  • BMD bone mineral density
  • BMC bone mineral content
  • BV bone volume
  • BV/TV bone volume/tissue volume ratio
  • BS/BV bone surface/bone volume ratio
  • Tb.N trabecular number
  • Tb.Th trabecular thickness
  • Tb.Sp trabecular separation
  • Example 18 Prevention of HFD-induced liver tumours by intravenous administration of AAV8-hAAT-moFGF21 vectors Long-term feeding (>60 weeks) with a HFD has been associated with increased incidence of liver neoplasms in C57BL/6J mice (Hill-Baskin A.E. et al., 2009. Hum. Mol. Genet. 18:2975-2988; Nakagawa H., 2015. World J. Hepatol. 7:2110). In our study in animals that initiated the HFD as young adults and maintained it for 60 weeks we found liver tumours in 66.7% (6/9) of animals injected with null-vectors.
  • Example 19 Amelioration of STZ-induced hyperglycemia by liver-specific AAV8- mediated FGF21 over expression
  • mice had free access to a standard diet and were kept under a 12 h light-dark cycle (lights on at 08:00 hours).
  • mice received five intraperitoneal injections, on consecutive days, of streptozotocin (50 mg/kg) dissolved in 0.1 mol/1 citrate buffer (pH 4.5). Blood glucose levels were assessed using an analyser (Glucometer Elite; Bayer, Leverkusen, Germany). Animal care and experimental procedures were approved by the Ethics Committee in Animal and Human Experimentation of the Universitat Autonoma de Barcelona.
  • AAV vectors AAV vectors
  • AAV vectors were diluted in 200 ⁇ of 0.001% F68 Pluronic® (Gibco) in PBS and injected via the tail vein.
  • AAV8-hAAT-moFGF21 5xl0 10 vg or 2xlO n vg of AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (AAV8-hAAT-moFGF21) were administered IV to male 9-week-old C57B16 mice. Control mice received 2xlO u vg of AAV8-hAAT-Null vectors. Two weeks post- AAV administration, all animals were treated with streptozotocin (STZ) (5 doses of 50 mg/kg; 1 dose per day) to trigger the diabetic process.
  • STZ streptozotocin
  • Example 20 Extension of healthy lifespan by intramuscular administration of AAV-CMV-moFGF21 vectors in C57B16 mice due to the prevention of weight gain and insulin resistance associated with aging.
  • Skeletal muscle (Skm) is a readily accessible tissue and has been used to produce secretable therapeutic proteins (Haurigot V. et al, 2010. J. Clin. Invest. 123:3254-3271; Callejas D. et al, 2013. Diabetes 62: 1718-1729; Jaen M . et al, 2017. Mol. Ther. Methods Clin. Dev. 6: 1-7).
  • AAV vectors of serotype 1 which show a high tropism for Skm (Chao L. et al, 2000. J. Clin. Invest. 106: 1221-1228; Wu Z. et al, 2006. J. Virol.
  • mice injected intramuscularly with AAVl-CMV-moFGF21 maintained the body weight they had at the initiation of the study and were ⁇ 38% slimmer than controls, which steady increased their weight as animals aged (FIG 31C). While the weight of the muscles was barely affected by FGF21 gene transfer, the weight of the white and brown depots as well as the liver were considerably reduced (FIG 3 ID). Indeed, the weight of the WAT pads analysed was reduced by >50% (FIG 3 ID). Moreover, mice treated with AAVl-CMV-moFGF21 showed a marked reduction in the hepatic total triglyceride content (FIG 3 IE).
  • mice As controls, another cohort of obese mice and the cohort of chow-fed mice received 3x10 11 vg of non-coding null vectors (AAVl-CMV-null). Following AAV delivery, mice were maintained on chow or HFD feeding. Animals treated with AAVl-CMV-moFGF21 experienced progressive loss of body weight (FIG 32A and B). The reversion of obesity by AAV 1 -CM V-FGF21 treatment was parallel to an increase in the circulating levels of FGF21 (FIG 32C). Null-treated mice fed a HFD showed normal fed glycemia (FIG 32D), but were hyperinsulinemic (FIG 32E), suggesting that these mice had developed insulin resistance.
  • AAVl-CMV-null non-coding null vectors
  • HFD-fed mice treated with AAVl-CMV-moFGF21 were, by the end of the study, normoglycemic and normoinsulinemic (FIG 32D and E).
  • animals administered with AAVl-CMV-moFGF21 showed greater insulin sensitivity than their HFD-fed controls (FIG 32F).
  • Example 22 Increased FGF21 circulating levels by codon-optimized human FGF21 nucleotide sequences.
  • 8-week-old male C57B16 mice were hydrodynamically injected with plasmids encoding three different codon-optimized human FGF21 nucleotide sequences (SEQ ID NO's:40-42) under the control of the hAAT promoter.
  • SEQ ID NO's:40-42 codon-optimized human FGF21 nucleotide sequences
  • Plasmid DNA was diluted in saline in a volume (ml) equal to -10% of the animals' average body weight (grams) and was manually injected into the lateral tail vein in less tan 5 seconds. Before the injection, the animals were put under a 250W infrared heat lamp (Philips) for a few minutes to dilate the blood vessels and facilitate viewing and easier access to the tail vein. A plastic restrainer (Harvard Apparatus) was used to secure the animal for injection. No anaesthesia was used as it is not necessary so long as an appropriate restraining device is employed. We used 26G 3/8 in. gauge hypodermic needles (BD), the largest feasible needle gauge that fit snugly into the access vein, to inject the animals. Results
  • BD gauge hypodermic needles
  • mice treated with either codon-optimized human FGF21 version 2 or 3 were able to secrete higher human FGF21 levels into the circulation in comparison with wild-type or codon-optimized FGF21 variant 1 (FIG 33, thus demonstrating increased FGF21 protein production by codon-optimization of variants 2 and 3.
  • Example 23 In vitro and in vivo increased FGF21 expression and protein production levels by h AAT-moFGF21 , C AG-moFGF21 -doublemiRT and CMV- moFGF21 expression cassettes
  • Plasmid DNA was diluted in saline in a volume (ml) equal to -10% of the animals' average body weight (grams) and was manually injected into the lateral tail vein in less tan 5 seconds. Before the injection, the animals were put under a 25 OW infrared heat lamp (Philips) for a few minutes to dilate the blood vessels and facilitate viewing and easier access to the tail vein. A plastic restrainer (Harvard Apparatus) was used to secure the animal for injection. No anaesthesia was used as it is not necessary so long as an appropriate restraining device is employed. We used 26G 3/8 in. gauge hypodermic needles (BD), the largest feasible needle gauge that fit snugly into the access vein, to inject the animals. Results
  • BD gauge hypodermic needles
  • HEK293 cells were transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183) (SEQ ID NO:57) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV- moFGF21) or the CAG promoter in conjunction with four tandem repeats of the miPvT122a sequence and four tandems repeats of the miRTl sequence (CAG-moFGF21- doublemiRT). As control, non-transfected cells were used.
  • EFla elongation factor la
  • CMV- moFGF21 CMV promoter
  • CAG promoter in conjunction with four tandem repeats of the miPvT122a sequence and four tandems repeats of the miRTl sequence
  • CAG-moFGF21- doublemiRT a
  • HEK293 cells transduced with CAG-moFGF21 -doublemiRT expressed higher levels of FGF21 in comparison with cells transduced with EFla-mFGF21 or non-transduced cells (FIG 34A). Moreover, HEK293 cells transduced with CAG-moFGF21 -doublemiRT also showed higher intracellular FGF21 protein content and higher FGF21 protein levels in the culture medium ( Figure 34B and C).
  • HEK293 cells transduced with EFla-mFGF21 or CMV-moFGF21 expressed similar levels of FGF21 ( Figure 34A)
  • HEK293 cells transduced with CMV-moFGF21 showed higher intracellular FGF21 protein content and higher FGF21 protein levels in the culture medium ( Figure 34B and C).
  • C2C12 cells were transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21).
  • EFla-mFGF21 EFla-mFGF21
  • CMV-moFGF21 codon-optimized murine FGF21 coding sequence under the control of the CMV promoter
  • non- transfected cells were used.
  • C2C12 cells transduced with CMV-moFGF21 expressed higher levels of FGF21 in comparison with cells transduced with EFla-mFGF21 or non- transduced cells (FIG 34D).
  • HepG2 cells were transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183) or a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (hAAT-moFGF21).
  • EFla-mFGF21 EFla-mFGF21
  • hAAT-moFGF21 a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter
  • non- transfected cells were used.
  • HepG2 cells transduced with hAAT-moFGF21 expressed higher levels of FGF21 in comparison with cells transduced with EFla-mFGF21 or non- transduced cells (FIG 34E).
  • mice 8-week-old male C57B16 mice were hydrodynamically administered with 5 ⁇ g of plasmids encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) (Zhang et al., EBioMedicine 15 (2017) 173-183) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21) or the hAAT promoter (hAAT-moFGF21).
  • EFla elongation factor la
  • CMV-moFGF21 CMV promoter
  • hAAT-moFGF21 hAAT-moFGF21
  • Example 24 In vivo increased FGF21 expression in target tissues and FGF21 circulating levels by AAV8-h AAT-moFGF21 , AAV8-CAG-moFGF21-doublemiRT and AAVl-CMC-moFGF21 in comparison with AAV8-Efla-mFGF21 Hepatic expression
  • mice Male C57B16 mice were intravenously administered with lxlO 10 vg, 2xl0 10 vg or 5xl0 10 vg of AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or a codon- optimized murine FGF21 coding sequence under the control of the liver-specific hAAT promoter (AAV8-hAAT-moFGF21).
  • EFla elongation factor la
  • AAV8-hAAT-moFGF21 codon- optimized murine FGF21 coding sequence under the control of the liver-specific hAAT promoter
  • mice Male C57B16 mice were administered intra-eWAT with 2x10 10 vg, 5xl0 10 vg or lxlO 11 vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the C AG promoter in conjunction with four tandem repeats of the miRT 122a sequence and four tandems repeats of the miRTl sequence (AAV8-CAG-moFGF21-doublemiRT).
  • EFla elongation factor la
  • AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the C AG promoter in conjunction with four tandem repeats of the miRT 122a sequence and four tandems repeats of the miRTl sequence (AAV8-CAG-m
  • mice Male C57B16 mice were administered intramuscularly with 5xl0 10 vg, lxlO 11 vg or 3xl0 u vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV1 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (AAV 1 -CM V-FGF21 ).
  • EFla elongation factor la
  • AAV1 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter
  • SV40 polyadenylation signal Rabbit ⁇ -Globin polyadenylation signal CMV promoter and CMV enhancer sequence Hepatocyte control region (HCR) enhancer from apolipoprotein E mini/aP2 promoter
  • Nuleotide sequence oi homo sapiens FGF21 (SEQ ID NO: 4)
  • Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 1 (SEQ ID NO: 5)
  • Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 2 (SEQ ID NO: 6)
  • Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 3 (SEQ ID NO: 7)
  • nucleotide sequence encoding miRT122a (target sequence of microRNA 122a) (SEQ ID NO: 12)
  • nucleotide sequence encoding miRTl (target sequence of microRNA 1) (SEQ ID NO: 13)
  • nucleotide sequence encoding miRT152 (target sequence of microRNA 152) (SEQ ID NO: 14)
  • Nucleotide sequence encoding miRTl 99a-5p (target sequence of microRNA 199a) (SEQ ID NO: 15)
  • nucleotide sequence encoding miRT148a (target sequence of microRNA 148a) (SEQ ID NO: 19)
  • Nucleotide sequence encoding miRT194 (target sequence of microRNA 194) (SEQ ID NO: 20)
  • nucleotide sequence encoding miRT124 (target sequence of microRNA 124) (SEQ ID NO: 21)
  • nucleotide sequence encoding miRT216 (target sequence of microRNA 216) (SEQ ID NO: 22)
  • nucleotide sequence encoding miRT133a (target sequence of microRNA 133a) (SEQ ID NO: 24)
  • nucleotide sequence encoding miRT206 (target sequence of microRNA 206) (SEQ ID NO: 25)
  • nucleotide sequence encoding miRT130 (target sequence of microRNA 130) (SEQ ID NO: 26) 5' ATGCCCTTTTAACATTGCACTG 3'
  • nucleotide sequence encoding miRT99 (target sequence of microRNA 99) (SEQ ID NO: 27)
  • Nucleotide sequence encoding miRT208-5p (target sequence of microRNA 208a) (SEQ ID NO: 28)
  • Nucleotide sequence encoding miRT208a-3p (target sequence of microRNA 208a) (SEQ ID NO: 29)
  • Nucleotide sequence encoding miRT499-5p (target sequence of heart-specific microRNA 499) (SEQ ID NO: 30)
  • Hepatocyte control region (HCR) enhancer from apolipoprotein E SEQ ID NO: 53
  • Elongation factor 1 alpha promoter from 150 to 1327 (1178bp)
  • SEQ ID NO: 57 also contains the truncated AAV2 5' and 3' ITR and the SV40 polyA (already included in sequence listing, SEQ ID NO: 48, 49 and 50)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Physics & Mathematics (AREA)
  • Environmental Sciences (AREA)
  • Plant Pathology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Public Health (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Toxicology (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Animal Husbandry (AREA)
  • Mycology (AREA)
  • Immunology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The invention relates to a viral expression construct and related viral vector and nucleic acid molecule and composition and to their use wherein said construct and vector are suitable for expression in a mammal and comprise a nucleotide sequence encoding a Fibroblast growth factor 21 (FGF21) to be expressed in liver, adipose tissue and/or skeletal muscle.

Description

Viral expression construct comprising a Fibroblast Growth Factor 21 (FGF21) coding sequence
Field of the invention
The invention pertains to the medical field, comprising gene therapy compositions for use in the treatment of a metabolic disorder, use in the treatment of liver inflammation and/or fibrosis, use in the treatment of cancer and/or use in extending healthy lifespan in mammals, particularly in human beings. Background of the invention
The prevalence of diabetes is growing at an alarming rate and is a major health problem worldwide. Obesity is strongly associated with insulin resistance and type 2 diabetes (T2D) (Moller, D. E., and Flier, J. S., 1991. N. Engl. J. Med. 325:938-948). Moreover, obesity increases the risk of mortality (Peeters, A. et al., 2003. Ann. Intern. Med. 138:24- 32) and is also a significant risk factor for heart disease, immune dysfunction, hypertension, arthritis, neurodegenerative diseases, and certain types of cancer (Roberst, D. L. et al, 2010. Annu. Rev. Med. 61 :301-316; Spiegelman, B. M. et al, 1993. J. Biol. Chem. 268:6823-6826; Whitmer, R. A., 2007. Curr. Alzheimer Res. 4: 117-122). Despite the clinical significance of T2D and obesity, no effective treatments are available. Hence, there is an urgent need for novel and safe approaches to prevent and combat the current T2D-obesity epidemic. Recently, it has become widely accepted that obesity is an important risk factor for cancer (Roberst, D. L. et al., 2010. Annu. Rev. Med. 61 :301- 316). Given the current obesity epidemic, obesity-related cancer risks are a clinically important concern for which novel and safe approaches are urgently needed. An increase in weight and insulin resistance is also associated with aging. Hence, novel and safe approaches to prevent and reverse obesity and diabetes are needed to extend healthy lifespan. Liver fibrosis is an excessive accumulation of extracellular matrix proteins, e.g. collagen, resulting predominantly from chronic liver inflammation. Advanced liver fibrosis will lead to liver cirrhosis, portal hypertension and liver failure. Thus, novel and safe antifibrotic therapeutics are required.
Fibroblast growth factor 21 (FGF21 ), a growth factor predominantly secreted by the liver, but also by adipose tissue and pancreas (Muise, E. S. et al, 2008. Mol. Pharmacol. 74:403-412), has been shown to increase brown adipose tissue (BAT) growth and expression of thermogenic genes in BAT and white adipose tissue (WAT), stimulating energy expenditure (Coskun, T. et al, 2008. Endocrinology 149:6018-6027; Fisher, F. M. et al., 2012. Genes Dev. 26:271-281; Kharitonenkov, A. et al., 2005. J. Clin. Invest 115: 1627-1635; Konishi, M. et al, 2000. J. Biol. Chem. 275: 12119-12122; Tomlinson, E. et al, 2002. Endocrinology 143: 1741-1747; Xu, J. et al, 2009. Diabetes 58:250-259). Overexpression of FGF21 in transgenic mice protected them from diet-induced obesity (Kharitonenkov, A. et al., 2005. J. Clin. Invest 115 : 1627-1635) and the administration of FGF21 to ob/ob, db/db or high fat diet (HFD)-fed mice or to obese ZDF rats promoted a robust reduction in adiposity, significantly lowered blood glucose and triglycerides, decreased fasting insuling levels and improved insulin sensitivity (Coskun, T. et al, 2008. Endocrinology 149:6018-6027; Kharitonenkov, A. et al, 2005. J. Clin. Invest 115: 1627- 1635; Xu, J. et al, 2009. Diabetes 58:250-259; Adams, A. C. et al, 2012. PLoS. One. 7:e38438.; Berglund, E. D. et al, 2009. Endocrinology 150:4084-4093). Moreover, the administration of FGF21 to obese diabetic rhesus monkeys dramatically reduced fasting plasma glucose, fructosamine, triglyceride, insulin and glucagon levels and induced a small but significant weight loss (Kharitonenkov, A. et al., 2007. Endocrinology 148:774- 781).
Native FGF21 protein exhibits poor pharmacokinetic characteristics. It has a short half- life, and it is susceptible to in vivo proteolytic degradation and in vitro aggregation (Huang, J. et al, 2013. J Pharmacol Exp Ther. 346(2 :270-80; So, W. Y. and Leung, P.S. 2016. Med Res Rev. 36(4 :672-704; Zhang, J. and Li, Y. 2015. Front Endocrinol (Lausanne). 6: 168). Various engineering approaches have been developed to extend the half-life and to improve the stability and solubility of FGF21. Currently, two engineered FGF21 mimetics (LY2405319 and PF-05231023) are being tested in humans. Nevertheless, those FGF21 mimetics require multiple administrations, which poses a significant burden to the patients. Moreover, engineered FGF21 mimetics/analogs may exhibit a higher risk of immunogenicity than native FGF21, e.g. patients treated with LY2405319 developed injection site reactions, anti-drug antibodies and a serious hypersensitivity reaction (Gaich, G. et al, 2013. Cell Metab. 18{3):333-40).
Therefore there is still a need for new treatments for diabetes and/or obesity and/or liver inflammation and/or fibrosis and/or cancer and/or extending healthy lifespan which do not have all the drawbacks of existing treatments. Description of the invention
The inventors designed improved gene therapy strategies based on adeno-associated viral (AAV) vector-mediated FGF21 gene transfer to liver, adipose tissue and/or skeletal muscle to counteract metabolic disorders, preferably diabetes and/or obesity. The gene therapy of the invention may also be used to counteract liver inflammation and/or fibrosis. Additionally, the gene therapy of the invention may also be used for the extension of healthy lifespan by counteracting metabolic disorders associated with aging, preferably diabetes and/or obesity. Additionally, the gene therapy of the invention may also be used to counteract cancer, preferably liver cancer.
Generation of single-vector gene constructs allows the in vivo production of native FGF21, which should result in reduced risk of immunogenicity or other toxicities. However, the skilled person knows that native FGF21 may be susceptible to in vivo proteolytic degradation and/or have a fast in vivo clearance rate. All vectors tested in the experimental part were found to be able to enable long-lasting secretion of stable native FGF21 into the bloodstream. Efficacy is maintained even with a single administration of gene transfer vectors.
Therefore the generation of such AAV vectors for in vivo production of native FGF21 is not routine for a person skilled in the art, as demonstrated in the experimental part. Viral expression construct
In a first aspect there is provided a viral expression construct suitable for expression in a mammal and comprising a nucleotide sequence encoding a Fibroblast growth factor 21 (FGF21) to be expressed in liver, adipose tissue and/or skeletal muscle.
The definition of "viral expression construct", "suitable for expression in a mammal" "liver", "adipose tissue" and "skeletal muscle" has been provided in the part of the description entitled "general definitions".
A preferred nucleotide sequence encoding a FGF21 present in the viral expression construct of the invention has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". A more preferred nucleotide sequence encoding a human FGF21 present in the viral expression construct of the invention has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6 or 7. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". SEQ ID NO: 4 is a nucleotide sequence encoding human FGF21. SEQ ID NO: 5 is a codon optimized nucleotide sequence encoding human FGF21, variant 1. SEQ ID NO: 6 is a codon optimized nucleotide sequence encoding human FGF21, variant 2. SEQ ID NO: 7 is a codon optimized nucleotide sequence encoding human FGF21, variant 3. Variant 1, variant 2 and variant 3 encode for the same human FGF21 protein and were obtained by different algorithms of codon optimization. Another preferred nucleotide sequence encoding mouse FGF21 present in the viral expression construct of the invention has at least 60%>, 65%>, 70%>, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 8 or 9. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". SEQ ID NO: 8 is a nucleotide sequence encoding mouse FGF21. SEQ ID NO: 9 is a codon optimized nucleotide sequence encoding mouse FGF21. Another preferred nucleotide sequence encoding canine FGF21 present in the viral expression construct of the invention has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 10 or 11. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". SEQ ID NO: 10 is a nucleotide sequence encoding canine FGF21. SEQ ID NO: 11 is a codon optimized nucleotide sequence encoding canine FGF21. The nucleotide sequence encoding a FGF21 may be derived from any FGF21 gene or FGF21 coding sequence, preferably from human, mouse or dog; or a mutated FGF21 gene or FGF21 coding sequence, or a codon optimized FGF21 gene or FGF21 coding sequence, preferably from human, mouse or dog.
A FGF21 as used herein exerts at least a detectable level of an activity of a FGF21 as known to the skilled person. An activity of a FGF21 is to increase insulin sensitivity. This activity could be assessed using the insulin tolerance test, as described in the experimental part, preferably as in example 8 or 9. In an embodiment there is provided a viral expression construct as described above, wherein the nucleotide sequence encoding a FGF21 suitable for expression in a mammal is selected from the group consisting of:
(a) a nucleotide sequence encoding a polypeptide comprising an amino acid sequence that has at least 60% sequence identity with the amino acid sequence of SEQ ID NO: 1,
2 or 3.
(b) a nucleotide sequence that has at least 60% sequence identity with the nucleotide sequence of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11.
(c) a nucleotide sequence the sequence of which differs from the sequence of a nucleotide sequence of (b) due to the degeneracy of the genetic code.
A preferred nucleotide sequence encoding a FGF21 suitable for expression in a mammal encodes a polypeptide comprising an amino acid sequence that has at least 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 1, 2 or 3. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". SEQ ID NO: 1 is an amino acid sequence of human FGF21. SEQ ID NO: 2 is an amino acid sequence of murine FGF21. SEQ ID NO: 3 is an amino acid sequence of canine FGF21. In an embodiment there is provided a viral expression construct as described above comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and at least one of elements a), b), c), d) and e):
(a) a liver-specific promoter
(b) an adipose tissue-specific promoter
(c) a combination of an ubiquitous promoter and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, wherein said combination enables specific expression in adipose tissue
(d) a skeletal muscle promoter and
(e) a combination of an ubiquitous promoter and an adeno-associated virus (AAV) vector sequence, wherein said combination enables specific expression in skeletal muscle. A "target sequence of a microRNA expressed in the liver" or "target sequence of a miRNA expressed in the liver" or "binding site of a microRNA expressed in the liver" refers to a nucleotide sequence which is complementary or partially complementary to at least a portion of a microRNA expressed in the liver. Similarly, a "target sequence of a microRNA expressed in the heart" or "target sequence of a miRNA expressed in the heart" or "binding site of a microRNA expressed in the heart" refers to a nucleotide sequence which is complementary or partially complementary to at least a portion of a microRNA expressed in the heart. A portion of a microRNA expressed in the liver or a portion of a microRNA expressed in the heart, as defined herein, means a nucleotide sequence of at least five or at least six consecutive nucleotides of said microRNA. The binding site sequence can have perfect complementarity to at least a portion of an expressed microRNA, meaning that the sequences can be a perfect match, no mismatch may occur. Alternatively, the binding site sequence can be partially complementary to at least a portion of an expressed microRNA, meaning that one mismatch/five, six consecutive nucleotides may occur. Partially complementary binding sites preferably contain perfect or near perfect complementarity to the seed region of the microRNA, meaning that no mismatch (perfect complementarity) or one mismatch/five, six consecutive nucleotides (near perfect complementarity) may occur between the seed region of the microRNA and its binding site. The seed region of the microRNA consists of the 5' region of the microRNA from about nucleotide 2 to about nucleotide 8 of the microRNA (i.e. 6 nucleotides). The portion as defined herein is preferably the seed region of said microRNA. Degradation of the messenger RNA (mRNA) containing the target sequence for a microRNA expressed in the liver or a microRNA expressed in the heart may be through the RNA interference pathway or via direct translational control (inhibition) of the mRNA. The invention is not limited by the pathway ultimately utilized by the miRNA in inhibiting expression of the transgene or encoded protein.
In the context of the invention, a nucleotide sequence encoding a target sequence of a microRNA expressed in the liver may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 12 or 14-23. A more preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 12 or 14- 23. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". In one embodiment, the nucleotide sequence encoding a target sequence of a microRNA expressed in the liver may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 12. A more preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 12. In a further embodiment, at least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the liver, as defined in SEQ ID NO: 12 or 14-23, is present in the viral expression construct of the invention. In a further embodiment, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding a target sequence of a liver-specific microRNA, as defined in SEQ ID NO: 12 or 14-23, are present in the viral expression construct of the invention. In a preferred embodiment one, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding miRT122a (SEQ ID NO: 12) are present in the viral expression construct of the invention.
A target sequence of a microRNA expressed in the liver as used herein exerts at least a detectable level of activity of a target sequence of a microRNA expressed in the liver as known to the skilled person. An activity of a target sequence of a microRNA expressed in the liver is to bind to its cognate, microRNA expressed in the liver and, when operatively linked to a transgene, to mediate detargeting of transgene expression in the liver. This activity may be assessed by measuring the levels of transgene expression in the liver by qPCR, as described in the experimental part.
In the context of the invention, a nucleotide sequence encoding a target sequence of a microRNA expressed in the heart may be replaced by a nucleotide sequence comprising a nucleotide sequence that has a least 60% sequence identity or similarity with SEQ ID NO: 13 or 23-30. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 13 or 23-30. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". In one embodiment, the nucleotide sequence encoding a target sequence of a microRNA expressed in the heart may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 13. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 13. In a further embodiment, at least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, as defined in SEQ ID NO: 13 or 23-30, is present in the viral expression construct of the invention. In a further embodiment, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding a target sequence of a heart-specific microRNA, as defined in SEQ ID NO: 13 or 23-30, are present in the viral expression construct of the invention. In a preferred embodiment one, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding miRTl (SEQ ID NO: 13), are present in the viral expression construct of the invention. An activity of a target sequence of a microRNA expressed in the heart is to bind to its cognate, microRNA expressed in the heart and, when operatively linked to a transgene, to mediate detargeting of transgene expression in the heart. This activity may be assessed by measuring the levels of transgene expression in the heart by qPCR, as described in the experimental part.
In an embodiment there is provided a viral expression construct as described above, wherein the nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and the nucleotide sequence encoding a target sequence of a microRNA expressed in the heart is selected from a group consisting of sequences SEQ ID NO: 12 to 30 and/or combinations thereof.
In one embodiment, at least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the liver, as defined in SEQ ID NO: 12 or 14-23, and at least one copy of a nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, as defined in SEQ ID NO: 13 or 23-30, are present in the viral expression construct of the invention. In a further embodiment, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding a target sequence of a microRNA expressed in the liver, as defined in SEQ ID NO: 12 or 14-23, and two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, as defined in SEQ ID NO: 13 or 23-30, are present in the viral expression construct of the invention. In a further embodiment one, two, three, four, five, six, seven or eight copies of a nucleotide sequence encoding miRTl 22a (SEQ ID NO: 12) and one, two, three, four, five, six, seven or eight copies nucleotide sequence encoding miRTl (SEQ ID NO: 13) are combined in the viral expression construct of the invention. In a further embodiment, four copies of a nucleotide sequence encoding miRTl 22a (SEQ ID NO: 12) and four copies of nucleotide sequence encoding miRTl (SEQ ID NO: 13) are combined in the viral expression construct of the invention.
The definition "promoter", "liver-specific promoter", "adipose tissue-specific promoter", "ubiquitous promoter", "skeletal muscle promoter" has been provided in the part of the description entitled "general definitions". A preferred ubiquitous promoter is a CAG promoter.
In the context of the invention, a nucleotide sequence of a CAG promoter may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 44. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 44. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
Another preferred ubiquitous promoter is a cytomegalovirus (CMV) promoter.
In the context of the invention, a nucleotide sequence of a CMV promoter may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60%> sequence identity or similarity with SEQ ID NO: 45. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 45. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
Preferably said CMV promoter is used together with an intronic sequence. In this context an intronic sequence may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 43. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 43. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
A preferred liver-specific promoter is a human a 1 -antitrypsin (hAAT) promoter. In the context of the invention, a nucleotide sequence of a hAAT promoter may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 47. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 47. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
Preferably said hAAT promoter is used together with an intronic sequence. A preferred intronic sequence is a hepatocyte control region (HCR) enhancer from apo lipoprotein E. A most preferred intronic sequence is the HCR enhancer from apolipoprotein E as defined in SEQ ID NO: 53. In this context an intronic sequence may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60%> sequence identity or similarity with SEQ ID NO: 53. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 53. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". In an embodiment, said hAAT promoter is used together with one, two, three, four or five copies of an intronic sequence. In a preferred embodiment, said hAAT promoter is used together with one, two, three, four or five copies of the HCR enhancer from apolipoprotein E as defined in SEQ ID NO: 53.
Other liver-specific promoters are the albumin promoter, the major urinary protein promoter, the phosphoenolpyruvate carboxykinase (PEPCK) promoter, the liver- enriched protein activator promoter, the transthyretin promoter, the thyroxine binding globulin promoter, the apolipoprotein Al promoter, the liver fatty acid binding protein promoter and the phenylalanine hydroxylase promoter .
Adipose tissue-specific promoters are the adipocyte protein 2 (aP2, also known as fatty acid binding protein 4 (FABP4)) promoter, the PPARy promoter, the adiponectin promoter, the phosphoenolpyruvate carboxykinase (PEPCK) promoter, the promoter derived from human aromatase cytochrome p450 (p450arom) the mini/aP2 promoter (composed of the adipose-specific aP2 enhancer and the basal aP2 promoter), the uncoupling protein 1 (UCP1) promoter, the mini/UCPl promoter (composed of the adipose-specific UCP1 enhancer and the basal UCP1 promoter), the adipsin promoter, the leptin promoter, or the Foxa-2 promoter. Preferred adipose tissue-specific promoters are the mini/aP2 promoter (SEQ ID NO: 54) and the mini/UCPl promoter (SEQ ID NO 55). In this context an adipose tissue-specific promoter sequence may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 53 or SEQ ID NO: 54. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 53 or SEQ ID NO: 54. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions".
Preferred skeletal muscle promoters are the myosin light-chain promoter, the myosin heavy-chain promoter, the desmin promoter, the muscle creatine kinase (MCK) promoter, the smooth muscle alpha-actin promoter, the CK6 promoter, the Unc-45 Myosin Chaperone B promoter, the basal MCK promoter in combination with copies of the MCK enhancer, the Enh358MCK promoter (combination of the MCK enhancer with the 358 bp proximal promoter of the MCK gene). A most preferred skeletal muscle promoter is the C5-12 promoter as defined in SEQ ID NO: 56. In this context a skeletal muscle promoter sequence may be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: 56. A preferred nucleotide sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 56. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained in the part of the description entitled "general definitions". A promoter as used herein (especially when the promoter sequence is defined as having a minimal identity percentage with a given SEQ ID NO) should exert at least an activity of a promoter as known to the skilled person. Please be referred to the part of the description entitled "general definitions" for a definition of such activity. Preferably a promoter defined as having a minimal identity percentage with a given SEQ ID NO should control transcription of the nucleotide sequence it is operably linked thereto (i.e. a nucleotide sequence encoding a FGF21) as assessed in an assay known to the skilled person. In the context of the invention, said promoter is operatively linked to the FGF21 nucleotide sequence defined above. In one embodiment, the promoter is cell-specific and/or tissue-specific, preferably specific for liver, adipose tissue and/or skeletal muscle.
Several viral expression constructs are therefore encompassed by the present invention: A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element a),
A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element b),
A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element c),
A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element d),
A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element e),
A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element b) and a nucleotide sequence of element c),
A viral expression construct comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and comprising element e) and a nucleotide sequence of element c).
In an embodiment there is provided a viral expression construct as described herein, wherein the liver-specific promoter is the human a 1 -antitrypsin (hAAT) promoter and/or the adipose tissue-specific promoter is the mini/ap2 promoter and/or the mini/UCPl promoter and/or the skeletal muscle promoter is the C5-12 promoter and/or the ubiquitous promoter is the cytomegalovirus (CMV) promoter and/or the CAG promoter.
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element a), wherein the liver-specific promoter is a hAAT promoter (SEQ ID NO: 47).
In a preferred embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element a) wherein said construct is AAV8-hAAT-moFGF21. This construct for example contains a viral expression construct as depicted in Figure 6A: ITR2-hAAT-moFGF21- polyA-ITR2; the sequence of this expression construct is comprised in SEQ ID NO:34. For this construct, Example 3 surprisingly reveals high and stable liver-specific expression after intravenous administration. Expression was shown to be stable for up to 1 year (Example 12). Extensive beneficial therapeutic effects for the reversion and treatment of obesity and diabetes are shown in ob/ob mice (Examples 3 and 11), high fat diet (HFD)-fed mice (Examples 4, 12-14) and old HFD-fed mice (Examples 5, 12-14). Examples 11 and 16 also reveal marked improvement of hepatic steatosis, hepatic inflammation and hepatic fibrosis. Example 15 shows improvement of the inflammation of WAT associated to obesity. Example 17 indicates the long-term safety of the therapy. Example 18 reveals a beneficial effect in preventing liver tumors. Example 19 shows therapeutic potential in a model for type I diabetes.
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element b), wherein the adipose tissue-specific promoter is a mini/aP2 promoter (SEQ ID NO: 54) and/or a mini/UCPl promoter (SEQ ID NO 55).
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element c), wherein the ubiquitous promoter is a CAG Promoter (SEQ ID NO: 44) and wherein the at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver is selected from the group consisting of SEQ ID NO: 12 or 14-23 and the at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart is selected from the group consisting of SEQ ID NO: 13 or 23-30.
In a preferred embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element c) wherein said construct is AAV9-CAG-moFGF21 -dmiRT or AAV8-CAG-moFGF21- dmiRT. The notations dmiRT and doublemiRT are equivalent. These constructs for example contain a viral expression construct as depicted in Figure 1A: ITR2-CAG- moFGF21-4x miRT122a-4x miRTl-polyA-ITR2; the sequence of this expression construct is comprised in SEQ ID NO:32. For these constructs, Examples 1 -2 surprisingly reveal high and stable adipose-specific expression after intra-eWAT administration. Extensive beneficial therapeutic effects for the prevention, reversion and treatment of obesity and diabetes are shown in normal mice (Example 1) and ob/ob mice (Examples 2 and 10). Example 10 also reveals improvement of hepatic steatosis.
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element d), wherein the skeletal muscle promoter is a C5-12 promoter (SEQ ID NO: 56).
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element e), wherein the ubiquitous promoter is a CMV promoter (SEQ ID NO: 45) and the AAV serotype is AAV1.
In a preferred embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element e) wherein said construct is AAV 1 -CMV-moFGF21. This construct for example contains a viral expression construct as depicted in Figure 11 A: ITR2-CMV-moFGF21-polyA- ITR2; the sequence of this expression construct is comprised in SEQ ID NO:36.
For this construct, Example 20 reveals high and stable skeletal muscle-specific expression after intramuscular administration. Extensive beneficial therapeutic effects for the prevention, reversion and treatment of obesity and diabetes are shown in HFD- fed mice (Examples 6 and 21). Example 20 reveals a beneficial effect in extending healthy lifespan by preventing obesity and diabetes.
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element b) and a nucleotide sequence of element c), wherein the adipose tissue-specific promoter is a mini/aP2 promoter (SEQ ID NO : 54) and/or the mini/UCP 1 promoter (SEQ ID NO 55).
In an embodiment, a viral expression construct is encompassed comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and element e) and a nucleotide sequence of element c), wherein the ubiquitous promoter is a CMV promoter (SEQ ID NO: 45) and the AAV serotype is AAV1.
All constructs of the invention are more attractive than the ones of the prior art, such as the one disclosed in Zhang et al, EBioMedicine 15 (2017) 173-183, especially the ones comprising element a) which is a liver-specific promoter, preferably hAAT, and/or element c) which is a combination of an ubiquitous promoter and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver, preferably miRT122a, and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, preferably miRTl, wherein said combination enables specific expression in adipose tissue, and/or element e) which is a combination of an ubiquitous promoter, preferably CMV, and an adeno-associated virus (AAV) vector sequence, preferably AAVl, wherein said combination enables specific expression in skeletal muscle. Zhang et al. discloses wild type murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183). This construct was compared with constructs of the invention in Examples 23 and 24. In all the in vitro and in vivo experiments, all expression cassettes and AAV vectors of the invention mediated higher expression of FGF21 in the target tissue or cell type and lower expression of FGF21 in off-target tissues, demonstrating higher efficiency of the expression cassettes and AAV vectors of the invention as well as higher tissue-specificity. In addition, constructs CMV-moFGF21 and C AG-moFGF21 -double miRT also mediated higher protein production and secretion to the culture media in HEK293 cells in comparison to EFla-mFGF21. Morevover, hAAT-moFGF21 and AAV8-hAAT-moFGF21 also mediated higher secretion of FGF21 to the bloodstream than EF 1 a-mFGF21 and AAV8-EF 1 a-mFGF21.
Additional sequences may be present in the viral expression construct of the invention as explained in detail in the part of the description entitled "general definitions". Preferred additional sequences include inverted terminal repeats (ITRs), a SV40 polyadenylation signal (SEQ ID NO: 50), a rabbit β-globin polyadenylation signal (SEQ ID NO: 51), a CMV enhancer sequence (SEQ ID NO: 46) and a HCR enhancer from apolipoprotein E (SEQ ID NO: 53). Within the context of the invention, "ITRs" is intended to encompass one 5'ITR and one 3'ITR, each being derived from the genome of an AAV. Preferred ITRs are from AAV2 and are represented by SEQ ID NO: 48 (5' ITR) and SEQ ID NO: 49 (3' ITR). Within the context of the invention, it is encompassed to use the CMV enhancer sequence (SEQ ID NO: 46) and the CMV promoter sequence (SEQ ID NO: 45) as two separate sequences or as a single sequence (SEQ ID NO: 52).
Each of these additional sequences may be present in the viral expression construct of the invention (see for example as depicted in Figures 1, 2, 3, 4, 5, 6, 7, 8 and 9 and also as depicted in Figures 11, 31 and 32).
In an embodiment, the viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and at least one of elements a) and/or b) and/or c) and/or d) and/or e) as earlier defined further comprises:
- ITRs that flank the expression cassette of said construct,
- SV40 or rabbit β-globin polyadenylation signals that are located at the 3' of the nucleotide sequence encoding the FGF21 and/or
- a CMV enhancer sequence or a HCR enhancer sequence that is located at the 5 ' of the nucleotide sequence encoding the FGF21.
In a preferred embodiment, the viral expression construct comprising a nucleotide sequence encoding FGF21 suitable for expression in a mammal and at least one of elements a) and/or b) and/or c) and/or d) and/or e) as earlier defined further comprises ITRs that flank the expression cassette of said construct and optionally
- SV40 or rabbit β-globin polyadenylation signals that are located at the 3' of the nucleotide sequence encoding the FGF21 and/or
- a CMV enhancer sequence or a HCR enhancer sequence that is located at the 5 ' of the nucleotide sequence encoding the FGF21.
These sequences were used in the experimental part in some of the constructs identified herein.
Therefore, in one embodiment, for each of these preferred viral expression constructs defined above an additional sequence may be present selected from the group consisting of: ITRs, SV40 polyadenylation signal, rabbit β-globin polyadenylation signal, CMV enhancer sequence, HCR enhancer sequence from apolipoprotein E.
In a preferred embodiment, the viral expression construct comprises a nucleotide sequence encoding FGF21 suitable for expression in a mammal and at least one of elements a) and/or b) and/or c) and/or d) and/or e), wherein an additional sequence is present which is selected from the group consisting of: ITRs, SV40 polyadenylation signal, rabbit β-globin polyadenylation signal, CMV enhancer sequence, HCR enhancer sequence. Preferred ITRs are those of AAV2 which are represented by SEQ ID NO: 48 (5' ITR) and SEQ ID NO: 49 (3' ITR).
Preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR. Other preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR. In addition, SV40 polyadenylation signals are present.
Other preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR. In addition, rabbit β-globin polyadenylation signals are present.
Other preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR. In addition, CMV enhancer sequence is present.
Other preferred viral expression constructs comprise elements a) and/or b) and/or c) and/or d) and/or e) and are such that the expression cassette is flanked by a 5'ITR and a 3 'ITR. In addition, HCR enhancer sequence from apolipoprotein E is present.
Most preferred designed viral expression constructs include:
Construct B (represented by a nucleotide sequence comprising SEQ ID NO: 32), Construct D (represented by a nucleotide sequence comprising SEQ ID NO: 34), Construct F (represented by a nucleotide sequence comprising SEQ ID NO: 36), Construct G (represented by a nucleotide sequence comprising SEQ ID NO: 37), Construct H (represented by a nucleotide sequence comprising SEQ ID NO: 38), Construct I (represented by a nucleotide sequence comprising SEQ ID NO: 39), Construct J (represented by a nucleotide sequence comprising SEQ ID NO: 40), Construct K (represented by a nucleotide sequence comprising SEQ ID NO: 41).
Construct L (represented by a nucleotide sequence comprising SEQ ID NO: 42). As the skilled person will understand, each of these viral expression constructs already comprise two ITRs from AAV2 (i.e. SEQ ID NO: 48 (5' ITR) and SEQ ID NO: 49 (3' ITR)). Constructs B and G comprise a rabbit β-globin polyadenylation signal. Construct F comprises a SV40 polyadenylation signal, a CMV enhancer sequence and a nucleotide sequence of a chimeric intron (composed of introns from human β-globin and immunoglobulin heavy chain genes). Constructs D, H-L comprise a SV40 polyadenylation signal, a HCR enhancer sequence and a nucleotide sequence of chimeric intron (composed of introns from human β-globin and immunoglobulin heavy chain genes).
As explained in the general part entitled "general definitions", throughout this application, each time one refers to a specific nucleotide sequence SEQ ID NO (take SEQ ID NO: A, B or C) representing the preferred constructs designed herein, one may replace it by:
i. a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: A, B or C;
ii. a nucleotide sequence the sequence of which differs from the sequence of a nucleic acid molecule of (i) due to the degeneracy of the genetic code.
Each nucleotide sequence described herein by virtue of its identity percentage (at least 60%) with a given nucleotide sequence respectively has in a further preferred embodiment an identity of at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more identity with the given nucleotide respectively. In a preferred embodiment, sequence identity is determined by comparing the whole length of the sequences as identified herein. Unless otherwise indicated herein, identity with a given SEQ ID NO means identity or similarity based on the full length of said sequence (i.e. over its whole length or as a whole).
A construct defined by its minimum identity (i.e. at least 60%) to a given SEQ ID NO as identified above is encompassed within the scope of the invention when this construct or a viral expression construct or a viral vector comprising this construct or a composition comprising this construct or vector is able to induce the expression of FGF21 in a cell, preferably in a liver cell, cell of adipose tissue or in a cell of skeletal muscle. The expression of FGF21 could be assessed using techniques known to the skilled person. In a preferred embodiment, said expression is assessed as carried out in the experimental part.
In a preferred embodiment, a viral expression construct is such that the construct is represented by a nucleotide sequence comprising SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11 or a sequence having at least 60% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11 or a sequence having at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11. Viral vector
In a further aspect, there is provided a viral vector comprising a viral expression construct as defined above, wherein said viral vector is an adenovirus vector, an adeno-associated virus vector, a retrovirus vector or a lentivirus vector, preferably an adeno-associated virus vector selected from the group consisting of an adeno-associated virus 1 (AAV1) vector, an adeno-associated virus 8 (AAV8) vector, and an adeno-associated virus 9 (AAV9) vector.
A "viral vector" and an "adeno-associated virus vector (AAV vector)" are further defined in the part of the description entitled "general definitions".
In an embodiment, an AAV vector is used comprising each of the elements defined earlier herein and a recombinant AAV (rAAV) based genome comprising a ITR or a part thereof. Preferred ITRs are those of AAV2 which are represented by SEQ ID NO: 48 (5 ' ITR) and SEQ ID NO: 49 (3' ITR).
Preferably, said AAV vector is an AAVl vector, an AAV8 vector or an AAV9 vector. A viral expression construct and a viral vector of the invention are preferably for use as a medicament. The medicament is preferably for preventing, delaying, curing, reverting and/or treating a metabolic disorder, preferably a diabetes and/or obesity. Diabetes may be Type 1 Diabetes, Type 2 Diabetes or Monogenic Diabetes. In another preferred embodiment, the medicament is for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis. In yet another preferred embodiment, the medicament is for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity. In yet another preferred embodiment, the medicament is for preventing, delaying, curing, reverting and/or treating cancer, preferably liver cancer.
The subject treated may be a higher mammal, e.g. cats, rodents, (preferably mice, rats, gerbils and guinea pigs, and more preferably mice and rats), or dogs, or human beings.
Nucleic acid molecule
In a further aspect, there is provided a nucleic acid molecule suitable for expression in a mammal and represented by a mammalian codon optimized nucleotide sequence encoding a FGF21 to be expressed in liver, adipose tissue and/or skeletal muscle.
The definition of "codon optimization" has been provided in the part of the description entitled "general definitions".
In an embodiment, a nucleic acid molecule is encompassed as described above, wherein the nucleotide sequence has at least 60% sequence identity with the nucleotide sequence of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11. A preferred nucleotide sequence has at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11.
Composition
In a further aspect there is provided a composition comprising a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above, together with one or more pharmaceutically acceptable excipients or vehicles.
This composition is preferably called a gene therapy composition. Preferably, the composition is a pharmaceutical composition said pharmaceutical composition comprising a pharmaceutically acceptable carrier, adjuvant, diluents, solubilizer, filler, preservative and/or excipient.
Such pharmaceutically acceptable carrier, filler, preservative, solubilizer, diluent and/or excipient may for instance be found in Remington: The Science and Practice of Pharmacy, 20th Edition. Baltimore, MD: Lippincott Williams & Wilkins, 2000.
In a preferred embodiment, said composition is for use as a medicament, preferably for preventing, delaying, curing, reverting and/or treating a metabolic disorder, preferably a diabetes and/or obesity. Diabetes may be Type 1 Diabetes, Type 2 Diabetes or Monogenic Diabetes. In another preferred embodiment, the medicament is for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis. In yet another preferred embodiment, the medicament is for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity. In yet another preferred embodiment, the medicament is for preventing, delaying, curing, reverting and/or treating cancer, preferably liver cancer. The subject treated may be a higher mammal, e.g. cats, rodent, (preferably mice, rats, gerbils and guinea pigs, and more preferably mice and rats), or dogs, or a human being.
Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for preventing, delaying, reverting, curing and/or treating a metabolic disorder, preferably a diabetes and/or obesity, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-diabetes effect and/or an anti-obesity effect.
Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-fibrotic effect.
Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-diabetes effect and/or an anti-obesity effect during aging.
Said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are preferably said to be able to be used for preventing, delaying, curing, reverting and/or treating cancer, preferably liver cancer, when said viral expression construct, viral vector and/or nucleic acid molecule and/or composition are able to exhibit an anti-cancer effect. An anti-diabetes effect may be reached when glucose disposal in blood is increased and/or when glucose tolerance is improved and/or when insulin sensitivity is increased. This could be assessed using techniques known to the skilled person or as done in the experimental part, preferably as assessed in example 8 or 9. In this context, "increase" (respectively "improvement") means at least a detectable increase (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part, such as measurement of glycaemia, insulinemia and/or performance of an insulin tolerance test and/or of a glucose tolerance test. The increase may be an increase of at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 100%) using assays such as the measurement of glycaemia, insulinemia and/or performance of an insulin tolerance test and/or of a glucose tolerance test.
An anti-obesity effect may be reached when body weight, body weight gain and/or body fat percentage is decreased. An anti-obesity effect may also be reached when body mass index (BMI), waist circumference, waist-to-hip ratio (WHR) and/or waist-to-height ratio (WHtR) is decreased. This could be assessed using techniques known to the skilled person or as done in the experimental part. In this context, "decrease" (respectively "improvement") means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part. Anti-obesity effects include both prevention of obesity and reversion of obesity, as evaluated by measurement of body weight of the individual, the BMI and/or weight of the tissues.
An anti-inflammatory effect in the liver may be reached by a decrease in macrophage infiltration, decreased pro-inflammatory cytokines. This could be assessed using techniques known to the skilled person or as done in the experimental part. In this context, "decrease" (respectively "improvement") means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
An anti-fibrotic effect in the liver may be reached by a decrease in deposited extracellular matrix proteins, blood markers (e.g. including N-terminal propeptide of type III collagen, hyaluronic acid, tissue inhibitor of metalloproteinase type 1 (TIMP-1), YKL-40, serum glutamate oxaloacetate transaminase (SGOT), serum glutamate pyruvic transaminase (SGPT) levels in the plasma). An anti-fibrotic effect may also be reached by an improvement in a fibrosis scoring system such as Metavir or Ishak. This could be assessed using techniques known to the skilled person or as done in the experimental part. In this context, "decrease" (respectively "improvement") means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
A healthy lifespan-extending effect may be reached when an anti-diabetes and/or anti- obesity effect as defined earlier herein is used to prevent, delay, cure, reverse or treat the onset or progression of a metabolic disorder associated with aging, preferably of a diabetes and/or obesity. A healthy lifespan-extending effect may also be reached by an increase in the healthy lifespan, wherein symptoms associated with metabolic disorders, preferably of a diabetes and/or obesity, are absent or reduced. A healthy-lifespan extending effect may also be reached by improved coordination and balance (assessed by Rota-Rod test), memory (assessed by Object Recognition Test), and/or neuromuscular coordination (assessed by Tightrope Test), decreased mitochondrial and metabolic deterioration (assessed by measurement of expression levels of genes involved in metabolism and mitochondrial function such as PGC-1 alpha, ATP synthase and ERRalpha). This could be assessed using techniques known to the skilled person or as done in the experimental part. In this context, "increase" (respectively "improvement") means at least a detectable increase (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part. An anti-cancer effect may be reached by a decrease in the cumulative incidence of cancer over the lifetime. This could be assessed using techniques known to the skilled person or as done in the experimental part. In this context, "decrease" (respectively "improvement") means at least a detectable decrease (respectively a detectable improvement) using an assay known to the skilled person or using assays as carried out in the experimental part.
An anti-diabetes effect and/or anti-obesity effect may also be observed when the progression of a typical symptom (e.g. insulitis, beta cell loss, increase of body weight) has been slowed down as assessed by a physician. A decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms. Symptoms, and thus also a decrease in symptoms, can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of diabetes and/or obesity, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, X- rays, biochemical, immunohistochemical and others.
An anti-inflammatory effect in the liver may also be observed when the progression of a typical symptom (e.g. fatigue, flu-like symptoms, dark urine, pale stool, abdominal pain, loss of appetite, unexplained weight loss, jaundice) has been slowed down as assessed by a physician. A decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms. Symptoms, and thus also a decrease in symptoms, can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of liver fibrosis, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, imaging methods (elastography, X- rays, MRI, CT, ultrasonography, angiography), biochemical, immunohistochemical and others.
An anti-fibrotic effect in the liver may also be observed when the progression of a typical symptom (e.g. liver stifness, jaundice, appetite loss, difficulty thinking clearly, fluid buildup in the legs or stomach, nausea, unexplained weight loss, weakness) has been slowed down as assessed by a physician. A decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms. Symptoms, and thus also a decrease in symptoms, can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of liver fibrosis, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, imaging methods (elastography, X-rays, MRI, CT, ultrasonography, angiography), biochemical, immunohistochemical and others.
An healthy lifespan-extending effect may also be observed when the progression of a typical symptom of metabolic disorders associated with aging (e.g. insulin resistance, glucose intolerance, increase of body weight) has been slowed down as assessed by a physician. A decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms. Symptoms, and thus also a decrease in symptoms, can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of diabetes and/or obesity, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, X-rays, biochemical, immunohistochemical and others.
An anti-cancer effect may also be observed when the progression of a typical symptom (e.g. tumor size, unexplained weight loss, loss of appetite, feeling very full after a small meal, nausea or vomiting, enlarged liver, enlarged spleen, pain in the abdomen or near the right shoulder blade, swelling or fluid build-up in the abdomen, itching, jaundice) has been slowed down as assessed by a physician. A decrease of a typical symptom may mean a slow down in progression of symptom development or a complete disappearance of symptoms. Symptoms, and thus also a decrease in symptoms, can be assessed using a variety of methods, to a large extent the same methods as used in diagnosis of cancer, including clinical examination and routine laboratory tests. Such methods include both macroscopic and microscopic methods, as well as molecular methods, imaging methods (X-rays, MRI, CT, ultrasonography, angiography), biochemical, immunohistochemical and others.
A medicament as defined herein (viral expression construct, viral vector, nucleic acid molecule, composition) is preferably able to alleviate one symptom or one characteristic of a patient or of a cell, tissue or organ of said patient if after at least one week, one month, six months, one year or more of treatment using a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention, said symptom or characteristic has decreased (e.g. is no longer detectable or has slowed down), as defined above.
A viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for use according to the invention may be suitable for administration to a cell, tissue and/or an organ in vivo of individuals affected by or at risk of developing a metabolic disorder, such as a diabetes and/or obesity, liver inflammation and/or fibrosis, a metabolic disorder associated with aging, and/or cancer, and may be administered in vivo, ex vivo or in vitro. Said viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or composition may be directly or indirectly administrated to a cell, tissue and/or an organ in vivo of an individual affected by or at risk of developing a metabolic disorder, such as a diabetes and/or obesity, liver inflammation and/or fibrosis, a metabolic disorder associated with aging, and/or cancer, and may be administered directly or indirectly in vivo, ex vivo or in vitro. An administration mode may be intravenous, subcutaneous, intramuscular, intrathecal, intraarticular, intraventricular, intraperitoneal, intra-adipose tissue, via inhalation, oral, intranasal, intrahepatic, intrasplanchnic, intra-ocular, intra-ear, topic administration and/or via retrograde intraductal pancreatic administration. A preferred administration mode is intramuscular, intravenous or intra-adipose tissue, as described in the "General procedures to the Examples" as part of this application.
A viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention may be directly or indirectly administered using suitable means known in the art. Improvements in means for providing an individual or a cell, tissue, organ of said individual with a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention are anticipated, considering the progress that has already thus far been achieved. Such future improvements may of course be incorporated to achieve the mentioned effect of the invention. A viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition can be delivered as is to an individual, a cell, tissue or organ of said individual. Depending on the disease or condition, a cell, tissue or organ of said individual may be as earlier defined herein. When administering a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition of the invention, it is preferred that such viral expression construct and/or vector and/or nucleic acid and/or composition is dissolved in a solution that is compatible with the delivery method.
As encompassed herein, a therapeutically effective dose of a viral expression construct, vector, nucleic acid molecule and/or composition as mentioned above is preferably administered in a single and unique dose hence avoiding repeated periodical administration. More preferably, the single dose is administered to skeletal muscle, to adipose tissue or intravenously.
A further compound may be present in a composition of the invention. Said compound may help in delivery of the composition. Below is provided a list of suitable compounds: compounds capable of forming complexes, nanoparticles, micelles and/or liposomes that deliver each constituent as defined herein, complexed or trapped in a vesicle or liposome through a cell membrane. Many of these compounds are known in the art. Suitable compounds comprise polyethylenimine (PEI), or similar cationic polymers, including polypropyleneimine or polyethylenimine copolymers (PECs) and derivatives, synthetic amphiphiles (SAINT-18), lipofectin™, DOTAP.
Depending on their identity, the skilled person will know which type of formulation is the most appropriate for the composition as defined herein.
Method/Use
In a further aspect there is provided a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above, for use as a medicament.
In an embodiment, said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in the treatment and/or prevention of a metabolic disorder, preferably a diabetes and/or obesity. Complications of a metabolic disorder may also be encompassed.
In another embodiment, said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in the treatment and/or prevention of liver inflammation and/or fibrosis. Complications of liver inflammation and/or fibrosis may also be encompassed.
In yet another embodiment, said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity.
In yet another embodiment, said viral expression construct and/or viral vector and/or nucleic acid molecule and/or composition is provided for use in the treatment and/or prevention of cancer, preferably liver cancer. Complications of a cancer may also be encompassed.
In a further aspect there is provided a method for preventing, delaying, reverting, curing and/or treating a metabolic disorder, preferably a diabetes and/or obesity and their complications, comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above. Such a method is preferably for alleviating one or more symptom(s) of a metabolic disorder, such as a diabetes and/or obesity, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein.
In a further aspect there is provided a method for preventing, delaying, reverting, curing and/or treating liver inflammation and/or fibrosis and its complications, comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above. Such a method is preferably for alleviating one or more symptom(s) of liver inflammation and/or fibrosis, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein.
In a further aspect there is provided a method for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity, comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above.
Such a method is preferably for alleviating one or more symptom(s) of a metabolic disorder associated with aging, such as a diabetes and/or obesity, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein.
In a further aspect there is provided a method for preventing, delaying, reverting, curing and/or treating cancer, preferably liver cancer and its complications, comprising the use of a viral expression construct as defined above and/or a viral vector as defined above and/or a nucleic acid molecule as defined above and/or a composition as defined above. Such a method is preferably for alleviating one or more symptom(s) of cancer, such as liver cancer, in an individual, in a cell, tissue or organ of said individual or alleviate one or more characteristic(s) or symptom(s) of a cell, tissue or organ of said individual, the method comprising administering to said individual a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein. In the context of the invention there is provided a use of a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating a metabolic disorder, preferably a diabetes and/or obesity.
In the context of the invention there is provided a use of a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for preventing, delaying, curing, reverting and/or treating liver inflammation and/or fibrosis.
In the context of the invention there is provided a use of a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for extending healthy lifespan, preferably by preventing, delaying, curing, reverting and/or treating a metabolic disorder associated with aging, preferably a diabetes and/or obesity.
In the context of the invention there is provided a use of a viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition as defined herein for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating cancer, preferably liver cancer.
Metabolic disorders include metabolic syndrome, diabetes, obesity, obesity-related comorbidities, diabetes-related comorbidities, hyperglycaemia, insulin resistance, glucose intolerance, hepatic steatosis, alcoholic liver diseases (ALD), non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), coronary heart disease (CHD), hyperlipidemia, atherosclerosis, endocrinophaties, osteosarcopenic obesity syndrome (OSO), diabetic nephropaty, chronic kidney disease (CKD), cardiac hypertrophy, diabetic retinopathy, diabetic nephropathy, diabetic neuropathy, arthritis, sepsis, ocular neovascularization, neurodegeneration, dementia, and may also include depression, adenoma, carcinoma.
Diabetes includes prediabetes, hyperglycaemia, Type 1 diabetes, Type 2 diabetes, maturity-onset diabetes of the young (MODY), monogenic diabetes, neonatal diabetes, gestational diabetes, brittle diabetes, idiopathic diabetes, drug- or chemical-induced diabetes, Stiff-man syndrome, lipoatrophic diabetes, latent autoimmune diabetes in adults (LADA).
Obesity includes overweight, central/upper body obesity, peripheral/lower body obesity, morbid obesity, osteosarcopenic obesity syndrome (OSO), pediatric obesity, Mendelian (monogenic) syndromic obesity, Mendelian non-syndromic obesity, polygenic obesity. Metabolic disorders, diabetes, obesity and the type of subject treated have been earlier defined herein.
Liver inflammation and/or fibrosis includes automimmune hepatitis, viral hepatitis including hepatitis A, B, C, D and E, alcoholic hepatitis, non-alcoholic steatohepatitis (NASH) and liver cirrhosis.
Cancer includes astrocytoma, glioma, leukemia, lymphoma, melanoma, myeloma, neuroblastoma, sarcoma (including chondrosarcoma, fibrosarcoma, rhabdomyoscaroma, and osteosarcoma), schwannoma, seminoma, and carcinomas of the bladder, breast, cervix, colon, endometrium, esophagus, gallbladder, kidney, liver, lung, ovary, prostate, pancreas, rectum, skin, stomach and thyroid. A preferred cancer is liver cancer, preferably hepatocellular carcinoma. In one embodiment said method or use is performed in vitro, for instance using a cell culture. Preferably, said method or use is in vivo. Each feature of these methods/uses has already been defined herein.
In a method of the invention, a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for treating metabolic disorders, preferably diabetes and/or obesity in an individual.
In another method of the invention, a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for treating liver inflammation and/or fibrosis.
In yet another method of the invention, a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for extending healthy lifespan.
In yet another method of the invention, a viral expression construct and/or a vector and/or a nucleic acid molecule and/or a composition may be combined with an additional compound known to be used for treating cancer, preferably liver cancer. In a preferred embodiment, a treatment in a use or in a method according to the invention does not have to be repeated. Alternatively in a use or a method according to the invention said administration of the viral expression construct or of said composition may be repeated each year or each 2, 3, 4, 5, 6 years.
General definitions Identity/ similarity
In the context of the invention, a protein fragment or a polypeptide or a peptide or a derived peptide as Fibroblast growth factor 21 (FGF21) is represented by an amino acid sequence.
In the context of the invention, a nucleic acid molecule as a nucleic acid molecule encoding a FGF21 is represented by a nucleic acid or nucleotide sequence which encodes a protein fragment or a polypeptide or a peptide or a derived peptide. A nucleic acid molecule may comprise a regulatory region.
It is to be understood that each nucleic acid molecule or protein fragment or polypeptide or peptide or derived peptide or construct as identified herein by a given Sequence Identity Number (SEQ ID NO) is not limited to this specific sequence as disclosed. Each coding sequence as identified herein encodes a given protein fragment or polypeptide or peptide or derived peptide or construct or is itself a protein fragment or polypeptide or construct or peptide or derived peptide. Throughout this application, each time one refers to a specific nucleotide sequence SEQ ID NO (take SEQ ID NO: X as example) encoding a given protein fragment or polypeptide or peptide or derived peptide, one may replace it by:
i. a nucleotide sequence comprising a nucleotide sequence that has at least 60% sequence identity or similarity with SEQ ID NO: X;
ii. a nucleotide sequence the sequence of which differs from the sequence of a nucleic acid molecule of (i) due to the degeneracy of the genetic code; or,
iii. a nucleotide sequence that encodes an amino acid sequence that has at least 60% amino acid identity or similarity with an amino acid sequence encoded by a nucleotide sequence SEQ ID NO: X.
Throughout this application, each time one refers to a specific amino acid sequence SEQ ID NO (take SEQ ID NO: Y as example), one may replace it by: a polypeptide comprising an amino acid sequence that has at least 60% sequence identity or similarity with amino acid sequence SEQ ID NO: Y.
Each nucleotide sequence or amino acid sequence described herein by virtue of its identity or similarity percentage (at least 60%) with a given nucleotide sequence or amino acid sequence respectively has in a further preferred embodiment an identity or a similarity of at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more identity or similarity with the given nucleotide or amino acid sequence respectively. In a preferred embodiment, sequence identity or similarity is determined by comparing the whole length of the sequences as identified herein. Unless otherwise indicated herein, identity or similarity with a given SEQ ID NO means identity or similarity based on the full length of said sequence (i.e. over its whole length or as a whole).
Each non-coding nucleotide sequence (i.e. of a promoter or of another regulatory region) could be replaced by a nucleotide sequence comprising a nucleotide sequence that has at least 60%) sequence identity or similarity with a specific nucleotide sequence SEQ ID NO (take SEQ ID NO: A as example). A preferred nucleotide sequence has at least 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% identity with SEQ ID NO: A. Identity may be assessed over the whole SEQ ID NO or over part thereof as explained herein. In a preferred embodiment, such non-coding nucleotide sequence such as a promoter exhibits or exerts at least an activity of such a non-coding nucleotide sequence such as an activity of a promoter as known to the skilled person.
"Sequence identity" is herein defined as a relationship between two or more amino acid (polypeptide or protein) sequences or two or more nucleic acid (polynucleotide) sequences, as determined by comparing the sequences. In a preferred embodiment, sequence identity is calculated based on the full length of two given SEQ ID NO or on part thereof. Part thereof preferably means at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% of both SEQ ID NO. In the art, "identity" also means the degree of sequence relatedness between amino acid or nucleic acid sequences, as the case may be, as determined by the match between strings of such sequences.
"Similarity" between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide. "Identity" and "similarity" can be readily calculated by known methods, including but not limited to those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heine, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988).
Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Preferred computer program methods to determine identity and similarity between two sequences include e.g. the GCG program package (Devereux, J., et al, Nucleic Acids Research 12 (1): 387 (1984)), BestFit, BLASTP, BLASTN, and FASTA (Altschul, S. F. et al, J. Mol. Biol. 215:403-410 (1990). The BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al, NCBI NLM NIH Bethesda, MD 20894; Altschul, S., et al, J. Mol. Biol. 215:403-410 (1990). The well-known Smith Waterman algorithm may also be used to determine identity.
Preferred parameters for polypeptide sequence comparison include the following: Algorithm: Needleman and Wunsch, J. Mol. Biol. 48:443-453 (1970); Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff, Proc. Natl. Acad. Sci. USA. 89: 10915-10919 (1992); Gap Penalty: 12; and Gap Length Penalty: 4. A program useful with these parameters is publicly available as the "Ogap" program from Genetics Computer Group, located in Madison, WI. The aforementioned parameters are the default parameters for amino acid comparisons (along with no penalty for end gaps). Preferred parameters for nucleic acid comparison include the following: Algorithm: Needleman and Wunsch, J. Mol. Biol. 48:443-453 (1970); Comparison matrix: matches=+10, mismatch=0; Gap Penalty: 50; Gap Length Penalty: 3. Available as the Gap program from Genetics Computer Group, located in Madison, Wis. Given above are the default parameters for nucleic acid comparisons.
Optionally, in determining the degree of amino acid similarity, the skilled person may also take into account so-called "conservative" amino acid substitutions, as will be clear to the skilled person. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulphur-containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine - leucine-isoleucine, phenylalanine -tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine. Substitutional variants of the amino acid sequence disclosed herein are those in which at least one residue in the disclosed sequences has been removed and a different residue inserted in its place. Preferably, the amino acid change is conservative. Preferred conservative substitutions for each of the naturally occurring amino acids are as follows: Ala to Ser; Arg to Lys; Asn to Gin or His; Asp to Glu; Cys to Ser or Ala; Gin to Asn; Glu to Asp; Gly to Pro; His to Asn or Gin; He to Leu or Val; Leu to He or Val; Lys to Arg; Gin or Glu; Met to Leu or He; Phe to Met, Leu or Tyr; Ser to Thr; Thr to Ser; Trp to Tyr; Tyr to Trp or Phe; and, Val to He or Leu. Gene or coding sequence
"Gene" or "coding sequence" or "nucleic acid" or "nucleotide sequence" or "nucleic" refers to a DNA or RNA region (the transcribed region) which "encodes" a particular protein such as a FGF21. A coding sequence is transcribed (DNA) and translated (RNA) into a polypeptide when placed under the control of an appropriate regulatory region, such as a promoter. A gene may comprise several operably linked fragments, such as a promoter, a 5' leader sequence, an intron, a coding sequence and a 3' nontranslated sequence or 3' untranslated region (3' UTR), comprising a polyadenylation site or a signal sequence. A chimeric or recombinant gene (such as a FGF21 gene) is a gene not normally found in nature, such as a gene in which for example the promoter is not associated in nature with part or all of the transcribed DNA region. "Expression of a gene" refers to the process wherein a gene is transcribed into an RNA and/or translated into an active protein. Promoter
As used herein, the term "promoter" refers to a nucleic acid fragment that functions to control the transcription of one or more genes (or coding sequence), located upstream with respect to the direction of transcription of the transcription initiation site of the gene, and is structurally identified by the presence of a binding site for DNA-dependent R A polymerase, transcription initiation sites and any other DNA sequences, including, but not limited to transcription factor binding sites, repressor and activator protein binding sites, and any other sequences of nucleotides known to one of skill in the art to act directly or indirectly to regulate the amount of transcription from the promoter. A "constitutive" promoter is a promoter that is active under most physiological and developmental conditions. An "inducible" promoter is a promoter that is regulated depending on physiological or developmental conditions. A "organ-specific" or "tissue-specific" promoter is a promoter that is active in a specific type of organ or tissue, respectively. Organ-specific and tissue-specific promoters regulate expression of one or more genes (or coding sequence) primarily in one organ or tissue, but can allow detectable level ("leaky") expression in other organs or tissues as well. Leaky expression in other organs or tissues means at least one-fold, at least two-fold, at least three-fold, at least four-fold or at least five-fold lower, but still detectable expression as compared to the organ- specific or tissue-specific expression, as evaluated by standard assays known to the skilled person (e.g. PCR, Western blot analysis, ELISA). The maximum number of organs or tissues where leaky expression may be detected is five, six, seven or eight. An "adipose tissue-specific promoter" is a promoter that is capable of initiating transcription in the adipose tissue, whilst still allowing for any leaky expression in other (maximum five, six, seven or eight) organs and parts of the body. Transcription in the adipose tissue can be detected in adipose tissue and adipose cells, such as white adipocytes, brown adipocytes, beige adipocytes, preadipocytes, stromal vascular cells. A "liver-specific promoter" is a promoter that is capable of initiating transcription in the liver, whilst still allowing for any leaky expression in other (maximum five, six, seven or eight) organs and parts of the body. Transcription in the liver can be detected in liver tissue and liver cells, such as hepatocytes, Kupffer cells and/or oval cells. Similarly, a "skeletal muscle promoter" is a promoter that is capable of initiating transcription in skeletal muscle, whilst still allowing for any leaky expression in other (maximum five, six, seven or eight) organs and parts of the body. Transcription in the skeletal muscle can be detected in skeletal muscle cells, such as myocytes, myoblasts, satellite cells.
A "ubiquitous promoter" is active in substantially all tissues, organs and cells of an organism.
Suitable promoters for organ-specific and/or tissue-specific expression of a nucleotide sequence encoding a FGF21 include the human a 1 -antitrypsin promoter, the al- antitrypsin promoter in combination with the hepatocyte control region (HCR) enhancer from the apolipoprotein E, the albumin promoter, the major urinary protein promoter, the phosphoenolpyruvate carboxykinase (PEPCK) promoter, the liver-enriched protein activator promoter, the transthyretin promoter, the thyroxine binding globulin promoter, the apolipoprotein Al promoter, the liver fatty acid binding protein promoter, the phenylalanine hydroxylase promoter, the adipocyte protein 2 (aP2, also known as fatty acid binding protein 4 (FABP4)) promoter, the PPARy promoter, the adiponectin promoter, the phosphoenolpyruvate carboxykinase (PEPCK) promoter, the promoter derived from human aromatase cytochrome p450 (p450arom) the mini/aP2 promoter (composed of the adipose-specific aP2 enhancer and the basal aP2 promoter), the uncoupling protein 1 (UCP1) promoter, the mini/UCPl promoter (composed of the adipose-specific UCP1 enhancer and the basal UCP1 promoter), the adipsin promoter, the leptin promoter, the Foxa-2 promoter, the myosin light-chain promoter, the myosin heavy-chain promoter, the desmin promoter, the C5-12 promoter, the muscle creatine kinase (MCK) promoter, the smooth muscle alpha-actin promoter, the CK6 promoter, the Unc-45 Myosin Chaperone B promoter, the basal MCK promoter in combination with copies of the MCK enhancer, the Enh358MCK promoter (combination of the MCK enhancer with the 358 bp proximal promoter of the MCK gene).
Operably linked
"Operably linked" is defined herein as a configuration in which a control sequence such as a promoter sequence or regulating sequence is appropriately placed at a position relative to the nucleotide sequence of interest, preferably coding for a FGF21 such that the promoter or control or regulating sequence directs or affects the transcription and/or production or expression of the nucleotide sequence of interest, preferably encoding a FGF21 in a cell and/or in a subject. For instance, a promoter is operably linked to a coding sequence if the promoter is able to initiate or regulate the transcription or expression of a coding sequence, in which case the coding sequence should be understood as being "under the control of the promoter. When one or more nucleotide sequences and/or elements comprised within a construct are defined herein to be "configured to be operably linked to an optional nucleotide sequence of interest", said nucleotide sequences and/or elements are understood to be configured within said construct in such a way that these nucleotide sequences and/or elements are all operably linked to said nucleotide sequence of interest once said nucleotide sequence of interest is present in said construct. Viral expression construct
An expression construct carries a genome that is able to stabilize and remain episomal in a cell. Within the context of the invention, a cell may mean to encompass a cell used to make the construct or a cell wherein the construct will be administered. Alternatively a construct is capable of integrating into a cell's genome, e.g. through homologous recombination or otherwise. A particularly preferred expression construct is one wherein a nucleotide sequence encoding a FGF21 as defined herein is operably linked to a promoter as defined herein wherein said promoter is capable of directing expression of said nucleotide sequence {i.e. coding sequence) in a cell. Preferably, said promoter directs expression of said nucleotide sequence in at least one cell of a specific organ and/or a specific tissue. Preferably, said promoter directs expression of said nucleotide sequence in at least one cell of liver, adipose tissue and/or skeletal muscle. Preferably, said promoter directs expression in at least 10%, 20%, 30%, 40%, 40%, 60%, 70%, 80%, 90%), or 100%) of cells of liver, adipose tissue and/or skeletal muscle. In the context of the invention, a FGF21 to be expressed in the liver, adipose tissue or skeletal muscle refers to the preferential or predominant (at least 10% higher, at least 20% higher, at least 30% higher, at least 40% higher, at least 50% higher, at least 60% higher, at least 70% higher, at least 80% higher, at least 90% higher, at least 100% higher, at least 150% higher, at least 200% higher or more) expression of FGF21 in the liver, adipose tissue or skeletal muscle as compared to other organs or tissues. Throughout the application, where liver-specific, or adipose-specific or skeletal muscle-specific is mentioned in the context of expression, cell-type specific expression of the cell type(s) making up the liver, the adipose tissue or skeletal muscle is also envisaged, respectively. The viral expression constructs of the invention comprise a nucleotide sequence in a form "suitable for expression in a mammal", which means that the viral expression constructs include one or more regulatory sequences, selected on the basis of the mammalian host cells to be used for expression, that is operatively linked to the nucleotide sequence to be expressed. Preferably, said mammalian host cells to be used for expression are human, murine or canine cells.
The viral expression constructs of the invention comprise a nucleotide sequence to be expressed in liver, adipose tissue and/or skeletal muscle.
As used herein, "adipose tissue" refers to tissue composed of mature adipocytes (i.e. fat cells) and a combination of small blood vessels, nerve tissue, lymph nodes and the stromal vascular fraction (SVF). The SVF is composed of endothelial cells, fibroblasts, adipocyte precursor cells (i.e. preadipocytes), and immune cells such as macrophages and T cells. In mammals, two different types of adipose tissues are traditionally distinguished: the white adipose tissue (WAT) and the brown adipose tissue (BAT). In mammals, the adipose tissue is contained in a multi-depot organ. Adipose depots include but are not limited to epidydymal WAT (eWAT), inguinal WAT (iWAT), retroperitoneal WAT (rWAT), mesenteric WAT (mWAT), interscapular BAT (iBAT).
As used herein, "skeletal muscle" refers to the tissue composed of muscle fibers. A muscle fiber, also known as a myofiber, is a single multinucleated or syncitial cell that results from the fusion of many hundreds of myoblasts, some of which remain in the mature muscle as undifferentiated cells known as satellite cells. Individual muscle fibers are surrounded by a connective tissue called endomysium. Around 10 to 100 muscle fibers form fascicles, or bundles, which are themselves surrounded by another connective tissue layer called the perimysium. Finally, the skeletal muscle is formed by groups of fascicles that are surrounded also by another connective tissue layer called the epimysium. In addition to muscle fibers, skeletal muscle is also composed of numerous blood vessels and nerves. The ends of muscles converge in dense connective tissue structures, the tendons and aponeuroses that mediate attachment of muscles to the periosteum of bones or to the connective tissue of other muscles. As used herein, "liver" refers to the tissue composed of hepatocytes. Hepatocytes represent about 50-70% of the cells in the liver. In addition to hepatocytes, the liver is composed of endothelial cells, perisinusoidal cells, oval cells, Kupffer cells and stellate cells (Ito cells). When activated by Kupffer cells, the stellate cells transform into myofibroblasts. Central veins and portal tracks (portal triads) that contain preterminal branches of the hepatic artery, the hepatic portal vein, bile ductules and lymphatic vessels are also found in the liver.
Such a preferred expression construct is said to comprise an expression cassette. An expression cassette as used herein comprises or consists of a nucleotide sequence encoding a FGF21 , being operably linked to a promoter wherein said promoter is capable of directing expression of said nucleotide sequence. In an embodiment, an expression cassette as used herein comprises or consists of a nucleotide sequence encoding a FGF21 , a promoter and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart. In one embodiment the described expression cassettes contain nucleotide sequences encoding target sequences for a microRNA expressed in the liver and/or a microRNA expressed in the heart with perfect complementarity to their cognate microRNAs. In another embodiment, the described expression cassettes contain one or more nucleotide sequence(s) encoding microRNA binding sites with imperfect complementarity (one mismatch/five consecutive nucleotides). In yet another embodiment, the expression cassettes may contain both nucleotide sequences encoding perfect and imperfect microRNA binding sites. Expression cassettes can therefore be tailored to result in varying levels of regulation by using nucleotide sequences encoding single perfect, multiple perfect, single imperfect, multiple imperfect or a combination of perfect and imperfect target sites for microRNAs. Further, nucleotide sequence encoding target sites for different microRNAs may be used, therefore permitting a gene to be regulated by multiple microRNAs. A preferred location for the nucleotide sequence encoding a target sequence of a microRNA is the 3'UTR. However, nucleotide sequences (encoding target sequences) inserted into either a coding sequence or 5 'UTR sequences may also be used.
The choice of nucleotide sequence encoding a target sequence of a microRNA is determined by the desired expression pattern. The presence of an endogenous microRNA in a cell will inhibit expression of a gene or coding sequence from an expression construct which contains a nucleotide sequence encoding a target sequence for said microRNA. For expression of the gene or coding sequence of interest to be inhibited in a given cell- type, a nucleotide sequence encoding a target sequence that is recognized by a microRNA present in that cell-type is chosen.
A viral expression construct is an expression construct which is intended to be used in gene therapy. It is designed to comprise part of a viral genome as later defined herein. Expression constructs disclosed herein could be prepared using recombinant techniques in which a nucleotide sequence encoding said FGF21 is expressed in a suitable cell, e.g. cultured cells or cells of a multicellular organism, such as described in Ausubel et ah, "Current Protocols in Molecular Biology", Greene Publishing and Wiley-Interscience, New York (1987) and in Sambrook and Russell (2001, supra); both of which are incorporated herein by reference in their entirety. Also see, Kunkel (1985) Proc. Natl. Acad. Sci. 82:488 (describing site directed mutagenesis) and Roberts et al. (1987) Nature 328:731-734 or Wells, J.A., et al. (1985) Gene 34: 315 (describing cassette mutagenesis). Typically, a nucleic acid or nucleotide sequence encoding a FGF21 is used in an expression construct or expression vector. The phrase "expression vector" or "vector" generally refers to a nucleotide sequence that is capable of effecting expression of a gene or a coding sequence in a host compatible with such sequences. These expression vectors typically include at least suitable promoter sequences and optionally, transcription termination signals. An additional factor necessary or helpful in effecting expression can also be used as described herein. A nucleic acid or DNA or nucleotide sequence encoding a FGF21 is incorporated into a DNA construct capable of introduction into and expression in an in vitro cell culture. Specifically, a DNA construct is suitable for replication in a prokaryotic host, such as bacteria, e.g., E. coli, or can be introduced into a cultured mammalian, plant, insect, (e.g., Sf9), yeast, fungi or other eukaryotic cell lines. A DNA construct prepared for introduction into a particular host may include a replication system recognized by the host, an intended DNA segment encoding a desired polypeptide, and transcriptional and translational initiation and termination regulatory sequences operably linked to the polypeptide-encoding segment. The term "operably linked" has already been defined herein. For example, a promoter or enhancer is operably linked to a coding sequence if it stimulates the transcription of the sequence. DNA for a signal sequence is operably linked to DNA encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of a polypeptide. Generally, a DNA sequence that is operably linked are contiguous, and, in the case of a signal sequence, both contiguous and in reading frame. However, enhancers need not be contiguous with a coding sequence whose transcription they control. Linking is accomplished by ligation at convenient restriction sites or at adapters or linkers inserted in lieu thereof, or by gene synthesis.
The selection of an appropriate promoter sequence generally depends upon the host cell selected for the expression of a DNA segment. Examples of suitable promoter sequences include prokaryotic, and eukaryotic promoters well known in the art (see, e.g. Sambrook and Russell, 2001, supra). A transcriptional regulatory sequence typically includes a heterologous enhancer or promoter that is recognised by the host. The selection of an appropriate promoter depends upon the host, but promoters such as the trp, lac and phage promoters, tRNA promoters and glycolytic enzyme promoters are known and available (see, e.g. Sambrook and Russell, 2001, supra). An expression vector includes the replication system and transcriptional and translational regulatory sequences together with the insertion site for the polypeptide encoding segment. In most cases, the replication system is only functional in the cell that is used to make the vector (bacterial cell as E. Coli). Most plasmids and vectors do not replicate in the cells infected with the vector. Examples of workable combinations of cell lines and expression vectors are described in Sambrook and Russell (2001, supra) and in Metzger et al. (1988) Nature 334: 31-36. For example, suitable expression vectors can be expressed in, yeast, e.g. S.cerevisiae, e.g., insect cells, e.g., Sf9 cells, mammalian cells, e.g., CHO cells and bacterial cells, e.g., E. coli. A cell may thus be a prokaryotic or eukaryotic host cell. A cell may be a cell that is suitable for culture in liquid or on solid media.
Alternatively, a host cell is a cell that is part of a multicellular organism such as a transgenic plant or animal.
Viral vector
A viral vector or a viral gene therapy vector is a vector that comprises a viral expression construct as defined above.
A viral vector or a viral gene therapy vector is a vector that is suitable for gene therapy. Vectors that are suitable for gene therapy are described in Anderson 1998, Nature 392: 25-30; Walther and Stein, 2000, Drugs 60: 249-71; Kay et al, 2001, Nat. Med. 7: 33-40; Russell, 2000, J. Gen. Virol. 81 : 2573-604; Amado and Chen, 1999, Science 285: 674- 6; Federico, 1999, Curr. Opin. Biotechnol.10: 448-53; Vigna and Naldini, 2000, J. Gene Med. 2: 308-16; Marin et al, 1997, Mol. Med. Today 3: 396-403; Peng and Russell, 1999, Curr. Opin. Biotechnol. 10: 454-7; Sommerfelt, 1999, J. Gen. Virol. 80: 3049-64; Reiser, 2000, Gene Ther. 7: 910-3; and references cited therein.
A particularly suitable gene therapy vector includes an adenoviral and adeno-associated virus (AAV) vector. These vectors infect a wide number of dividing and non-dividing cell types including synovial cells and liver cells. The episomal nature of the adenoviral and AAV vectors after cell entry makes these vectors suited for therapeutic applications, (Russell, 2000, J. Gen. Virol. 81 : 2573-2604; Goncalves, 2005, Virol J. 2(1):43) as indicated above. AAV vectors are even more preferred since they are known to result in very stable long term expression of transgene expression (up to 9 years in dog (Niemeyer et al, Blood. 2009 Jan 22;113(4):797-806) and ~ 10 years in human (Buchlis, G. et al, Blood. 2012 Mar 29; 119(13):3038-41). Preferred adenoviral vectors are modified to reduce the host response as reviewed by Russell (2000, supra). Method for gene therapy using AAV vectors are described by Wang et al, 2005, J Gene Med. March 9 (Epub ahead of print), Mandel et al, 2004, Curr Opin Mol Ther. 6(5):482-90, and Martin et al, 2004, Eye 18(11): 1049-55, Nathwani et al, N Engl J Med. 2011 Dec 22;365(25):2357- 65, Apparailly et al, Hum Gene Ther. 2005 Apr;16(4):426-34.
Another suitable gene therapy vector includes a retroviral vector. A preferred retroviral vector for application in the present invention is a lentiviral based expression construct. Lentiviral vectors have the ability to infect and to stably integrate into the genome of dividing and non-dividing cells (Amado and Chen, 1999 Science 285: 674-6). Methods for the construction and use of lentiviral based expression constructs are described in U.S. Patent No.'s 6,165,782, 6,207,455, 6,218,181, 6,277,633 and 6,323,031 and in Federico (1999, Curr Opin Biotechnol 10: 448-53) and Vigna et al (2000, J Gene Med 2000; 2: 308-16).
Other suitable gene therapy vectors include an adenovirus vector, a herpes virus vector, a polyoma virus vector or a vaccinia virus vector.
A gene therapy vector comprises a nucleotide sequence encoding a FGF21 to be expressed, whereby said nucleotide sequence is operably linked to the appropriate regulatory sequences. Such regulatory sequence will at least comprise a promoter sequence. Suitable promoters for expression of a nucleotide sequence encoding a FGF21 from a gene therapy vector include e.g. CMV promoter, viral long terminal repeat promoters (LTRs), such as those from murine moloney leukaemia virus (MMLV) rous sarcoma virus, or HTLV-1, the simian virus 40 (SV 40) early promoter, the CAG promoter, the a 1 -antitrypsin promoter, the mini/aP2 promoter, the mini/UCPl promoter, the C5-12 promoter and the herpes simplex virus thymidine kinase promoter.
Several inducible promoter systems have been described that may be induced by the administration of small organic or inorganic compounds. Such inducible promoters include those controlled by heavy metals, such as the metallothionine promoter (Brinster et al. 1982 Nature 296: 39-42; Mayo et al. 1982 Cell 29: 99-108), RU-486 (a progesterone antagonist) (Wang et al. 1994 Proc. Natl. Acad. Sci. USA 91 : 8180-8184), steroids (Mader and White, 1993 Proc. Natl. Acad. Sci. USA 90: 5603-5607), tetracycline (Gossen and Bujard 1992 Proc. Natl. Acad. Sci. USA 89: 5547-5551; U.S. Pat. No. 5,464,758; Furth et al. 1994 Proc. Natl. Acad. Sci. USA 91 : 9302-9306; Howe et al. 1995 J. Biol. Chem. 270: 14168-14174; Resnitzky et al. 1994 Mol. Cell. Biol. 14: 1669-1679; Shockett et al. 1995 Proc. Natl. Acad. Sci. USA 92: 6522-6526) and the tTAER system that is based on the multi-chimeric transactivator composed of a tetR polypeptide, as activation domain of VP 16, and a ligand binding domain of an estrogen receptor (Yee et al, 2002, US 6,432,705).
A gene therapy vector may optionally comprise a further nucleotide sequence coding for a further polypeptide.
A gene therapy vector is preferably formulated in a composition or pharmaceutical composition as defined herein. In this context, a composition or pharmaceutical composition may comprise a suitable pharmaceutical carrier as earlier defined herein. Adeno-associated virus vector (AAV vector)
A preferred viral vector or a preferred gene therapy vector is an AAV vector. An AAV vector as used herein preferably comprises a recombinant AAV vector (rAAV vector). A "rAAV vector" as used herein refers to a recombinant vector comprising part of an AAV genome encapsidated in a protein shell of capsid protein derived from an AAV serotype as explained herein. Part of an AAV genome may contain the inverted terminal repeats (ITR) derived from an adeno-associated virus serotype, such as AAVl, AAV2, AAV3, AAV4, AAV5 and others. Preferred ITRs are those of AAV2 which are represented by sequences comprising or consisting of SEQ ID NO: 48 (5 ' ITR) and SEQ ID NO: 49 (3' ITR). The invention also preferably encompasses the use of a sequence having at least 80% (or at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identity with SEQ ID NO: 48 as 5 'ITR and a sequence having at least 80% identity with SEQ ID NO: 49 as 3 'ITR.
Protein shell comprised of capsid protein may be derived from an AAV serotype such as AAV1 , 2, 3, 4, 5 and others. A preferred AAV capsid is an AAV1 , AAV3, AAV8, AAV9 capsid. A preferred ITR is from the AAV2. A protein shell may also be named a capsid protein shell. rAAV vector may have one or preferably all wild type AAV genes deleted, but may still comprise functional ITR nucleic acid sequences. Functional ITR sequences are necessary for the replication, rescue and packaging of AAV virions. The ITR sequences may be wild type sequences or may have at least 80%>, 85%, 90%>, 95%, 97%, 98%), 99% or 100% sequence identity with wild type sequences or may be altered by for example in insertion, mutation, deletion or substitution of nucleotides, as long as they remain functional. In this context, functionality refers to the ability to direct packaging of the genome into the capsid shell and then allow for expression in the host cell to be infected or target cell. In the context of the present invention a capsid protein shell may be of a different serotype than the rAAV vector genome ITR. A nucleic acid molecule represented by a nucleic acid sequence of choice is preferably inserted between the rAAV genome or ITR sequences as identified above, for example an expression construct comprising an expression regulatory element operably linked to a coding sequence and a 3' termination sequence. Said nucleic acid molecule may also be called a transgene.
"AAV helper functions" generally refers to the corresponding AAV functions required for rAAV replication and packaging supplied to the rAAV vector in trans. AAV helper functions complement the AAV functions which are missing in the rAAV vector, but they lack AAV ITRs (which are provided by the rAAV vector genome). AAV helper functions include the two major ORFs of AAV, namely the rep coding region and the cap coding region or functional substantially identical sequences thereof. Rep and Cap regions are well known in the art, see e.g. Chiorini et al. (1999, J. of Virology, Vol 73(2): 1309-1319) or US 5,139,941, incorporated herein by reference. The AAV helper functions can be supplied on an AAV helper construct. Introduction of the helper construct into the host cell can occur e.g. by transformation, transfection, or transduction prior to or concurrently with the introduction of the rAAV genome present in the rAAV vector as identified herein. The AAV helper constructs of the invention may thus be chosen such that they produce the desired combination of serotypes for the rAAV vector's capsid protein shell on the one hand and for the rAAV genome present in said rAAV vector replication and packaging on the other hand.
"AAV helper virus" provides additional functions required for AAV replication and packaging. Suitable AAV helper viruses include adenoviruses, herpes simplex viruses (such as HSV types 1 and 2) and vaccinia viruses. The additional functions provided by the helper virus can also be introduced into the host cell via plasmids, as described in US 6,531 ,456 incorporated herein by reference.
A "transgene" is herein defined as a gene or a coding sequence or a nucleic acid molecule (i.e. a molecule encoding a FGF21) that has been newly introduced into a cell, i.e. a gene that may be present but may normally not be expressed or expressed at an insufficient level in a cell. In this context, "insufficient" means that although said FGF21 is expressed in a cell, a condition and/or disease as defined herein could still be developed. In this case, the invention allows the over-expression of a FGF21. The transgene may comprise sequences that are native to the cell, sequences that naturally do not occur in the cell and it may comprise combinations of both. A transgene may contain sequences coding for a FGF21 and/or additional proteins as earlier identified herein that may be operably linked to appropriate regulatory sequences for expression of the sequences coding for a FGF21 in the cell. Preferably, the transgene is not integrated into the host cell's genome.
"Transduction" refers to the delivery of a FGF21 into a recipient host cell by a viral vector. For example, transduction of a target cell by a rAAV vector of the invention leads to transfer of the rAAV genome contained in that vector into the transduced cell. "Host cell" or "target cell" refers to the cell into which the DNA delivery takes place, such as the muscle cells of a subject. AAV vectors are able to transduce both dividing and non- dividing cells.
Production of an AAV vector The production of recombinant AAV (rAAV) for vectorizing transgenes have been described previously. See Ayuso E, et al, Curr. Gene Ther. 2010; 10:423-436, Okada T, et al, Hum. Gene Ther. 2009; 20: 1013-1021, Zhang H, et al, Hum. Gene Ther. 2009; 20:922-929, and Virag T, et al, Hum. Gene Ther. 2009; 20:807-817. These protocols can be used or adapted to generate the AAV of the invention. In one embodiment, the producer cell line is transfected transiently with the polynucleotide of the invention (comprising the expression cassette flanked by ITRs) and with construct(s) that encodes rep and cap proteins and provides helper functions. In another embodiment, the cell line supplies stably the helper functions and is transfected transiently with the polynucleotide of the invention (comprising the expression cassette flanked by ITRs) and with construct(s) that encodes rep and cap proteins. In another embodiment, the cell line supplies stably the rep and cap proteins and the helper functions and is transiently transfected with the polynucleotide of the invention. In another embodiment, the cell line supplies stably the rep and cap proteins and is transfected transiently with the polynucleotide of the invention and a polynucleotide encoding the helper functions. In yet another embodiment, the cell line supplies stably the polynucleotide of the invention, the rep and cap proteins and the helper functions. Methods of making and using these and other AAV production systems have been described in the art. See Muzyczka N, et al, US 5,139,941, Zhou X, et al, US 5,741,683, Samulski R, et al, US 6,057,152, Samulski R, et al, US 6,204,059, Samulski R, et al, US 6,268,213, Rabinowitz J, et al, US 6,491,907, Zolotukhin S, et al , US 6,660,514, Shenk T, et al , US 6,951,753, Snyder R, et al, US 7,094,604, Rabinowitz J, et al, US 7,172,893, Monahan P, et al, US 7,201,898, Samulski R, et al, US 7,229,823, and Ferrari F, et al, US 7,439,065. The rAAV genome present in a rAAV vector comprises at least the nucleotide sequences of the inverted terminal repeat regions (ITRs) of one of the AAV serotypes (preferably the ones of serotype AAV2 as disclosed earlier herein), or nucleotide sequences substantially identical thereto or nucleotide sequences having at least 60% identity thereto, and nucleotide sequence encoding a FGF21 (under control of a suitable regulatory element) inserted between the two ITRs. A vector genome requires the use of flanking 5 ' and a 3 ' ITR sequences to allow for efficient packaging of the vector genome into the rAAV capsid. The complete genome of several AAV serotypes and corresponding ITR has been sequenced (Chiorini et al. 1999, J. of Virology Vol. 73, No.2, pl309-1319). They can be either cloned or made by chemical synthesis as known in the art, using for example an oligonucleotide synthesizer as supplied e.g. by Applied Biosystems Inc. (Fosters, CA, USA) or by standard molecular biology techniques. The ITRs can be cloned from the AAV viral genome or excised from a vector comprising the AAV ITRs. The ITR nucleotide sequences can be either ligated at either end to the nucleotide sequence encoding one or more therapeutic proteins using standard molecular biology techniques, or the AAV sequence between the ITRs can be replaced with the desired nucleotide sequence.
Preferably, the rAAV genome as present in a rAAV vector does not comprise any nucleotide sequences encoding viral proteins, such as the rep (replication) or cap (capsid) genes of AAV. This rAAV genome may further comprise a marker or reporter gene, such as a gene for example encoding an antibiotic resistance gene, a fluorescent protein {e.g. gfp) or a gene encoding a chemically, enzymatically or otherwise detectable and/or selectable product {e.g. lacZ, aph, etc.) known in the art.
The rAAV genome as present in said rAAV vector further comprises a promoter sequence operably linked to the nucleotide sequence encoding a FGF21. Preferred promoter sequences are promoters which confer expression in skeletal muscle cells and/or skeletal muscle, in liver cells and/or liver and in adipose cells and /or adipose tissue. Examples of such promoters include a CMV, a CAG, a mini/aP2, a mini/UCPl, a C5-12 and a hAAT promoter as earlier defined herein.
A suitable 3' untranslated sequence may also be operably linked to the nucleotide sequence encoding a FGF21. Suitable 3' untranslated regions may be those naturally associated with the nucleotide sequence or may be derived from different genes, such as for example the SV40 polyadenylation signal (SEQ ID NO: 50) and the rabbit β-globin polyadenylation signal (SEQ ID NO: 51). Optionally, additional nucleotide sequences may be operably linked to the nucleotide sequence(s) encoding a FGF21, such as nucleotide sequences encoding signal sequences, nuclear localization signals, expression enhancers, and the like. Codon optimization
"Codon optimization", as used herein, refers to the processes employed to modify an existing coding sequence, or to design a coding sequence, for example, to improve translation in an expression host cell or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence. Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism. For example, to suit the codon preference of mammalians, preferably of murine, canine or human expression hosts. Codon optimization also eliminates elements that potentially impact negatively RNA stability and/or translation (e. g. termination sequences, TATA boxes, splice sites, ribosomal entry sites, repetitive and/or GC rich sequences and RNA secondary structures or instability motifs).
In this document and in its claims, the verb "to comprise" and its conjugations is used in its non-limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded. In addition the verb "to consist" may be replaced by "to consist essentially of meaning that a viral expression construct, viral vector, composition, gene therapy composition, as defined herein may comprise additional component(s) than the ones specifically identified, said additional component(s) not altering the unique characteristic of the invention.
In addition, reference to an element by the indefinite article "a" or "an" does not exclude the possibility that more than one of the element is present, unless the context clearly requires that there be one and only one of the elements. The indefinite article "a" or "an" thus usually means "at least one".
The word "approximately" or "about" when used in association with a numerical value (approximately 10, about 10) preferably means that the value may be the given value of 10 more or less 1% of the value. All patent and literature references cited in the present specification are hereby incorporated by reference in their entirety. Each embodiment as identified herein may be combined together unless otherwise indicated. The invention is further explained in the following examples. These examples do not limit the scope of the invention, but merely serve to clarify the invention.
Figure legends:
Figure 1. Prevention of obesity by intra-eWAT administration of AAV9-CAG- moFGF21-dmiRT vectors in C57B16 mice. (A) Schematic representation of the AAV- CAG-moFGF21-doublemiRT vectors. The expression cassette contained the CAG promoter, a murine codon-optimized FGF21 coding sequence and four tandem repeats of the miRT122a sequence and four tandems repeats of the miRTl sequence cloned in the 3' untranslated region of the expression cassette. ITRs from AAV2 flanked the expression cassette. The schematic representation is not to scale. CAG: chicken β-actin promoter/CMV enhancer; pA: polyA. (B) Expression levels of FGF21 in metabolic tissues. The expression levels of the murine codon-optimized FGF21 coding sequence were measured by RTqPCR in eWAT, iWAT, iBAT and liver of C57B16 mice, and normalized with RplpO values (n = 8-11 animals/group). (C) Circulating levels of FGF21 (n = 8-11 animals/group). (D-E) Expression levels of FGF21R1 (D) and β-Klotho (E) in metabolic tissues. The expression levels of the FGF21 receptor 1 (FGF21R1) and β- Klotho were measured by RTqPCR in eWAT, iWAT, iBAT and liver of C57B16 mice, and normalized with RplpO values (n = 7 animals/group). (F) Body weight evolution. Body weight was measured weekly (n = 8-11 animals/group). (G) Representative image of animals. (H) Weight of tissues. Weight of eWAT, iWAT, rWAT, mWAT, iBAT and liver of chow- and HFD-fed C57B16 mice treated intra-eWAT with AAV vectors (n = 8- 11 animals/group). Analyses were performed 14 weeks after intra-eWAT administration of 1012 vg of AAV9-CAG-moFGF21-doublemiRT or AAV9-CAG-null vectors. Results are expressed as the mean ± SEM. ND, not detected. HFD, high fat diet. AU, arbitrary units. eWAT, epididymal white adipose tissue. iWAT, inguinal white adipose tissue. rWAT, retroperitoneal white adipose tissue. mWAT, mesenteric white adipose tissue. iBAT interscapular brown adipose tissue. * p<0.05 vs AAV9-C AG-null chow, ** p<0.01 vs AAV9-CAG-null chow, *** p<0.001 vs AAV9-CAG-null chow, $ p<0.05 vs AAV9- CAG-null HFD, $$ p<0.01 vs AAV9-CAG-null HFD, $$$ p<0.001 vs AAV9-CAG-null HFD.
Figure 2. Histological analysis of adipose tissue and liver of C57B16 mice treated intra-eWAT with AAV9-CAG-moFGF21-doublemiRT vectors. (A) Representative images of sections stained with hematoxylin and eosin of epididymal white adipose tissue (eWAT), inguinal white adipose tissue (iWAT) interscapular brown adipose tissue (iBAT) and liver of chow- and HFD-fed C57B16 mice treated intra-eWAT with AAV9- CAG-moFGF21-doublemiRT or AAV9-CAG-null vectors. Original magnification XI 00. (B) Mean area of white adipocytes of eWAT (n = 4 animals/group). (C) Frequency distribution of area of white adipocytes of eWAT (n = 4 animals/group). Analyses were performed 14 weeks after intra-eWAT administration of 1012 vg of AAV9-CAG- moFGF21-doublemiRT or AAV9-C AG-null vectors. Results are expressed as the mean ± SEM. HFD, high fat diet. ** p<0.01 vs AAV9-CAG-null chow, *** p<0.001 vs AAV9-CAG-null chow, $$ p<0.01 vs AAV9-CAG-null HFD, $$$ p<0.001 vs AAV9- CAG-null HFD.
Figure 3. Increased energy expenditure and insulin sensitivity in C57B16 mice treated intra-eWAT with AAV9-CAG-moFGF21-doublemiRT vectors. (A-B)
Expression levels of UCP1 (A) and Dio2 (B). The expression levels of UCP1 and Dio2 were measured by RTqPCR in iWAT and normalized with RplpO values (n = 7 animals/group). (C) Energy metabolism. The energy expenditure (EE) was measured with indirect open circuit calorimeter. Oxygen consumption and carbon dioxide production were monitored simultaneously. Data were taken 9 weeks post-AAV administration during the light cycle (basal state) and dark cycle (activity phase) and adjusted for body weight (n = 8-11 animals/group). (D) Liver triglyceride content (n = 8-10 animals/group). (E-F) Serum triglyceride (E) and cholesterol (F) levels (n = 8-11 animals/group). (G) Intraperitoneal insulin tolerance test. Mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points (n = 6-11 animals/group). The test was performed 11 weeks post-AAV administration. (H) Fasted insulin circulating levels. Unless otherwise indicated, analyses were performed 14 weeks after intra-eWAT administration of 1012 vg of AAV9-CAG-moFGF21-doublemiRT or AAV9-CAG-null vectors. Results are expressed as the mean ± SEM. HFD, high fat diet. TG, triglycerides. Choi, cholesterol. * p<0.05 vs AAV9-C AG-null chow, ** p<0.01 vs AAV9-CAG-null chow, *** p<0.001 vs AAV9-CAG-null chow, $ p<0.05 vs AAV9-CAG-null HFD, $$ p<0.01 vs AAV9-CAG-null HFD, $$$ p<0.001 vs AAV9-C AG-null HFD. Figure 4. Reversion of obesity by intra-eWAT administration of AAV8-CAG- moFGF21-dmiRT vectors in ob/ob mice. (A) Expression levels of FGF21 in metabolic tissues. The expression levels of the murine codon-optimized FGF21 coding sequence were measured by RTqPCR in eWAT, iWAT, iBAT and liver of ob/ob mice, and normalized with RplpO values (B) Circulating levels of FGF21. (C-D) Body weight (C) and body weight gain (D) evolution. Body weight was measured weekly. (E) Weight of tissues. Weight of eWAT, iWAT, rWAT, mWAT, iBAT and liver of ob/ob mice treated intra-eWAT with AAV vectors. Analyses were performed 16 weeks after intra-eWAT administration of 1010 vg, 5xl010 vg, 2xlOu vg or 1012 vg of AAV8-CAG-moFGF21- doublemiRT or 1012 vg of AAV8-CAG-null vectors. Results are expressed as the mean ± SEM. n = 7-8 animals/group. ND, not detected. AU, arbitrary units. eWAT, epididymal white adipose tissue. iWAT, inguinal white adipose tissue. rWAT, retroperitoneal white adipose tissue. mWAT, mesenteric white adipose tissue. iBAT interscapular brown adipose tissue. * p<0.05 vs AAV8-CAG-null, ** p<0.01 vs AAV8-CAG-null, *** p<0.001 vs AAV8-CAG-null.
Figure 5. Improved insulin sensitivity in ob/ob mice treated intra-eWAT with AAV8-CAG-moFGF21-doublemiRT vectors. (A) Intraperitoneal insulin tolerance test. Ob/ob mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 9 weeks post-AAV administration. (B) Fasted insulin circulating levels 2 months post-AAV. Results are expressed as the mean ± SEM, n = 7-8 animals/group. * p<0.05 vs AAV8-CAG-null, ** p<0.01 vs AAV8-CAG-null, *** p<0.001 vs AAV8- CAG-null.
Figure 6. Reversion of obesity and amelioration of glucose metabolism by intravenous administration of AAV8-hAAT-moFGF21-vectors in ob/ob mice. (A)
Schematic representation of AAV-hAAT-moFGF21 vectors. The expression cassette contained the human a 1 -antitrypsin (hAAT) promoter and a murine codon-optimized FGF21 coding sequence. ITRs from AAV2 flanked the expression cassette. The schematic representation is not to scale. pA: polyA. (B) Expression levels of FGF21. The expression levels of the murine codon-optimized FGF21 coding sequence were measured by RTqPCR in the liver of ob/ob mice, and normalized with RplpO values. (C) Circulating levels of FGF21. (D-E) Body weight (C) and body weight gain (D) evolution. Body weight was measured weekly. (F) Representative image of animals. (G) Weight of tissues. Weight of eWAT, iWAT, rWAT, mWAT, iBAT and liver of ob/ob mice treated intravenously with AAV vectors. (H) Intraperitoneal insulin tolerance test. Ob/ob mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 9 weeks post-AAV administration. (I) Fasted insulin circulating levels 3 months post- AAV. Unless otherwise indicated, analyses were performed 20 weeks after intravenous administration of 1011 vg or 5xlOu vg of AAV8-hAAT-moFGF21 or 5xlOu vg of AAV8-hAAT-null vectors. Results are expressed as the mean ± SEM. n = 9-10 animals/group. ND, not detected. AU, arbitrary units. eWAT, epididymal white adipose tissue. iWAT, inguinal white adipose tissue. rWAT, retroperitoneal white adipose tissue. mWAT, mesenteric white adipose tissue. iBAT interscapular brown adipose tissue. * p<0.05 vs AAV8-hAAT-null, ** p<0.01 vs AAV8-hAAT-null, *** pO.001 vs AAV8- hAAT-null.
Figure 7. Long-term reversion of obesity by intravenous administration of AAV- h AAT-moFGF21 vectors in HFD-fed C57bl6 mice. (A) Circulating levels of FGF21. (B-C) Body weight (C) and body weight gain (D) evolution. Body weight was measured weekly. Analyses were performed 52 weeks after intravenous administration of 1010 vg or 5xl010 vg of AAV8-hAAT-moFGF21 or 5xl010 vg of AAV8-hAAT-null vectors. Results are expressed as the mean ± SEM, n = 9-12 animals/group. *** p<0.001 vs AAV8-hAAT-null chow, $$ p<0.01 vs AAV8-hAAT-null HFD, $$$ p<0.001 vs AAV8- hAAT-null HFD.
Figure 8. Long-term increased energy expenditure and insulin sensitivity by intravenous administration of AAV-hAAT-moFGF21 vectors in HFD-fed C57B16 mice. (A) Energy metabolism. The energy expenditure (EE) was measured with indirect open circuit calorimeter. Oxygen consumption and carbon dioxide production were monitored simultaneously. Data were taken 4 weeks post-AAV administration during the light cycle (basal state) and dark cycle (activity phase) and adjusted for body weight. (B) Intraperitoneal insulin tolerance test. C57B16 mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 7 weeks post-AAV administration. (C) Fasted and fed insulin circulating levels. Results are expressed as the mean ± SEM, n = 9-12 animals/group. HFD, high fat diet. * p<0.05 vs AAV8-hAAT-null chow, ** p<0.01 vs AAV8-hAAT-null chow, *** p<0.001 vs AAV8-hAAT-null chow, $ p<0.05 vs AAV8-hAAT-null HFD, $$ p<0.01 vs AAV8-hAAT-null HFD, $$$ p<0.001 vs AAV8- hAAT-null HFD.
Figure 9. Reversion of obesity by intravenous administration of AAV-hAAT- moFGF21 vectors in old HFD-fed mice. (A) Circulating levels of FGF21. (B-C) Body weight (B) and body weight gain (C) evolution. Body weight was measured weekly. Analysis were performed 21 weeks after intravenous administration of 1010 vg, 2xl010 vg or 5xl010 vg of AAV8-hAAT-moFGF21 or 5xl010 vg of AAV8-hAAT-null vectors. Results are expressed as the mean ± SEM, n = 7-8 animals/group. HFD, high fat diet. *** p<0.05 vs AAV8-hAAT-null chow, $ p<0.05 vs AAV8-hAAT-null HFD, $$ p<0.01 vs AAV8-hAAT-null HFD. $$$ p<0.001 vs AAV8-hAAT-null HFD.
Figure 10. Increased energy expenditure and insulin sensitivity by intravenous administration of AAV-hAAT-moFGF21 vectors in old HFD-fed mice. (A) Energy metabolism. The energy expenditure (EE) was measured with indirect open circuit calorimeter. Oxygen consumption and carbon dioxide production were monitored simultaneously. Data were taken 6 weeks post-AAV administration during the light cycle (basal state) and dark cycle (activity phase) and adjusted for body weight. (B) Intraperitoneal insulin tolerance test. Old C57B16 mice were given an intraperitoneal injection of 0.75 U insulin/kg body weight and blood glucose levels were measured at the indicated time points. The test was performed 9 weeks post-AAV administration. (C) Fasted and fed insulin circulating levels. Results are expressed as the mean ± SEM, n = 7-8 animals/group. HFD, high fat diet. ** p<0.01 vs AAV8-hAAT-null chow, *** p<0.001 vs AAV8-hAAT-null chow, $ p<0.05 vs AAV8-hAAT-null HFD, $$ p<0.01 vs AAV8-hAAT-null HFD, $$$ p<0.001 vs AAV8-hAAT-null HFD.
Figure 11. Body weight loss by intramuscular administration of AAV-CMV- moFGF21 vectors in C57B16 mice. (A) Schematic representation of the AAV-CMV- moFGF21 vectors. The expression cassette contained the cytomegalovirus (CMV) promoter and a murine codon-optimized FGF21 coding sequence. ITRs from AAV2 flanked the expression cassette. The schematic representation is not to scale. pA: polyA. (B) Circulating FGF21 levels. (C-D) Body weight (C) and body weight gain (D) evolution. Body weight was measured weekly. Results are expressed as the mean ± SEM. n = 6-7 animals/group. * p<0.05 vs AAVl-CMV-null, ** p<0.01 vs AAVl-CMV-null. FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Figure 12. Increased FGF21 protein production by codon-optimization of nucleotide sequences encoding human FGF21. (A) Levels of hFGF21 protein in the culture media of HEK293 cells transfected with wild-type hFGF21 or three different versions of codon-optimized human FGF21 sequences. Results are expressed as the mean ± SEM. n = 3 wells/group. ND, non detected. * p<0.05 vs Non-transfected cells.
Figure 13. Intra-eWAT administration of AAV8-CAG-moFGF21-dmiRT vectors in ob/ob mice.
A,B Representative images of the hematoxylin-eosin staining of (A) eWAT and (B) liver tissue sections obtained from ob/ob animals injected intra-eWAT either null or FGF21 -encoding AAV8 vectors at all doses tested. Scale bars: 100 μιη for eWAT and 200 μιη for liver.
C Glycemia in the fed state.
D Insulinemia in the fed state 3 months post- AAV.
FGF21 labels in the figure refer to moFGF21.
Data information: All values are expressed as mean ± SEM. In (A, B) n= 6-9 animals/group. In (C-H) n= 4-8 animals/group. In (I) n= 6-8 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the Null-injected group.
Figure 14. Impact of FGF21 gene transfer to the eWAT of ob/ob mice.
A Serum adiponectin levels in 25-week-old ob/ob animals injected intra-eWAT at 11 weeks of age with either AAV8-CAG-null vectors or AAV8-CAG-moFGF21- dmiRT vectors at 4 different doses (lxlO10, 5xl010, 2xlOu, lxlO12 vg/mouse).
B Quantification by qRT-PCR of the expression of the macrophage marker F4/80 the same groups of animals as in (A). C Representative images of the immunostaining of eWAT sections from ob/ob mice that received AAV8-CAG-moFGF21-dmiRT vectors for the macrophage- specific marker Mac2. n=4-8/group. Scale bars: 200 μιη.
D Weight of the liver in all intra-eWAT treatment groups.
E, F Hepatic triglyceride and cholesterol content in the fed stated in the same cohorts as in (A)
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (A, B, D) n=4-8 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus null-injected ob/ob group.
Figure 15. Reduced obesity and improved insulin sensitivity in ob/ob mice treated with AAV8-h AAT-moFGF21 vectors.
A Representative images of the hematoxylin-eosin staining of eWAT tissue sections obtained from ob/ob animals injected with either null or FGF21 -encoding AAV vectors at lxlO11 or 5xlOu vg/mouse.
B Serum adiponectin levels in all groups.
C Representative images of the hematoxylin-eosin staining of liver tissue sections obtained from ob/ob animals injected with either null or FGF21 -encoding AAV vectors at lxlO11 or 5xlOu vg/mouse.
D Fed blood glucose levels.
E Fed serum Insulin levels 5 months post-AAV.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All data represent the mean±SEM. In (A-C, E, G-H) n=9-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus null-injected ob/ob group.
Figure 16. Effects of FGF21 liver gene transfer on ob/ob mice.
A Immunohistochemistry for the macrophage-specific marker Mac2 in eWAT sections from ob/ob mice that received AAV8-hAAT-moFGF21 vectors. Scale bars: 500 μιη.
B, C Quantification by qRT-PCR of the expression of the markers of inflammation F4/80 (B) and TNF-a (C) in the same cohorts of mice.
D, E Weight (D) and representative images of the liver (E) obtained from animals belonging to the same experimental groups as in (A). F, G Hepatic triglyceride and cholesterol content in the fed state in the same cohorts as in (A)
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (B, D-F, H-I) n=9-10 animals/group. *P<0.05, **P<0.01 and *** <0.001 versus null-injected ob/ob group.
Figure 17. AAV8-hAAT-moFGF21 treatment increases the expression of genes involved in glucose uptake and thermogenesis in adipose tissue of ob/ob mice.
A, B Quantification by qRT-PCR of liver PEPCK and G6Pase expression in ob/ob mice injected at 2 months of age with either AAV8-hAAT-null vectors or AAV8- hAAT-moFGF21 vectors.
C-F Quantification by qRT-PCR of GLUT1 (C), GLUT4 (D), HKI (E) and HKII (F) expression in eWAT, iWAT and iBAT in the same animals as in (A)
G Relative expression of UCP1 in iBAT in the same cohorts as in (A).
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Data information: All values are expressed as mean ± SEM. In (A-G) n=9-10 animals/group. *P<0.05, **P<0.01 and *** <0.001 versus null-injected ob/ob group.
Figure 18. AAV8-mediated liver gene transfer of FGF21 counteracts HFD-induced obesity.
A Weight of the epididymal (eWAT), inguinal (iWAT) and retroperitoneal (rWAT) white adipose tissue depots, the liver and the quadriceps obtained from mice treated with AAV8-hAAT-moFGF21 vectors as young adults (top panel) or as adults (bottom panel).
B Circulating levels of FGF21 at different time -points after vector administration. FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (A-D) «=7-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the chow-fed Null-injected group. <0.05, <0.01 and <0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 19. FGF21 gene transfer to the liver counteracts HFD-induced obesity. A, B Representative images of animals belonging to all experimental groups of the studies performed in young adults (A) or in adults (B).
C Representative images of the epididymal white adipose (eWAT) pad obtained at sacrifice from animals treated with several doses of AAV8-hAAT-moFGF21 as young adults (left) or adults (right).
D Representative images of the liver obtained from animals treated as young adults
(left) or adults (right).
E AAV-derived FGF21 expression in the liver of animals treated as young adults or adults. The qPCR was performed with primers that specifically detected the codon-optimized murine FGF21 (coFGF21) coding sequence.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (E) n=7-10 animals/group. HFD, High-fat diet. ND, non-detected. Figure 20. AAV8-hAAT-moFGF21-mediated increased energy expenditure and decreased fat accumulation in iBAT and iWAT.
A Assessment of the locomotor activity through the Open field test in animals that had been subjected to HFD-feeding since ~2 months of age and were treated with either null or FGF21 -encoding vectors 2 months later (young adults).
B Hematoxylin-eosin staining of iBAT tissue sections obtained from animals treated as young adults (left) or adults (right).
C Western-blot analysis of UCP1 content in iBAT from the same cohort of animals as in (A). A representative immunoblot is shown (left). The histogram depicts the densitometric analysis of two different immunoblots (right).
D Hematoxylin-eosin staining of iWAT tissue sections obtained from animals treated as young adults (left) or adults (right).
E Quantification by qRT-PCR of the expression of Phospho 1 in iWAT in the groups of animals that initiated the HFD feeding and received FGF21 vectors as young adults or adults.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Data information: All values are expressed as mean ± SEM. In (A-C) n=7-10 animals/group. In (E) n=4 animals/group. In (G) n=7-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the chow-fed Null-injected group. <0.05 and <0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 21. Energy expenditure 10 months after gene transfer to the liver.
A Energy expenditure was measured 10 months after AAV8-hAAT-null or AAV8- hAAT-moFGF21 vector delivery in the cohort of animals that initiated HFD- feeding at 2 months of age. Data were taken during the light and dark cycles.
B Western-blot analysis of UCP 1 content in iWAT from the same cohort of animals.
A representative immunoblot is shown {left). The graph shows the densitometric analysis of two different immunoblots {right).
C Relative expression of Serca2b and RyR2 in the iWAT of the groups of animals that initiated the HFD feeding and received FGF21 vectors as young adults or adults
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (A) n=7-10 animals/group. In (B) n=4 animals/group. In (C) n=7-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the chow-fed Null-injected group. #P<0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 22. AAV8-hAAT-moFGF21 -mediated reversal of islet hyperplasia.
A Fasted glucagon levels in the group of animals that initiated the HFD feeding and received FGF21 vectors as young adults.
B β-cell mass in the group of animals that initiated the HFD feeding and received
FGF21 vectors as adults.
C Representative images of the immunostaining against insulin in pancreas sections from animals that received 5x1010 vg/mouse of AAV8-hAAT-moFGF21 as adults. Scale bars: 400 μιη. Inset scale bars: 100 μιη.
D Representative images of the double immunostaining against insulin (dark grey) and glucagon (light grey) in pancreas sections from animals that received 5xl010 vg/mouse of AAV8-hAAT-moFGF21 as young adults {upper panel) or adults
{lower panel). Scale bars: 100 μιη.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (A-C) n=7-10 animals/group. In (D) n=4-5 animals/group. * <0.05, ** <0.01 and *** <0.001 versus the chow-fed Null-injected group. <0.05, ##P<0.01 and ###P<0.001 versus the HFD- fed Null-injected group. HFD, High-fat diet.
Figure 23. Treatment with AAV8-hAAT-moFGF21 improves glucose tolerance.
A Glucose tolerance was studied in the group of mice that initiated the HFD feeding and received FGF21 vectors as young adults after an intraperitoneal injection of glucose (2 g/kg body weight).
B Serum insulin levels during the glucose tolerance test shown in (A).
Data information: All data represent the mean mean ± SEM. In (A-D) n=7-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the chow-fed Null-injected group. <0.05, <0.01 and <0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 24. Reversal of WAT hypertrophy and inflammation by AAV8-hAAT- moFGF21 treatment.
A Representative images of the hematoxylin-eosin staining of the eWAT from animals fed a chow or a HFD and administered with either AAV8-hAAT-null or 5xl010 vg/mouse AAV8-hAAT-moFGF21 vectors as young adults {left panels) or adults {right panels). While HFD-fed, null-injected mice had larger adipocytes, HFD-fed, FGF21 -treated animals had adipocytes of reduced size. Scale bars: 100 μιη.
B Morphometric analysis of the area of WAT adipocytes in animals treated as young adults or as adults.
C, D Circulating levels of adiponectin (C) and leptin (D).
E Immunohistochemistry for the macrophage-specific marker Mac2 in eWAT sections from animals that received 5xl010 vg/mouse AAV8-hAAT-moFGF21 as adults. The micrographs illustrate the presence of crown-like structures {arrows and inset) in the eWAT of HFD-fed, null-injected animals but no in the eWAT of HFD-fed, FGF21-treated mice. Scale bars: 200 μιη and 50 μιη (inset). F-H Quantification by qRT-PCR of the expression of the markers of inflammation F4/80 (F), ILl-β (G) and TNF-a (H) in the group of animals that initiated the HFD feeding and received FGF21 vectors as adults.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (B) n=4 animals/group. In (F-H) n=7-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the chow- fed Null-injected group. <0.05, <0.01 and <0.001 versus the HFD-fed Null- injected group. HFD, High-fat diet. Figure 25. Adipocyte size and inflammation in AAV8-hAAT-moFGF21 -treated animals.
A Frequency distribution of adipocyte area in the groups of animals that initiated the chow or HFD feeding and received either AAV8-hAAT-null or 5xl010 vg/mouse AAV8-hAAT-moFGF21 vectors as young adults (top graph) or adults (bottom graph).
B Mac2 immunohistochemistry in eWAT of animals in which the study was initiated as young adults. The crown-like structures formed by infiltrating macrophages in the eWAT of HFD-fed, null-injected mice are indicated by arrows. Scale bars: 200 μιη and 50 μιη (inset).
C-E Relative expression by qRT-PCR of the markers of inflammation F4/80, CD68 and TNF-a in the same cohort of animals as in (B).
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (A) n=4 animals/group. In (C-E) n=7-10 animals/group. ***P<0.001 versus the chow-fed Null-injected group. #P<0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 26. Treatment with FGF21-encoding vectors reverses hepatic steatosis and inflammation.
A Representative images of the hematoxylin-eosin staining of liver sections obtained from animals fed a chow or a HFD and administered with either AAV 8- hAAT-null or 5xl010 vg/mouse AAV8-hAAT-moFGF21 vectors. HFD clearly induced the deposition of lipid droplets in the liver, and this was reverted by AAV8-hAAT-moFGF21 treatment both in young adults and in adults. Scale bars: 100 μπι.
B, C Fed hepatic triglyceride and cholesterol content in the same cohorts of animals.
D Immunostaining for the macrophage-specific marker Mac-2 of liver sections from animals fed a HFD that received either AAV8-hAAT-null or 5x1010 vg/mouse AAV8-hAAT-moFGF21 vectors. Arrows indicate the presence of crown- like structures. Scale bars: 200 μιη and 50 μιη (inset).
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Data information: All values are expressed as mean ± SEM. In (B-C) n=7-10 animals/group. **P<0.01 and ***P<0.001 versus the chow-fed Null-injected group.
<0.01 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 27. AAV8-hAAT-moFGF21 -mediated amelioration of liver fibrosis.
Analysis of hepatic fibrosis through Masson's trichrome staining in animals fed a HFD that received 5xl010 vg/mouse of either AAV8-hAAT-null or AAV8-hAAT-moFGF21 vectors. AAV8-hAAT-moFGF21 treatment {right panels) markedly decreased the detection of collagen fibers that were readily detectable (in blue) in animals treated with the null vector {left panels). Scale bars: 50 μιη. FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Figure 28. AAV8-hAAT-moFGF21 treatment improves liver fibrosis.
A Analysis of hepatic fibrosis through PicroSirius staining in animals fed a HFD that received 5xl010 vg/mouse of either AAV8-hAAT-null or AAV8-hAAT- moFGF21 vectors. AAV8-hAAT-moFGF21 treatment {right panels) markedly decreased the detection of collagen fibers that were readily detectable (in black) in animals treated with the null vector {left panels). Scale bars: 50 μιη.
B, C Quantification by qRT-PCR of the expression of collagen 1 in the liver in the group of animals that initiated the HFD feeding and received FGF21 vectors as young adults (B) or adults (C).
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Data information: All values are expressed as mean ± SEM. In (B-C) n=7-10 animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the chow-fed Null-injected group. <0.05 and ### <0.001 versus the HFD-fed Null-injected group. HFD, High-fat diet.
Figure 29. No bone abnormalities were observed in AAV8-hAAT-moFGF21-treated animals. The long-term effects of FGF21 gene transfer on bones were studied by comparison of HFD-fed mice treated with the highest dose (5xl010 vg/mouse) of AAV8- hAAT-moFGF21 vectors as young adults or adults with null-injected, chow or HFD-fed animals.
A Total naso-anal length.
B Tibial length.
C-0 Micro-computed tomography ^CT) analysis of the epiphysis (C-J) and the diaphysis (K-O) of tibiae obtained at the time of sacrifice, i.e. when animals were 18 months of age, from HFD-fed mice administered with either null or FGF21- encoding AAV vectors.
P, Q Circulating IGFBP 1 (P) and IGF 1 (Q) levels measured by ELISA.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All data represent the mean ± SEM. In (A, P-Q) n=7- 10 animals/group. In (B-O) n=4 animals/group. **P<0.01 and *** <0.001 versus the chow- fed Null- injected group. HFD, High-fat diet; BMD, bone mineral density; BMC, bone mineral content; BV, bone volume; BV/TV, bone volume/tissue volume ratio; BS/BV, bone surface/bone volume ratio; Tb.N, trabecular number; Tb.Th, trabecular thickness; Tb.Sp, trabecular separation.
Figure 30. Analysis of glycaemic profiles in C57B16 mice treated with AAV8-hAAT- moFGF21 vectors. Blood glucose levels were evaluated under fed conditions. AAV, IV administration of 5xl010 vg or 2xlOu vg of AAV8-hAAT-moFGF21 (n=13 and 15, respectively) or 2xlOu vg of AAV8-null vectors (n=15). STZ, treatment with streptozotocin (5x50mg/kg). Results shown are means + SEM. * p<0.05; *** p<0.001 vs AAV8-hAAT-Null. FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Figure 31. Gene transfer of FGF21 to the skeletal muscle of healthy animals. A Circulating levels of FGF21 measured 40 weeks after injection of 3xl0n vg/mouse of either AAVl-CMV-Null or AAVl-CMV-moFGF21 vectors to the skeletal muscle of healthy animals fed a chow diet.
B AAV-derived FGF21 expression in the muscles and liver of healthy animals injected intramuscularly with AAVl-CMV-Null or AAVl-CMV-moFGF21 vectors.
C Evolution of the body weight in the 40-week follow-up period.
D Wet tissue weight of different muscles, adipose pads and liver.
E, F Hepatic triglyceride and cholesterol content in the fed state.
G Fed serum insulin levels.
H Insulin sensitivity assessed through intraperitoneal injection of insulin (0.75 units/kg body weight) and represented as percentage of initial blood glucose.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend.
Data information: All values are expressed as mean ± SEM. In (A-H) η=5-Ί animals/group. *P<0.05, **P<0.01 and ***P<0.001 versus the Null-injected group.
Figure 32. AAVl-mediated skeletal muscle gene transfer of FGF21 counteracts HFD-induced obesity and insulin resistance.
A, B Evolution of body weight (A) and body weight gain (B) in animals treated with AAVl-CMV-moFGF21. C57B16 mice were fed a HFD for -12 weeks and then administered with 3xl0u vg/mouse of AAVl -CMV-moFGF21 vectors. Control obese mice and control chow-fed mice received 3xl0u vg of AAVl-CMV-null. C Circulating levels of FGF21 at different time-points after vector administration. D, E Fasted blood glucose (D) and fed serum insulin (E) levels in the same groups of animals as in (A, B).
F Insulin sensitivity was determined in all experimental groups after an intraperitoneal injection of insulin (0.75 units/kg body weight). Results were calculated as the percentage of initial blood glucose levels.
FGF21 labels in the figure refer to moFGF21 in accordance with this Figure legend. Data information: All values are expressed as mean ± SEM. In (A-F) HFD-fed mice n=10 animals/group; chow-fed mice n=5 animals/group. *** <0.001 versus the HFD-fed null- injected group. Figure 33. In vivo increased FGF21 circulating levels by codon-optimization of nucleotide sequences encoding human FGF21. Circulating levels of hFGF21 in C57B16 mice administered hydrodynamically with plasmids encoding wild-type hFGF21 or three different variants of codon-optimized human FGF21 sequences. Results are expressed as the mean ± SEM. n = 9- 10 mice/group. ND, non detected. Negative control, untreated mice. * p<0.05 vs Non-treated mice.
Figure 34. In vitro increased FGF21 expression levels by hAAT-moFGF21, CAG- moFGF21-doublemiRT and CMV-moFGF21 expression cassettes. (A) Expression levels of FGF21 in HEK293 cells transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21) or of the CAG promoter in conjunction with four tandem repeats of the miRT122a sequence and four tandems repeats of the miRTl sequence (CAG-moFGF21 -doublemiRT). (B and C) Intracellular FGF21 protein content (B) and FGF21 protein levels in the culture medium (C) in the same cells as in (A). (D) Expression levels of FGF21 in C2C12 cells transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EF 1 a promoter (EF 1 a-mFGF21 ) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21). (E) Expression levels of FGF21 in HepG2 cells transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (hAAT-moFGF21). The qPCR was performed with primers that detected both the wt and the codon-optimized FGF21 coding sequences. Results are expressed as the mean ± SEM. n = 3 wells/group. ND, non detected. * p<0.05 vs control. ### p<0.001 vs EFla-mFGF21.
Figure 35. In vivo increased hepatic FGF21 expression and FGF21 circulating levels by hAAT-moFGF21 and CMV-moFGF21 expression cassettes. (A) Expression levels of FGF21 in the liver of C57B16 mice hydrodynamically administered with plasmids encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21) or the hAAT promoter (hAAT-moFGF21). The qPCR was performed with primers that detected both the wt and the codon-optimized FGF21 coding sequences. (B) FGF21 circulating levels in the same cohorts as in (A). Results are expressed as the mean ± SEM. n = 5 mice/group. ** p<0.01 vs. EFla-mFGF21
Figure 36. In vivo increased hepatic FGF21 expression and FGF21 circulating levels by AAV8-h AAT-moFGF21. (A) Expression levels of FGF21 in the liver of C57B16 mice intravenously administered with lxlO10 vg, 2xl010 vg or 5xl010 vg of AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (AAV8-fiAAT- moFGF21). The qPCR was performed with primers that detected both the wt and the codon-optimized FGF21 coding sequences. (B) FGF21 circulating levels in the same cohorts as in (A). Analyses were performed two weeks post-AAV. Results are expressed as the mean ± SEM. n = 4-5 mice/group. Control, untreated mice. ** p<0.01 and *** p<0.001 vs. control. ## p<0.01 and ### p<0.001 vs. AAV8-EFla-mFGF21
Figure 37. In vivo increased adipose FGF21 expression by AAV8-CAG-moFGF21- dmiRT. (A-B) Expression levels of FGF21 in the eWAT (A) or the liver (B) of C57B16 mice administered intra-eWAT with 2x1010 vg, 5xl010 vg or lxlO11 vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CAG promoter in conjunction with four tandem repeats of the miRT122a sequence and four tandems repeats of the miRTl sequence (AAV8-CAG-moFGF21-doublemiRT). The qPCR was performed with primers that detected both the wt and the codon- optimized FGF21 coding sequences. Analyses were performed two weeks post-AAV. Results are expressed as the mean ± SEM. n = 4-5 mice/group. Control, untreated mice. eWAT, epidydimal white adipose tissue. * p<0.05, ** p<0.01 and
Figure 38. In vivo increased FGF21 expression in the skeletal muscle by AAV1- CMV-moFGF21. (A-B) Expression levels of FGF21 in the quadriceps (A) or the liver (B) of C57B16 mice administered intramuscularly with 5xl010 vg, lxlO11 vg or 3xl0n vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV1 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (AAV1-CMV-FGF21). The qPCR was performed with primers that detected both the wt and the codon-optimized FGF21 coding sequences. Analyses were performed two weeks post- AAV. Results are expressed as the mean ± SEM. n = 4- 5 mice/group. Control, untreated mice. * p<0.05, ** p<0.01 and *** p<0.001 vs. control. # p<0.05, ## p<0.01 and ### p<0.001 vs. AAV8-EF 1 a-mFGF21. Examples
General procedures to the Examples
Subject characteristics
Male C57B1/6J mice and B6.V-Zep°*/01aHsd (ob/ob) mice were used. Mice were fed ad libitum with a standard diet (2018S Teklad Global Diets®, Harlan Labs., Inc., Madison, WI, US) or a high fat diet (TD.88137 Harlan Teklad Madison, WI, US ) and kept under a light-dark cycle of 12 h (lights on at 8:00 a.m.) and stable temperature (22°C ± 2). For tissue sampling, mice were anesthetized by means of inhalational anesthetic isoflurane (IsoFlo®, Abbott Laboratories, Abbott Park, IL, US) and decapitated. Tissues of interest were excised and kept at -80°C or with formalin until analysis. All experimental procedures were approved by the Ethics Committee for Animal and Human Experimentation of the Universitat Autonoma de Barcelona. Recombinant AAV vectors
Single-stranded AAV vectors of serotype 1 , 8 or 9 were produced by triple transfection of HEK293 cells according to standard methods (Ayuso, E. et al, 2010. Curr Gene Ther. 10(6}:423-36). Cells were cultured in 10 roller bottles (850 cm2, flat; Corning™, Sigma- Aldrich Co., Saint Louis, MO, US) in DMEM 10% FBS to 80% confluence and co- transfected by calcium phosphate method with a plasmid carrying the expression cassette flanked by the AAV2 ITRs, a helper plasmid carrying the AAV2 rep gene and the AAV of serotypes 1, 8 or 9 cap gene, and a plasmid carrying the adenovirus helper functions. Transgenes used were: murine, canine or human codon-optimized or wt FGF21 coding- sequence driven by 1) the cytomegalovirus (CMV) early enhancer/chicken beta actin (CAG) promoter with the addition of four tandem repeats of the miRT122a sequence (5 'CAAACACCATTGTCACACTCCA3 ') (SEQ ID NO: 12) and four tandems repeats of the miRTl sequence (5 'TTACATACTTCTTTACATTCCA3 ') (SEQ ID NO: 13) cloned in the 3 ' untranslated region of the expression cassette; 2) the CMV promoter; or 3) the human a 1 -antitrypsin promoter (hAAT). Noncoding plasmids carrying the CAG, hAAT or CMV promoters were used to produce null vectors. AAV were purified with an optimized method based on a polyethylene glycol precipitation step and two consecutive cesium chloride (CsCl) gradients. This second-generation CsCl-based protocol reduced empty AAV capsids and DNA and protein impurities dramatically (Ayuso, E. et al, 2010. Curr Gene Ther. 10(6):423-36). Purified AAV vectors were dialyzed against PBS, filtered and stored at -80°C. Titers of viral genomes were determined by quantitative PCR following the protocol described for the AAV2 reference standard material using linearized plasmid DNA as standard curve (Lock M, et al, Hum. Gene Ther. 2010; 21 : 1273-1285). The vectors were constructed according to molecular biology techniques well known in the art.
In vivo intra-eWAT administration of AAV vectors
Mice were anesthetized with an intraperitoneal injection of ketamine (100 mg/kg) and xylazine (10 mg/kg). A laparotomy was performed in order to expose the epididymal white adipose tissue. AAV vectors were resuspended in PBS with 0.001% Pluronic® F68 (Gibco) and injected directly into the epididymal fat pad. Each epididymal fat pad was injected twice with 50μί of the AAV solution (one injection close to the testicle and the other one in the middle of the fat pad). The abdomen was rinsed with sterile saline solution and closed with a two-layer approach.
Systemic administration of AAV vectors
The appropriate amount of the AAV solution was diluted in 200 of PBS with 0.001% Pluronic® and was manually injected into the lateral tail vein without exerting pressure at the moment of delivery. Before the injection, the animals were put under a 250 W infrared heat lamp (Philips NV, Amsterdam, NL) for a few minutes to dilate the blood vessels and facilitate viewing and easier access to the tail vein. A plastic restrainer (Harvard Apparatus, Holliston, MA, US) was used to secure the animal for injection. No anesthesia was used since an appropriate restraining device was employed. A 30-gauge needle was utilized to inject the animals.
Intramuscular administration of AAV vectors
Mice were anesthetized with an intraperitoneal injection of ketamine (100 mg/kg) and xylazine (10 mg/kg). Hind limbs were shaved and vectors were administered by intramuscular injection in a total volume of 180 μΐ divided into six injection sites distributed in the quadriceps, gastrocnemius, and tibialis cranealis of each hind limb. Immunohistochemical and morphometric analysis
Tissues were fixed for 24 h in formalin (Panreac Quimica), embedded in paraffin, and sectioned. Tissue samples were stained with hematoxylin-eosin. Adipocyte area was determined in 12 hematoxylin/eosin WAT images per animal taken at 10 X with the Nikon Eclipse E800 microscope (Nikon, Tokyo, Japan) connected to a videocamera with a monitor with an image analysis software (analySIS 3.0; Soft Imaging System, Center Valley, PA, EEUU) and each adipocyte area was quantified in μιη2. Mean adipocyte area was calculated for each experimental group and distribution of adipocytes according to size categories was represented in a histogram. Four animals per group were used and at least 250 adipocytes per animal were analyzed.
Immunohistochemistry
Tissues were fixed for 12-24 h in 10% formalin, embedded in paraffin and sectioned.
Sections were incubated overnight at 4°C with rat anti-Mac2 (1 :50; CL8942AP;
Cedarlane), guinea pig anti -insulin (1 : 100; 1-8510; Sigma- Aldrich) or rabbit anti- glucagon (1 : 100; 219-01; Signet Labs). Biotinylated rabbit anti-rat (1 :300; E0467;
Dako), goat anti-rabbit IgG (Alexa Fluor 568-conjugated) (1 :200; A11011;
ThermoFisher), goat anti-guinea pig IgG (Alexa Fluor 488-conjugated) (1 :300; Al 1073;
ThermoFisher) or rabbit anti-guinea pig coupled to peroxidase (1 :300; P0141; Dako) were used as secondary antibodies. The ABC peroxidase kit (Pierce) was used for immunodetection, and sections were counterstained in Mayer's hematoxylin. Hoechst
(B2261; Sigma- Aldrich) was used for nuclear counterstaining of fluorescent specimens.
PicroSirius Red staining and Masson's trichrome staining were used to evaluate fibrosis.
The percentage of β-cell area in the pancreas was analyzed in two insulin-stained sections 200 μηι apart, by dividing the area of all insulin+ cells in one section by the total pancreas area of that section, β-cell mass was calculated by multiplying pancreas weight by percentage of β-cell area, as previously described (Jimenez et al, 2011). RNA analysis
Total RNA was obtained from adipose depots or liver by using QIAzol Lysis Reagent (Qiagen NV, Venlo, NL) or Tripure isolation reagent (Roche Diagnostics Corp., Indianapolis, IN, US), respectively, and RNeasy Lipid Tissue Minikit (Qiagen NV, Venlo, NL). In order to eliminate the residual viral genomes, total RNA was treated with DNAsel (Qiagen NV, Venlo, NL). For RT-PCR, 1 μg of RNA samples was reverse- transcribed using Transcriptor First Strand cDNA Synthesis Kit (04379012001, Roche, California, USA). Real-time quantitative PCR was performed in a SmartCyclerll® (Cepheid, Sunnyvale, USA) using EXPRESS SYBRGreen qPCR supermix (Invitrogen™, Life Technologies Corp., Carslbad, CA, US). Data was normalized with RplpO values and analyzed as previously described (Pfaffl, M., Nucleic Acids Res. 2001; 29(9):e45).
Hormone and metabolite assays
Blood glucose levels were measured with a Glucometer Elite™ analyzer (Bayer, Leverkusen, Germany). Circulating levels of FGF21 were determined by quantitative sandwich enzyme immunoassay Mouse/Rat FGF-21 ELISA kit (MF2100, R&Dsystems, Abingdon, UK). Serum insulin concentrations were determined by Rat Insulin ELISA sandwich assay (90010, Crystal Chem INC. Downers Grove, IL 60515, USA). To extract lipids from tissue, frozen samples of approximately 100 mg were weighted and homogenized in 15 ml chloroform:methanol (2: 1). Lipid and aquous phases were then separated by adding 3 ml of H2SO4 0.05 % and keeping them overnight at 4° C. Once the phases were separated, the aqueous superior phase was eliminated using a Pasteur pipet and 1 ml of the inferior lipid phase was recuperated in a glass tube. 1 ml of a chloroform and Triton X- 100 at 1 % solution was added to the glass tube and it was incubated at 90° C in a bath, to evaporate the chloroform. By the use of the chloroform and Triton X-100 mix, any remaining aquous particle was eliminated from the lipid phase. After the evaporation, chloroform was rinsed to the walls of the tube to concentrate the sample and, it was warmed again at 90° C to evaporate the chloroform. Once the sediment was completely dry and concentrated, it was ressuspended by the addition of 500 μΐ of H20 miliQ at 37° C. The amount of triglycerides was finally determined using the commercial product GPO-PAP (Roche Diagnostics, Basel, Switzerland). Serum triglycerides and cholesterol were quantified spectrophotometrically using an enzymatic assay kit (Horiba- ABX, Montpellier, France). All biochemical parameters were determined using Pentra 400 Analyzer (Horiba-ABX).
Glycemia was determined using a Glucometer EliteTM (Bayer). Glucagon levels were measured using a glucagon Radioimmunoassay (#GL-32K, EMD Millipore). Adiponectin, leptin, IGFBP1 and IGF1 were determined using the Mouse Adiponectin ELISA kit (80569, Crystal Chem), the Mouse Leptin ELISA kit (90030, Crystal Chem), the IGFBP1 (Mouse) ELISA kit (KA3054, Abnova) and the m/r IGF-I-ELISA kit (E25, Mediagnost), respectively.
Insulin tolerance tests
For insulin tolerance tests, insulin (0.75 IU/kg body wt; Humulin Regular; Eli Lilly, Indianapolis, IN) was injected intraperitoneally into awake fed mice. Glucose concentration was determined in blood samples obtained from the tail vein at the indicated time points after the insulin injection. Glucose tolerance test
Awake mice were fasted overnight (16 h) and administered with an intraperitoneal injection of glucose (2 g/kg body weight). Glycemia was measured in tail vein blood samples at the indicated time points. Venous blood was collected from tail vein in tubes (Microvette® CB 300, SARSTEDT) at the same time points and immediately centrifuged to separate serum, which was used to measure insulin levels.
Oximetry
An indirect open circuit calorimeter (Oxylet, Panlab, Cornelia, Spain) was used to monitor oxygen consumption, carbon dioxide production in eight metabolic chambers simultaneously. Mice were individualized and acclimated to the metabolic chambers for 24h, and data were collected every 15min for 3min in each cage for other 24h. Data were taken from the light and dark cycle and adjusted for body weight. To calculate energy expenditure the Metabolism software provided by the manufacturer was used. Transfection of HEK293, C2C12 and HepG2 cells
Cells were cultured in a 24-well plate and transfected with 0.8 μg of DNA per well using Lipofectamine 2000 following the manufacturer's instructions (Thermo Fisher Scientific).
Bone analysis
Bone volume and architecture were evaluated by μΏ\ Mouse tibiae were fixed in neutral buffered formalin (10%) and scanned using the explore Locus CT scanner (General Electric) at 27-micron resolution. Trabeculae were analyzed in 1 mm3 of proximal tibial epiphysis and 1.8 mm3 of cortical tibial diaphysis in 4 mice/group. Bone parameters were calculated with the Micro View 3D Image Viewer & Analysis Tool. The length of the tibia was measured from the intercondilar eminence to the medial malleolus. Western blot analysis
iWAT and iBAT were homogenized in QIAzol Lysis Reagent (Qiagen) and the protein fraction was isolated from the organic phase following the manufacturer's instructions. Proteins were separated by 12% SDS-PAGE, and analyzed by immunob lotting with rabbit polyclonal anti-UCPl (ab 10983; Abeam) and rabbit polyclonal anti-a-tubulin (ab4074; Abeam) antibodies. Detection was performed using ECL Plus detection reagent (Amersham Biosciences).
Open field test
The open field test was performed between 9:00 am and 1 :00 pm as previously reported(Haurigot et al, 2013). Briefly, animals were placed in the center of a brightly lit chamber (41x41x30 cm) crossed by 2 bundles of photobeams (LE 8811; Panlab) that detect horizontal and vertical movements. Motor and exploratory activities were evaluated during the first 6 minutes. The total distance covered was evaluated using a video tracking system (SMART Junior; Panlab).
Statistical analysis
All values are expressed as mean ± SEM. Differences between groups were compared by Student's t-test. Differences were considered significant at p<0.05. Examples
Example 1. Prevention of obesity and diabetes by intra-eWAT administration of AAV-CAG-moFGF21-dmiRT vectors in C57B16 mice
We evaluated the therapeutic potential of the AAV -mediated genetic engineering of adipose tissue with FGF21 to prevent obesity and diabetes in 8-week-old male C57B16. Intra-eWAT (eWAT: epididymal white adipose tissue) administration of 1012 viral genomes (vg) of AAV9 vectors encoding a murine codon-optimized FGF21 coding sequence under the control of the CAG ubiquitous promoter which included target sites of miR122 and miRl (AAV9-CAG-moFGF21 -doublemiRT) (FIG 1A) mediated adipose-specific overexpression of FGF21 (FIG IB) as well as high secretion of the protein into the bloodstream (FIG 1C). AAV9-CAG-moFGF21-doublemiRT-treated mice also showed overexpression of the FGF21 receptorl (FGF21R1) in eWAT (FIG ID) and β-Klotho (a FGF21 co-receptor) in adipose tissue and liver (FIG IE) in comparison with AAV9-CAG-null vectors (vectors that retain equal infectivity but do not encode any transgene). The CAG-moFGF21 -doublemiRT construct is comprised in SEQ ID NO: 32 and the CAG-null construct is comprised in SEQ ID NO:31.
Following AAV -mediated gene transfer of FGF21 to eWAT, mice fed a chow diet showed loss of body weight (FIGs IF and 1G). When challenged with a high fat diet (HFD), animals overexpressing FGF21 in adipose tissue remained lean for the duration of the experiment whereas AAV9-CAG-null treated mice became progressively obese (FIGs IF and 1G). According to their lower body weight, both chow- and HFD-fed AAV9-CAG-moFGF21 -doublemiRT -treated mice showed decreased weight of adipose depots and liver (FIG 1H).
Histological analysis of white adipose tissue by hematoxylin-eosin staining revealed decreased white adipocyte size in eWAT and iWAT (iWAT: inguinal white adipose tissue) and multiple multilocular adipocytes in iWAT, suggesting that browning of this depot had occurred (FIG 2A). Morphometric analysis further confirmed decreased mean area of white adipocytes in AAV9-CAG-moFGF21-doublemiRT-treated mice (FIG 2B). The frequency distribution of the area of white adipocytes was also different between groups. Both chow- and HFD-fed AAV9-CAG-moFGF21-doublemiRT -treated mice presented increased number of small adipocytes and fewer big adipocytes (FIG 2C). Noticeably, the frequency distribution of the area of white adipocytes in HFD-fed AAV9- CAG-moFGF21-doublemiRT -treated mice was almost identical to that of chow-fed AAV9-CAG-null-treated animals (FIG 2C). Therefore, the HFD-induced hypertrophy of adipocytes observed in AAV9-CAG-null-treated mice was blocked in mice overexpressing FGF21. Overexpression of UCP1 and Dio2 in iWAT (FIGs 3 A and 3B) further confirmed browning of iWAT in chow- and HFD-fed AAV9-CAG-moFGF21- doublemiRT-treated mice.
Histologic analisis of iBAT (iBAT: interscapular brown adipose tissue) showed lower lipid accummulation in this depot in chow- and HFD-fed AAV9-CAG-moFGF21- doublemiRT-treated mice in comparison with AAV9-C AG-null mice (FIG 2A). According to this result and to browning of iWAT, energy expenditure (FIG 3 C) of HFD- fed AAV9-CAG-moFGF21 -doublemiRT-treated mice during the light and dark cycles was higher than that of HFD-fed AAV9-CAG-null mice. Altogether, these data suggest that AAV9-CAG-moFGF21 -doublemiRT-treated mice have increased thermogenic activity.
Liver histologic sections showed decreased lipid accumulation in hepatocytes of mice overexpressing FGF21 compared with AAV9-C AG-null-treated mice both under chow or HFD (FIG 2A). Accordingly, HFD-fed AAV9-CAG-moFGF21 -doublemiRT-treated mice normalized their hepatic content of tryglycerides (TG) (FIG 3D). In parallel, circulating levels of TG, total cholesterol, HDL-cholesterol and LDL-cholesterol were normalized in HFD-fed mice overexpressing FGF21 (FIGs 3E and 3F).
HFD-fed mice overexpressing FGF21 were more insulin sensitive than HFD-fed AAV9- null treated mice (FIG 3G) and both chow- and HFD-fed AAV9-CAG-moFGF21- doublemiRT-treated mice showed decreased insulin circulating levels in comparison with their AAV9-CAG-null treated counterparts (FIG 3H). Example 2. Reversion of obesity and improvement of glucose metabolism by intra- eWAT administration of AAV-CAG-moFGF21-dmiRT vectors in ob/ob mice
We evaluated the anti-diabetic and anti-obesogenic therapeutic potential of the AAV- mediated genetic engineering of adipose tissue with FGF21 in 11 -week-old male ob/ob mice, which have defective leptin signalling and are a widely used genetic model of obesity and diabetes. To this end, a dose-response study was performed. Ob/ob mice were administered locally into the eWAT with four different doses (1010 vg, 5x1010 vg, 2xlOu vg or 1012 vg) of AAV8-CAG-moFGF21-doublemiRT vectors (FIG 1A). As control, ob/ob animals were administered intra-eWAT with 1012 vg of AAV8-CAG-null vectors.
Intra-eWAT administration of AAV8-CAG-moFGF21-doublemiRT vectors mediated specific overexpression of FGF21 in white adipose tissue as well as high secretion of the protein into the bloodstream in a dose-dependent manner (FIGs 4 A and 4B). Specifically, the dose of 1012 vg of AAV8-CAG-moFGF21-doublemiRT vectors mediated a very robust overexpression of FGF21 in eWAT and iWAT (FIG 4 A) and achieved the highest circulating FGF21 levels (FIG 4B). In contrast, the lowest dose administered, 1010 vg of AAV8-CAG-moFGF21-doublemiRT vectors, only produced a very modest overexpression of FGF21 in eWAT (FIG 4A) and animals treated with this dose showed no differences in the serum FGF21 levels in comparison with AAV8-CAG-null treated animals (FIG 4B), probably because FGF21 acted in a paracrine-autocrine manner. Accordingly, whereas AAV8-CAG-null-treated animals progressively increased their body weight, animals treated with AAV8-CAG-moFGF21-doublemiRT vectors showed decreased body weight gain proportional to the dose of vectors administered (FIGs 4C and 4D). Noticeably, animals treated with 1012 vg of AAV8-CAG-moFGF21- doublemiRT vectors lost approximately 15% of weight during the first two weeks after AAV administration and afterwards increased their body weight until they reached the initial body weight (FIGs 4C and 4D). Thus, animals administered intra-eWAT with 1012 vg of AAV8-CAG-moFGF21-doublemiRT vectors showed a 40% difference in total body weight in comparison with AAV8-CAG-null-treated animals at the end of the experiment (FIG 4D). In agreement, animals treated with 1012 vg of AAV8-CAG- moFGF21-doublemiRT vectors showed marked decreased adiposity and a 60%> reduction of the weight of the liver (FIG 4E). iBAT weight was increased in this cohort of mice (FIG 4E), probably due to increased thermogenic activity.
Animals treated with 5xl010 vg, 2xlOn vg or 1012 vg of AAV8-CAG-moFGF21- doublemiRT vectors presented improved insulin sensitivity in comparison with AAV8- CAG-null-treated mice (FIG 5A). Animals treated with 2xlOn vg or 1012 vg of AAV8- CAG-moFGF21 -doublemiRT vectors also showed lower insulin circulating levels than ob/ob mice treated with AAV8-CAG-null vectors (FIG 5B). Example 3. Reversion of obesity and improvement of glucose metabolism by intravenous administration of AAV-hAAT-moFGF21 vectors in ob/ob mice
We also evaluated the anti-diabetic and anti-obesogenic effects mediated by the increased circulating levels of FGF21 by means of AAV -mediated genetic engineering of the liver in 8-week-old male ob/ob mice. Ob/ob mice were administered intravenously (IV) with 1011 vg or 5xlOu vg of AAV8 vectors encoding a murine codon-optimized FGF21 coding sequence under the control of the liver- specific human a 1 -antitrypsin (hAAT) promoter (AAV8-hAAT-moFGF21) (FIG 6A). As control, ob/ob animals were administered IV with 5xlOu vg of AAV8-hAAT-null vectors. The hAAT-moFGF21 construct is comprised in SEQ ID NO: 34 and the hAAT -null construct is comprised in SEQ ID NO:33.
Intravenous administration of AAV8-hAAT-moFGF21 vectors mediated specific overexpression of FGF21 in the liver as well as high secretion of the protein into the bloodstream in a dose-dependent manner (FIGs 6B and 6C). Specifically, the dose of 5xlOu vg of AAV8-hAAT-moFGF21 vectors mediated a very robust overexpression of FGF21 in the liver (FIG 6B) and achieved the highest circulating FGF21 levels (FIG 6C). The body weight of animals treated with this dose of AAV8-hAAT-moFGF21 vectors decreased approximately 7% during the two first weeks after AAV administration and afterwards slightly increased whereas AAV8-fiAAT-null-treated mice progressively put on weight (FIGs 6D, 6E and 6F). Mice administered with 1011 vg of AAV8-hAAT- moFGF21 vectors gained markedly much less weight than AAV8 -hAAT -null-treated animals (FIGs 6D, 6E and 6F). Specifically, AAV8 -hAAT -null animals showed a 50% increase in their body weight at the end of the experiment in comparison with the 10% weight gain of animals treated with 1011 vg of AAV8-hAAT-moFGF21 vectors (FIG 6E). According to their lower body weight, animals overexpressing FGF21 in the liver showed significant decreased adiposity, particularly in those animals treated with the highest dose of vectors, and approximately a 60% reduction of the liver weight (FIG 6G). iBAT weight was similarly increased in both groups of AAV8-hAAT-moFGF21 -treated mice (FIG 6G), probably due to higher thermogenic activity in these animals in comparison with mice administered with AAV8-hAAT-null vectors. Animals treated with AAV8-hAAT-moFGF21 vectors showed improved insulin sensitivity and decreased insulin circulating levels in comparison with AAV8-hAAT- null-treated mice (FIGs 6H and 61)
Example 4. Long-term reversion of obesity and diabetes by intravenous administration of AAV-hAAT-moFGF21 vectors in HFD-fed mice
We also evaluated the anti-diabetic and anti-obesogenic effects mediated by the increased circulating levels of FGF21 by means of AAV -mediated genetic engineering of the liver in obese C57B16 mice. Nine -week-old male C57B16 mice (young adults) were fed a HFD for 9 weeks and then administered IV with 1010 vg or 5xl010 vg of AAV8-hAAT-moFGF21 vectors (FIG 6A). After AAV administration, AAV8-hAAT- moFGF21 -treated mice were maintained on HFD for 52 weeks. As controls, 5xl010 vg of AAV8-hAAT-null were administered IV to chow- and HFD-fed C57B16 mice. These two latter cohorts of mice were maintained either on chow diet or HFD thereafter.
Intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice mediated high secretion of FGF21 into the bloodstream in a dose-dependent manner (FIGs 7A). No differences in body weight were observed between HFD-fed AAV8 -null-treated mice and HFD-fed animals administered with 1010 vg of AAV8-hAAT-moFGF21 vectors (FIGs 7B and 7C). However, HFD-fed animals treated with 5xl010 vg of AAV8-hAAT- moFGF21 vectors initially lost 20% of body weight after AAV administration and then progressively gained weight similarly to chow-fed AAV8-hAAT -null-treated mice (FIGs 7B and 7C). Noticeably, from week 9 after AAV administration onwards no statistical significant differences were observed in the total body weight and body weight gain between HFD-fed animals administered with 5xl010 vg of AAV8-hAAT-moFGF21 vectors and chow-fed AAV8-hAAT -null-treated mice (FIGs 7B and 7C).
The energy expenditure of HFD-fed mice treated with 5xl010 vg of AAV8-hAAT- moFGF21 vectors during the light and dark cycles was higher than that of chow- and HFD-fed AAV8-hAAT-null mice (FIG 8A). No differences in energy expenditure were observed among chow- and HFD-fed AAV8-hAAT -null-treated animals and mice administered with 1010 vg of AAV8-hAAT-moFGF21 vectors (FIG 8 A). Altogether, these data suggest that mice treated with 5x1010 vg of AAV8-hAAT-moFGF21 have increased thermogenic activity. Animals treated with 1010 vg of AAV8-hAAT-moFGF21 vectors presented improved insulin sensitivity in comparison with HFD-fed mice administered with AAV8-hAAT- null vectors and their insulin sensitivity was similar to that of chow-fed mice treated with AAV8-hAAT-null vectors (FIG 8B). Noticeably, animals administered with 5xl010 vg of AAV8-hAAT-moFGF21 vectors presented improved insulin sensitivity in comparison with chow-fed mice administered with AAV8-hAAT-null vectors and showed normalized insulin circulating levels (FIGs 8B and 8C).
Example 5. Reversion of obesity and diabetes by intravenous administration of AAV-hAAT-moFGF21 vectors in old HFD-fed mice
We also evaluated the anti-diabetic and anti-obesogenic effects of FGF21 in obese old (adults) C57B16 mice. Seven and a half-month-old male C57B16 mice were fed a HFD for 8 weeks and then administered IV with 1010 vg, 2xl010 vg or 5xl010 vg of AAV8- hAAT-moFGF21 vectors (FIG 6A). After AAV administration, AAV8-hAAT- moFGF21 -treated mice were maintained on HFD for 22 weeks. As controls, 5xl010 vg of AAV8-hAAT-null were administered IV to chow- and HFD-fed old C57B16 mice. These two latter cohorts of mice were maintained either on chow diet or HFD thereafter. Intravenous administration of AAV8-hAAT-moFGF21 vectors in old HFD-fed mice mediated high secretion of FGF21 into the bloodstream in a dose-dependent manner (FIGs 9A). No differences in body weight were observed between HFD-fed AAV8 -null-treated mice and HFD-fed animals administered with 1010 vg of AAV8-hAAT-moFGF21 vectors (FIGs 9B and 9C). However, HFD-fed animals treated with either 2x1010 vg or 5x1010 vg of AAV8-hAAT-moFGF21 vectors initially lost 15 and 20%, respectively, of body weight after AAV administration (FIGs 9B and 9C). Thereafter, animals treated with 2xl010 vg of AAV8-hAAT-moFGF21 vectors progressively gained weight similarly to chow-fed AAV8-fiAAT-null-treated mice whereas no significant changes in body weight of animals treated with 5xl010 vg of AAV8-hAAT-moFGF21 vectors were observed (FIGs 9B and 9C). Noticeably from week 3 after AAV administration onwards no statistical significant differences were observed in the total body weight and body weight gain between HFD-fed animals administered with 5xl010 vg of AAV8-hAAT-moFGF21 vectors and chow-fed AAV8-hAAT -null-treated mice (FIGs 9B and 9C).
The energy expenditure of HFD-fed mice treated with 5x10 vg of AAV8-fiAAT- moFGF21 vectors during the light and dark cycles was higher than that of chow- and HFD-fed AAV8-hAAT-null mice (FIG 10A). Animals treated with 2xl010 vg of AAV8- hAAT-moFGF21 vectors showed increased energy expenditure during the light cycle and a tendency to increase energy expenditure during the dark cycle (FIG 10A). Animals treated with 1010 vg of AAV8-hAAT-moFGF21 vectors showed increased energy expenditure during the dark cycle (FIG 10A). No differences were observed among chow- and HFD-fed AAV8-fiAAT-null-treated animals and mice administered with 1010 vg of AAV8-hAAT-moFGF21 vectors (FIG 10A). Altogether, these data suggest that old mice treated with AAV8-hAAT-moFGF21 have increased thermogenic activity.
Animals treated with 1010 vg or 2xl010 vg of AAV8-hAAT-moFGF21 vectors presented improved insulin sensitivity in comparison with HFD-fed mice administered with AAV8-hAAT-null vectors and their insulin sensitivity was similar to that of chow-fed mice treated with AAV8-hAAT-null vectors (FIG 10B). Noticeably, animals administered with 5xl010 vg of AAV8-hAAT-moFGF21 vectors presented improved insulin sensitivity in comparison with chow-fed mice administered with AAV8-hAAT- null vectors (FIG 10A). Animals treated with 1010 vg, 2xl010 vg or 5xl010 vg of AAV8- hAAT-moFGF21 vectors showed lower fasted and fed insulin circulating levels than HFD-fed AAV8-hAAT-null-treated mice (FIG IOC). Noticeably, no differences in fed insulin circulating levels were observed between old animals administered IV with 2xl010 vg or 5xl010 vg of AAV8-hAAT-moFGF21 vectors and chow-fed AAV8-hAAT- null-treated mice (FIG IOC).
Example 6. Evaluation of weight loss by intramuscular administration of AAV- CMV-moFGF21 vectors in C57B16 mice
We also evaluated the therapeutic potential of increasing FGF21 circulating levels by the AAV-mediated genetic engineering of skeletal muscle in C57B16 mice. In order to target the skeletal muscle, the CMV promoter and the AAVl serotype were selected. Although the CMV promoter is an ubiquitous promoter, its concomitant use together with the AAVl capsids enables to very efficiently target the skeletal muscle without transducing the liver, as previously published (Mas et al, Diabetes 2006; Callejas et al, Diabetes 2013). A dose of 3xl0u vg of AAVl vectors encoding a murine codon-optimized FGF21 coding sequence under the control of the ubiquitous CMV promoter (AAVl-CMV-moFGF21) (FIG 11 A) were administered by intramuscular injection in the quadriceps, gastrocnemius, and tibialis cranealis of each hind limb (5xl010 vg/muscle) of 6 to 12- week-old male C57BL6 mice. As control, age-matched C57B16 animals were administered intramuscularly in the same muscles with 3xl0u vg of AAVl-CMV-null vectors (5xl010 vg/muscle). The CMV-moFGF21 construct is comprised in SEQ ID NO: 36 and the CMV-null construct is comprised in SEQ ID NO:35.
Intramuscular administration of AAVl-CMV-moFGF21 vectors mediated high secretion of FGF21 into the bloodstream (FIG 1 IB). Animals treated with AAVl-CMV-moFGF21 vectors showed decreased body weight and body weight gain in comparison with AAVl - CMV-null-treated mice (FIGs 11C and 11D). Example 7. Increased protein production by codon-optimized human FGF21 nucleotide sequences
To evaluate if codon-optimization was able to mediate increased FGF21 protein production, HEK293 cells were transfected with plasmids encoding three different codon-optimized human FGF21 nucleotide sequences (SEQ ID NO's: 40-42). As control, non-transfected cells and cells transduced with wild-type hFGF21 coding sequence were used. Expression of the three codon-optimized human FGF21 sequences and the WT human FGF21 sequence was under the control of the hAAT promoter (SEQ ID NO:47). Cells transduced with either codon-optimized human FGF21 version 1 or 3 were able to secrete higher human FGF21 levels into the culture media in comparison with wild-type or codon-optimized FGF21 variant 2 (FIG 12), thus demonstrating increased FGF21 protein production by codon-optimization of variants 1 and 3. Example 8. Reversion of obesity and diabetes in mice by administration of AAV vectors encoding human FGF21 (in vivo experiment proving the activity of FGF21)
HFD-fed mice are treated with AAV vectors encoding human FGF21. As controls, the same dose of AAV-null vectors is administered to chow- and HFD-fed mice.
To evaluate the capacity of human FGF21 to induce browning of WAT and thermogenic activity of BAT, to increase energy expenditure and to improve glucose and energy metabolism, the following tests are performed:
- measurement of body weight and food and liquid intake weekly
- measurement of body temperature
- measurement of energy expenditure and respiratory quotient by indirect calorimetry
- measurement of glycemia
- evaluation of whole-body glucose disposal by intraperitoneal glucose tolerance test
- evaluation of insulin sensitivity by intraperitoneal insulin tolerance test
- analyses in tissue and serum samples, including
- examination of the level of overexpression of human FGF21 in the targeted tissue and into the bloodstream
- morphological and histological analysis. - determination of circulating levels of hormones and cytokines
- determination of serum metabolic parameters, such as free fatty acids, glycerol, triglycerides, cholesterol and ketone bodies
- evaluation of browning capacity by examination of the presence of beige adipocytes in the inguinal fat pad by immunohistochemistry, and gene expression of classic white, brown and beige adipocyte markers
Example 9: In vitro assay for assessing FGF21 activity FGF21 is expected to increase glucose uptake and GLUT1 expression in 3T3-L1 cells (Kharitonenkov, A. et al., 2005. J. Clin. Invest 115:1627-1635).
Example 10. Reversion of obesity and improvement of glucose metabolism by intra- eWAT administration of AAV8-CAG-moFGF21-dmiRT vectors in ob/ob mice: further observations
We further evaluated the anti-diabetic and anti-obesogenic therapeutic potential of the AAV-mediated genetic engineering of adipose tissue with FGF21 in ob/ob mice (see Example 2).
Ob/ob mice that received intra-eWAT injections of AAV8-CAG-moFGF21-dmirT vectors showed a reduction in the size of white adipocytes of the epididymal pad (FIG 13A). Circulating adiponectin levels also increased with dose (FIG 14A). eWAT inflammation, evaluated through Mac2 staining, was also reduced as a function of the dose of vector, as did the expression of the macrophage marker F4/80 (FIG 14B and C). The liver of ob/ob mice injected with null vectors or the lowest dose of AAV8-CAG- moFGF21-dmirT showed accumulation of lipid droplets in hepatocytes (FIG 13B). The administration of doses of 5xl010 vg/mouse or higher of FGF21 -encoding vectors completely prevented the development of hepatic steatosis (FIG 13B), which correlated with the weight of the organ (FIG 14D) and its total triglyceride and cholesterol content (FIG 14E and F). Further evidence that the dose of 5x1010 vg/mouse represented a threshold for therapeutic efficacy came from the analysis of glycemia and insulinemia. While the dose of lxlO10 vg/mouse did not modify the levels of blood glucose in the fed state and only partially reduced insulin levels, doses of 5xl010 vg/mouse and higher completely normalized glycemia and insulinemia (FIG 13C and D). Altogether, this example confirms the therapeutic potential of overexpressing FGF21 in adipose tissue.
Example 11. Reversion of obesity and improvement of glucose metabolism by intravenous administration of AAV8-hAAT-moFGF21 vectors in ob/ob mice: further observations
We further evaluated the anti-diabetic and anti-obesogenic therapeutic potential of intravenous administration of AAV8-hAAT-moFGF21 vectors in ob/ob mice (see Example 3).
In agreement with their lower body weight, ob/ob animals overexpressing FGF21 in the liver showed significantly decreased size of white adipocytes, particularly those animals treated with 5xlOu vg (FIG 15A). This was parallel with a dose-dependent increase in circulating adiponectin levels (FIG 15B) and decreased WAT inflammation, as evidenced by decreased staining for Mac2 and expression of F4/80 and TNF-a in eWAT (FIG 16A-C). Noticeably, ob/ob mice treated with 5x1011 vg showed a remarkable reduction in "crown-like" structures in eWAT (FIG 16A).
While 7-month-old ob/ob mice showed marked hepatic steatosis, the liver of FGF21 - treated ob/ob mice did not show accumulation of lipids in hepatocytes (FIG 15C). This agreed with a 60% reduction in the weight of this organ (FIG 16D and E) as well as with a marked reduction in the total liver triglyceride and cholesterol content (FIG 16F and G) in ob/ob mice receiving therapeutic vectors. Ob/ob animals treated with both doses of AAV8-hAAT-moFGF21 also showed decreased fed glycemia, and their insulinemia in the fed state was reduced by -70% (FIG 15D and E).
We evaluated whether the decrease in circulating glucose levels observed in ob/ob mice after AAV8-hAAT-moFGF21 treatment resulted from suppression of hepatic gluconeo genesis by measuring the expression by qPCR of phosphoenolpyruvate carboxykinase (PEPCK) and glucose-6-phosphatase (G6Pase). No changes in the expression of these enzymes were observed in the liver of AAV8-hAAT-moFGF21- treated ob/ob mice, except for the animals treated with lxl 011 vg of AAV8-hAAT- moFGF21 that showed increased PEPCK expression (FIG 17A and B). These results suggested that AAV-mediated long-term expression of FGF21 in the liver, and the subsequent increase of circulating FGF21, did not lower glucose by inhibiting hepatic glucose production.
The glucose-lowering effects of FGF21 have also been attributed to increased glucose uptake by adipocytes and enhanced energy expenditure (Xu J. et al, 2009. AJP Endocrinol. Metab. 297:E1105-El 114; Ding X. et al, 2012. Cell Metab. 16:387-393; Camacho R.C. et al., 2013. Eur. J. Pharmacol. 715:41-45; Emanuelli B. et al., 2014. Clin. Invest. 124:515-527; Kharitonenkov A. et al, 2005. Endocrinology 148: 774-781; Hondares E. et al, 2010. Cell Metab. 11 :206-212; Samms R.J. et al, 2015. Cell Rep. 11:991-999). Thus, we assessed in different pads of adipose tissue (iWAT, eWAT and iBAT) the expression of key components of the glucose uptake machinery by qPCR, such as the glucose transporters Glutl and Glut4, the glucose phosphorylating enzymes hexokinase I and II (HKI and HKI), and UCP1 in the case of iBAT. In AAV8-FGF21 treated ob/ob mice, the expression of Glutl was increased in iWAT and iBAT (FIG 17C), and that of Glut4 was increased in eWAT, iWAT and iBAT (FIG 17D). HKI and HKII were upregulated only in iBAT (FIG 17E and F). Moreover, UCP1 expression was increased in the iBAT of ob/ob mice treated with the high dose of AAV8-hAAT- moFGF21 vectors (FIG 17G). Altogether, these results suggest that the long-term amelioration of glycemia observed in ob/ob mice following treatment with AAV8- hAAT-moFGF21 vectors probably results from increased glucose uptake by white and brown adipocytes and enhanced thermogenesis in iBAT.
Example 12. Long-term reversion of obesity and diabetes by intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice and HFD-fed old mice: decreased tissue weight and stable expression up to 1 year
Representative images of animals belonging to all experimental groups of the studies performed in young adults or in adults (see Examples 4 and 5) are shown in FIG 19A-B. The reversion of obesity by AAV8-bAAT-moFGF21 treatment was parallel to a dose- dependent decrease in the weight of the main white adipose tissue (WAT) depots, such as the epididymal (eWAT), inguinal (iWAT) and retroperitoneal (rWAT) fat pads, both in animals treated as young adults or as adults (FIG 18A and FIG 19C). The HFD- induced increase in the weight of the liver was completely normalized by FGF21 gene transfer at the highest doses of vector used, whereas the weight of the quadriceps was unchanged by the diet or AAV delivery (FIG 18A and FIG 19D). AAV8-hAAT-moFGF21 -treated mice of both ages showed specific overexpression of codon-optimized FGF21 in the liver (FIG 19E), which resulted in secretion of FGF21 into the bloodstream in a dose-dependent manner in both groups of mice, with levels remaining stable for up to 1 year after a single administration of the vector (FIG 18B).
Example 13. Long-term reversion of obesity and diabetes by intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice and HFD-fed old mice: increased locomotor activity and investigating the thermogenic mechanism
Increased energy expenditure (see Examples 4 and 5) was also seen in animals treated as young adults 10 months after AAV8 -hAAT-moFGF21 delivery (FIG 21 A).
This observation was in agreement with AAV8-hAAT-moFGF21 -mediated effects on locomotor activity. In contrast to the hypoactivity observed in the open field test in the animals fed a HFD that received AAV8-null vectors, mice treated with 5xl010 vg AAV8- hAAT-moFGF21 as young adults showed the same degree of spontaneous locomotor activity than chow-fed, null-injected animals. As shown in FIG 20A, 1 year after AAV8- hAAT-moFGF21 delivery, treated animals travelled more distance, rested less time, and spent more time doing slow and fast movements than untreated HFD-fed controls. Given that changes in energy expenditure may reflect changes in thermogenesis, we evaluated the degree of activation of the brown adipose tissue (BAT). Both mice treated as young adults or adults with 5xl010 vg AAV8-hAAT-moFGF21 showed decreased lipid deposition in iBAT (FIG 20B). The content of UCP1 protein in BAT was increased in a dose-dependent manner in mice treated with AAV8-hAAT-moFGF21 vectors as young adults (FIG 20C), consistent with an increase in non-shivering thermogenesis induced by FGF21 gene transfer to the liver.
The browning of the subcutaneous WAT, characterized by the appearance of beige adipocytes, is also associated with increases in energy expenditure (Harms & Seale, 2013). To evaluate if browning was accountable for the enhancement of energy expenditure observed following AAV8-hAAT-moFGF21 treatment, histological evaluation of iWAT was performed. In agreement with the decreased weight of this pad (Fig 18 A), the adipocytes of HFD-fed AAV8-hAAT-moFGF21 -treated animals were smaller than those of HFD-fed null-injected animals (FIG 20D). Treatment with AAV8- hAAT-moFGF21 vectors, nevertheless, did not result in increased detection of multilocular beige adipocytes in iWAT at any of the doses tested, either in animals treated as young adults or adults (FIG 20D). Accordingly, there were no statistically significant differences in the levels of UCP1 protein in iWAT between the HFD-fed groups (FIG 2 IB).
The creatine-driven substrate cycle and sarco/endoplasmic reticulum Ca2+-ATPase 2b (Serca2b)-mediated calcium cycling can increase thermogenesis in iWAT independently of UCP1 (Kazak L. et al, 2015. Cell 163:643-655; Ikeda K. et al, 2017. Nat. Med. 23: 1454-1465). Higher levels of expression of phosphatase orphan 1 (Phosphol), an enzyme involved in the creatine-driven substrate cycle, were observed in iWAT of HFD- fed mice treated with 5xl010 vg of AAV8-hAAT-moFGF21 when compared with age- matched, chow- and HFD-fed control groups (FIG 20E), suggesting that the activity of the creatine-driven cycle was probably increased as a result of FGF21 gene transfer. Regarding the calcium cycling-dependent thermogenic mechanism, no differences in the expression levels of Serca2b were detected in the iWAT of animals treated with AAV8- hAAT-moFGF21 vectors when compared with chow- or HFD-fed null-treated animals (FIG 21C). On the other hand, the iWAT expression of ryanodine receptor 2 (RyR2), another enzyme involved in the same cycle, was increased by HFD-feeding in both null- and AAV8-hAAT-moFGF21 -treated mice (FIG 21C). Altogether, these results suggest that the calcium cycling-dependent thermogenic mechanism is not involved in the improvement of whole-body energy homeostasis observed after AAV-FGF21 treatment.
Example 14. Long-term reversion of obesity and diabetes by intravenous administration of AAV8-hAAT-moFGF21 vectors in HFD-fed mice and HFD-fed old mice: glucagon levels, islet hyperplasia and glucose tolerance
Moreover, HFD-fed animals treated as young adults with AAV8-hAAT-moFGF21 vectors showed decreased circulating levels of glucagon compared with HFD-fed null- treated mice (FIG 22A).
While AAV8-null-treated mice developed islet hyperplasia as a consequence of HFD feeding, the β-cell mass of animals treated with AAV8-hAAT-FGF21 vectors (at the doses of 2xl010 or 5xl010 vg/mouse) was similar to that of control mice fed a chow diet (FIG 22B and C). Double immunostaining for insulin and glucagon of pancreatic sections from HFD-fed AAV8-hAAT-moFGF21 -treated mice showed normal distribution of a and β cells in the islets of these animals, with localization of glucagon-expressing cells in the periphery of the islet and of insulin-expressing cells in the core (FIG 22D).
To evaluate glucose tolerance in FGF21 -treated mice, an intraperitoneal glucose tolerance test (GTT) (2 g glucose/kg bw) was performed 10 weeks after AAV administration. HFD-fed animals injected with either null or FGF21 -encoding vectors at a dose of lxlO10 vg/mouse were glucose intolerant and showed markedly increased circulating levels of insulin during the GTT (FIG 23 A and B). In contrast, animals treated with 5xl010 vg/mouse of AAV8-hAAT-moFGF21 showed improved glucose clearance when compared to chow-fed control mice (FIG 23 A). Insulin levels were indistinguishable between these two experimental groups (FIG 23B). These results further confirmed improved insulin sensitivity in HFD-fed mice treated with 5x1010 vg/mouse of AAV8-hAAT-moFGF21.
Example 15. Reversion of HFD-associated WAT hypertrophy and inflammation by intravenous administration of AAV8-hAAT-moFGF21 vectors HFD-feeding induces an increase in the size of WAT adipocytes (Sattar N. & Gill J.M.R., 2014. BMC Med. 12: 123). Administration of FGF21 -encoding vectors counteracted this increase (FIG 24 A). Morphometric analysis of WAT revealed that the area of white adipocytes of animals treated as young adults with lxlO10 or 5xl010 vg of vector, and of mice treated as adults with 2xl010 or 5xl010 vg of vector was similar to that of animals fed a chow diet (FIG 24B). In both groups of FGF21 -treated animals, there was a redistribution of the size of adipocytes, with a greater proportion of smaller adipocytes (FIG 25A). In agreement with the decrease in adiposity and reversal of WAT hypertrophy, adiponectin and leptin levels were also normalized in animals treated with highest doses of AAV8-hAAT-moFGF21 vectors, irrespective of the age of initiation of the treatment (FIG 24C and D).
Obesity also causes the inflammation of WAT (Hajer G.R. et al., 2008. Eur. Heart J. 29:2959-2571). Thus, we analyzed inflammation in this tissue through immunostaining for the macrophage-specific marker Mac2 and the expression of pro -inflammatory molecules. While HFD-fed mice showed increased presence of macrophages, revealed as "crown-like" structures, in the eWAT, animals treated as young adults or adults with 5xl010 vg AAV8-hAAT-moFGF21 had no sign of macrophage infiltration (FIG 24E and FIG 25B). This was parallel to the normalization in the expression of the macrophage markers F480 and CD68 and of the pro-inflammatory cytokines TNFa and IL-Ιβ (FIG 24F-H and FIG 25C-E), indicating that FGF21 expression counteracted the inflammation of WAT associated to obesity.
Example 16. Reversal of hepatic steatosis, inflammation and fibrosis by intravenous administration of AAV8-h AAT-moFGF21 vectors
Histological analysis of the liver showed that all null-treated animals fed a HFD had marked hepatic steatosis at the time of sacrifice (FIG 26A-D). In contrast, HFD-fed mice receiving 5xl010 vg AAV8-hAAT-moFGF21 as young adults or as adults evidenced reversal of this pathological deposition of lipids (FIG 26A). These histological findings were parallel to a marked reduction in the total liver triglyceride and cholesterol content of 5xl010 vg AAV8-hAAT-moFGF21 -treated animals (FIG 26B and C). In addition, animals fed a HFD and treated with 5x1010 vg AAV8-hAAT-moFGF21 vectors when young adults or adults showed no sign of hepatic inflammation, as evidenced by the lack of staining for Mac2, which revealed increased presence of macrophages in the livers of null-treated HFD-fed mice (FIG 26D). Finally, FGF21 gene transfer to the liver reversed hepatic fibrosis. While collagen fibers were readily detectable following PicroSirius Red staining or Masson's trichrome staining of liver sections from animals fed a HFD and injected with control null vectors, they were undetectable in the livers of AAV8-hAAT- moFGF21 treated mice (FIG 28A and FIG 27). These mice also showed markedly reduced hepatic expression of collagen 1 (FIG 28B and C). Altogether these findings indicated that AAV8-hAAT-moFGF21 treatment protected from the development of HFD-induced non-alcoholic steatohepatitis (NASH). Example 17. Long-term safety of liver-directed AAV-FGF21 treatment
Pharmacological treatment with FGF21 or transgenic overexpression have been associated with perturbation of bone homeostasis through increased bone resorption, which could cause bone loss (Wei W. et al, 2012. Proc. Natl. Acad. Sci. 109:3143-3148; Wang X. et al, 2015. Cell Metab. 22:811-824; Charoenphandhu N. et al, 2017. J. Bone Miner. Metab. 35: 142-149; Talukdar S. et al, 2016. Cell Metab. 23:427-440; Kim A.M. et al, 2017. Diabetes, Obes. Metab). Given the therapeutic potential of AAV8-hAAT- moFGF21 for the treatment of obesity and diabetes, we evaluated the long-term effects of gene transfer on the bones of the animals treated with the highest dose of vector. At the time of sacrifice (~16.5 months of age), the naso-anal length and the tibial length were normal in the animals that were administered with AAV8-hAAT-moFGF21 vectors at 9 or 29 weeks of age (FIG 29A and B). We then examined bone structure by micro- computed tomography ^CT). Analysis of the proximal epiphysis of the tibia revealed no significant differences in the trabecular and cortical bone of mice fed a HFD and administered with 5xl010 vg AAV8-hAAT-moFGF21 in comparison with age-matched mice treated with null vectors. Specifically, no differences were documented in the bone mineral density (BMD) (FIG 29C), bone mineral content (BMC) (FIG 29D), bone volume (BV) (FIG 29E), bone volume/tissue volume ratio (BV/TV) (FIG 29F), bone surface/bone volume ratio (BS/BV) (FIG 29G), trabecular number (Tb.N) (FIG 29H), trabecular thickness (Tb.Th) (FIG 291) or trabecular separation (Tb.Sp) (FIG 29J). Similarly, the analysis of the compact bone at the tibial diaphysis showed no differences in the BMC, BMD, BV, BV/TV or BS/BV between the HFD-fed null-injected or FGF21 - treated groups (FIG 29K-0).
The pathological effects of FGF21 have been reported to be mediated, at least in part, by increased production of Insulin- like Growth Factor Binding Protein 1 (IGFPB1) by the liver (Wang X. et al., 2015. Cell Metab. 22:811-824). In agreement with the lack ofbone alterations, high-dose AAV8-hAAT-moFGF21 treatment did not lead to an increase in the levels of circulating IGFBP1 protein in animals treated 12 (young adults) or 6 (adults) months earlier when compared to null-injected HFD-fed mice (FIG 29P). Circulating IGF1 levels were also normal in all experimental groups (FIG 29Q). Altogether these results support the safety for bone tissue of AAV -mediated FGF21 gene transfer to the liver.
Example 18. Prevention of HFD-induced liver tumours by intravenous administration of AAV8-hAAT-moFGF21 vectors Long-term feeding (>60 weeks) with a HFD has been associated with increased incidence of liver neoplasms in C57BL/6J mice (Hill-Baskin A.E. et al., 2009. Hum. Mol. Genet. 18:2975-2988; Nakagawa H., 2015. World J. Hepatol. 7:2110). In our study in animals that initiated the HFD as young adults and maintained it for 60 weeks we found liver tumours in 66.7% (6/9) of animals injected with null-vectors. Animals treated with AAV8-hAAT-moFGF21 vectors were protected from HFD-induced development of liver neoplasms: 0% (0/8) of animals treated with the 5xl010 vg of FGF21 -encoding vectors showed tumours, and the incidence was 40%> (4/10) in the cohort treated with the lowest dose (lxlO10 vg). None (0/11) of the chow-fed mice developed tumours in the same period of time (Table 1).
Table 1. Liver tumour incidence in young adults.
Example 19. Amelioration of STZ-induced hyperglycemia by liver-specific AAV8- mediated FGF21 over expression
Material and Methods
Animals
We used 9-week-old male C57bl6 mice. Mice had free access to a standard diet and were kept under a 12 h light-dark cycle (lights on at 08:00 hours). For diabetes induction, mice received five intraperitoneal injections, on consecutive days, of streptozotocin (50 mg/kg) dissolved in 0.1 mol/1 citrate buffer (pH 4.5). Blood glucose levels were assessed using an analyser (Glucometer Elite; Bayer, Leverkusen, Germany). Animal care and experimental procedures were approved by the Ethics Committee in Animal and Human Experimentation of the Universitat Autonoma de Barcelona. In vivo administration of AAV vectors
For systemic administration, AAV vectors were diluted in 200 μΐ of 0.001% F68 Pluronic® (Gibco) in PBS and injected via the tail vein. Results
In order to test the protective potential against type 1 diabetes of AAV-derived FGF21, 5xl010 vg or 2xlOn vg of AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (AAV8-hAAT-moFGF21) were administered IV to male 9-week-old C57B16 mice. Control mice received 2xlOu vg of AAV8-hAAT-Null vectors. Two weeks post- AAV administration, all animals were treated with streptozotocin (STZ) (5 doses of 50 mg/kg; 1 dose per day) to trigger the diabetic process.
Analysis of the blood glucose levels revealed that animals treated with AAV8 vectors encoding moFGF21 displayed lower circulating glucose levels than C57B16 mice treated with AAV8-hAAT-Null vectors (FIG 30).
Example 20. Extension of healthy lifespan by intramuscular administration of AAV-CMV-moFGF21 vectors in C57B16 mice due to the prevention of weight gain and insulin resistance associated with aging.
Skeletal muscle (Skm) is a readily accessible tissue and has been used to produce secretable therapeutic proteins (Haurigot V. et al, 2010. J. Clin. Invest. 123:3254-3271; Callejas D. et al, 2013. Diabetes 62: 1718-1729; Jaen M . et al, 2017. Mol. Ther. Methods Clin. Dev. 6: 1-7). To explore if the Skm could represent a viable source of circulating FGF21, AAV vectors of serotype 1, which show a high tropism for Skm (Chao L. et al, 2000. J. Clin. Invest. 106: 1221-1228; Wu Z. et al, 2006. J. Virol. 80:9093-9103; Lisowski L. et al, 2015. Curr. Opin. Pharmacol. 24:59-67), carrying murine optimized FGF21 under the control of the CMV promoter were used (AAVl - CMV-moFGF21). Vectors were injected at a dose of 5xl010 vg/muscle to the quadriceps, gastrocnemius and tibialis cranialis of both legs (total dose, 3x 1011 vg/mouse) of 8-week- old C57B16 mice. Control animals were injected with AAVl-CMV-Null vectors at the same dose. The use of healthy mice fed a standard diet further allowed us to evaluate the long-term safety of FGF21 gene therapy. Eleven-month-old animals injected with FGF21 -encoding vectors at 8 weeks of age showed a marked increase in circulating FGF21 (FIG 31 A), which was parallel to high levels of expression of vector-derived FGF21 in the 3 injected muscles (FIG 3 IB). In agreement with previous reports, this combination of vector serotype, promoter and route of administration did not lead to expression of the transgene in the liver (FIG 3 IB).
At the end of the ~ 10-month follow-up period, mice injected intramuscularly with AAVl-CMV-moFGF21 maintained the body weight they had at the initiation of the study and were ~38% slimmer than controls, which steady increased their weight as animals aged (FIG 31C). While the weight of the muscles was barely affected by FGF21 gene transfer, the weight of the white and brown depots as well as the liver were considerably reduced (FIG 3 ID). Indeed, the weight of the WAT pads analysed was reduced by >50% (FIG 3 ID). Moreover, mice treated with AAVl-CMV-moFGF21 showed a marked reduction in the hepatic total triglyceride content (FIG 3 IE). No changes in hepatic cholesterol levels were observed (FIG 3 IF). As opposed to null- injected animals, animals treated with AAVl-CMV-moFGF21 showed normoglycemia {data not shown) and reduced insulinemia when they were approximately 1 -year-old (FIG 31G). Accordingly, FGF21 -treated mice showed markedly improved insulin sensitivity at the end of the study (FIG 31H). Altogether, this study demonstrates that administration of AAV vectors that leads to therapeutically-relevant levels of circulating FGF21 is safe in the long-term in healthy, and may be used to reverse the increase in body weight and insulin resistance associated to aging.
Example 21. Reversion of obesity and diabetes by intramuscular administration of AAVl-CMV-moFGF21 vectors in HFD-fed C57B16 mice.
We next evaluated whether im administration of AAVl-CMV-moFGF21 vectors was also able to reverse obesity and insulin resistance. To this end, two-month-old C57B16 mice were fed either a chow or a HFD for 12 weeks. During these first 3 months of follow-up, while the weight of chow-fed animals increased by 20%, animals fed a HFD became obese (95% body weight gain) (FIG 32A and B). Vectors were then injected at a dose of 5xl010 vg/muscle to the quadriceps, gastrocnemius and tibialis cranialis of both legs (total dose, 3xl0u vg/mouse) of obese C57B16 mice. As controls, another cohort of obese mice and the cohort of chow-fed mice received 3x1011 vg of non-coding null vectors (AAVl-CMV-null). Following AAV delivery, mice were maintained on chow or HFD feeding. Animals treated with AAVl-CMV-moFGF21 experienced progressive loss of body weight (FIG 32A and B). The reversion of obesity by AAV 1 -CM V-FGF21 treatment was parallel to an increase in the circulating levels of FGF21 (FIG 32C). Null-treated mice fed a HFD showed normal fed glycemia (FIG 32D), but were hyperinsulinemic (FIG 32E), suggesting that these mice had developed insulin resistance. In contrast, HFD-fed mice treated with AAVl-CMV-moFGF21 were, by the end of the study, normoglycemic and normoinsulinemic (FIG 32D and E). Moreover, animals administered with AAVl-CMV-moFGF21 showed greater insulin sensitivity than their HFD-fed controls (FIG 32F).
Example 22. Increased FGF21 circulating levels by codon-optimized human FGF21 nucleotide sequences. To evaluate if codon-optimization was able to mediate increased FGF21 circulating levels, 8-week-old male C57B16 mice were hydrodynamically injected with plasmids encoding three different codon-optimized human FGF21 nucleotide sequences (SEQ ID NO's:40-42) under the control of the hAAT promoter. As control, non-treated mice and mice hydrodynamically injected with a plasmid encoding wild-type hFGF21 coding sequence under the control of the hAAT promoter were used.
Material and methods
In vivo delivery of plasmids into mice by hydrodynamic tail vein injection Plasmid DNA was diluted in saline in a volume (ml) equal to -10% of the animals' average body weight (grams) and was manually injected into the lateral tail vein in less tan 5 seconds. Before the injection, the animals were put under a 250W infrared heat lamp (Philips) for a few minutes to dilate the blood vessels and facilitate viewing and easier access to the tail vein. A plastic restrainer (Harvard Apparatus) was used to secure the animal for injection. No anaesthesia was used as it is not necessary so long as an appropriate restraining device is employed. We used 26G 3/8 in. gauge hypodermic needles (BD), the largest feasible needle gauge that fit snugly into the access vein, to inject the animals. Results
Mice treated with either codon-optimized human FGF21 version 2 or 3 were able to secrete higher human FGF21 levels into the circulation in comparison with wild-type or codon-optimized FGF21 variant 1 (FIG 33, thus demonstrating increased FGF21 protein production by codon-optimization of variants 2 and 3.
Example 23. In vitro and in vivo increased FGF21 expression and protein production levels by h AAT-moFGF21 , C AG-moFGF21 -doublemiRT and CMV- moFGF21 expression cassettes
Material and Methods
In vivo delivery of plasmids into mice by hydrodynamic tail vein injection Plasmid DNA was diluted in saline in a volume (ml) equal to -10% of the animals' average body weight (grams) and was manually injected into the lateral tail vein in less tan 5 seconds. Before the injection, the animals were put under a 25 OW infrared heat lamp (Philips) for a few minutes to dilate the blood vessels and facilitate viewing and easier access to the tail vein. A plastic restrainer (Harvard Apparatus) was used to secure the animal for injection. No anaesthesia was used as it is not necessary so long as an appropriate restraining device is employed. We used 26G 3/8 in. gauge hypodermic needles (BD), the largest feasible needle gauge that fit snugly into the access vein, to inject the animals. Results
In vitro
HEK293 cells were transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183) (SEQ ID NO:57) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV- moFGF21) or the CAG promoter in conjunction with four tandem repeats of the miPvT122a sequence and four tandems repeats of the miRTl sequence (CAG-moFGF21- doublemiRT). As control, non-transfected cells were used. HEK293 cells transduced with CAG-moFGF21 -doublemiRT expressed higher levels of FGF21 in comparison with cells transduced with EFla-mFGF21 or non-transduced cells (FIG 34A). Moreover, HEK293 cells transduced with CAG-moFGF21 -doublemiRT also showed higher intracellular FGF21 protein content and higher FGF21 protein levels in the culture medium (Figure 34B and C). Although HEK293 cells transduced with EFla-mFGF21 or CMV-moFGF21 expressed similar levels of FGF21 (Figure 34A), HEK293 cells transduced with CMV-moFGF21 showed higher intracellular FGF21 protein content and higher FGF21 protein levels in the culture medium (Figure 34B and C).
C2C12 cells were transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21). As control, non- transfected cells were used. C2C12 cells transduced with CMV-moFGF21 expressed higher levels of FGF21 in comparison with cells transduced with EFla-mFGF21 or non- transduced cells (FIG 34D).
HepG2 cells were transfected with plasmids encoding the WT murine FGF21 coding sequence under the control of the EFla promoter (EFla-mFGF21) (Zhang et al, EBioMedicine 15 (2017) 173-183) or a codon-optimized murine FGF21 coding sequence under the control of the hAAT promoter (hAAT-moFGF21). As control, non- transfected cells were used. HepG2 cells transduced with hAAT-moFGF21 expressed higher levels of FGF21 in comparison with cells transduced with EFla-mFGF21 or non- transduced cells (FIG 34E).
In vivo
8-week-old male C57B16 mice were hydrodynamically administered with 5 μg of plasmids encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (EFla-mFGF21) (Zhang et al., EBioMedicine 15 (2017) 173-183) or a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (CMV-moFGF21) or the hAAT promoter (hAAT-moFGF21). Analysis of FGF21 expression levels in the liver 24h post-administration of plasmids revealed that animals treated with hAAT-moFGF21 or CMV-moFGF21 expressed much higher levels of FGF21 than animals receiving EFla-mFGF21 (FIG 35A). In addition, animals treated with hAAT-moFGF21 or CMV-moFGF21 showed higher FGF21 circulating levels than animals receiving EFla-mFGF21 (FIG 35B).
Example 24. In vivo increased FGF21 expression in target tissues and FGF21 circulating levels by AAV8-h AAT-moFGF21 , AAV8-CAG-moFGF21-doublemiRT and AAVl-CMC-moFGF21 in comparison with AAV8-Efla-mFGF21 Hepatic expression
Male C57B16 mice were intravenously administered with lxlO10 vg, 2xl010 vg or 5xl010 vg of AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or a codon- optimized murine FGF21 coding sequence under the control of the liver-specific hAAT promoter (AAV8-hAAT-moFGF21). Two weeks post- AAV administration, animals treated with AAV8-hAAT-moFGF21 showed both higher expression levels of FGF21 in the liver and higher FGF21 circulating levels than animals treated with AAV8-EFla- mFGF21, irrespective of the dose of vector (FIG 36A and B). Adipose expression
Male C57B16 mice were administered intra-eWAT with 2x1010 vg, 5xl010 vg or lxlO11 vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV8 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the C AG promoter in conjunction with four tandem repeats of the miRT 122a sequence and four tandems repeats of the miRTl sequence (AAV8-CAG-moFGF21-doublemiRT). Two weeks post- AAV administration, animals treated with AAV8-CAG-moFGF21- doublemiRT showed higher expression levels of FGF21 in WAT than animals administered with AAV8-EFla-mFGF21 (FIG 37A). Moreover, animals treated with AAV8-CAG-moFGF21-doublemiRT showed much lower expression of FGF21 in the liver than animals administered with AAV8-EFla-mFGF21 (FIG 37B), demonstrating that intra-eWAT administration of AAV8-CAG-moFGF21-doublemiRT vectors efficiently precluded transgene expression in off-target tissues. Skeletal muscle expression
Male C57B16 mice were administered intramuscularly with 5xl010 vg, lxlO11 vg or 3xl0u vg of either AAV8 vectors encoding the WT murine FGF21 coding sequence under the control of the elongation factor la (EFla) promoter (AAV8-EFla-mFGF21) or AAV1 vectors encoding a codon-optimized murine FGF21 coding sequence under the control of the CMV promoter (AAV 1 -CM V-FGF21 ). Two weeks post-AAV administration, animals treated with AAV1-CMV-FGF21 showed much higher expression levels of FGF21 in skeletal muscle than animals administered with AAV8- EFla-mFGF21 (FIG 38A). Moreover, animals treated with AAV8-EFla-mFGF21 showed high expression of FGF21 in the liver whereas intramuscular administration of AAV1-CMV-FGF21 vectors efficiently precluded hepatic transgene expression (FIG 38B).
SEQUENCES
SEQ ID NO: Type of sequence
1 Amino acid sequence of homo sapiens FGF21
2 Amino acid sequence of mus musculus FGF21
3 Amino acid sequence of canis lupus familiaris FGF21
4 Nucleotide sequence of homo sapiens FGF21
5 Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 1
6 Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 2
7 Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 3
8 Nucleotide sequence of mus musculus FGF21
9 Codon optimized nucleotide sequence of mus musculus FGF21
10 Nucleotide sequence of canis lupus familiaris FGF21
11 Codon optimized nucleotide sequence of canis lupus familiaris
FGF21
12 Nucleotide sequence encoding miRT122a
13 Nucleotide sequence encoding miRTl
14 Nucleotide sequence encoding miRT152
15 Nucleotide sequence encoding miRT199a-5p
16 Nucleotide sequence encoding miRT199a-3p
17 Nucleotide sequence encoding miRT215
18 Nucleotide sequence encoding miRT192
19 Nucleotide sequence encoding miRT148a
20 Nucleotide sequence encoding miRT194
21 Nucleotide sequence encoding miRT124
22 Nucleotide sequence encoding miRT216
23 Nucleotide sequence encoding miRT125
24 Nucleotide sequence encoding miRT133a
25 Nucleotide sequence encoding miRT206
26 Nucleotide sequence encoding miRT130 Nucleotide sequence encoding miRT99
Nucleotide sequence encoding miRT208-5p Nucleotide sequence encoding miRT208a-3p Nucleotide sequence encoding miRT499-5p
Construct A
Construct B
Construct C
Construct D
Construct E
Construct F
Construct G
Construct H
Construct I
Construct J
Construct K
Construct L
Nucleotide sequence of chimeric intron composed of introns from human β-globin and immunoglobulin heavy chain genes
Nucleotide sequence of CAG promoter Nucleotide sequence of CMV promoter Nucleotide sequence of CMV enhancer Nucleotide sequence of hAAT promoter Truncated AAV2 5'ITR
Truncated AAV2 3'ITR
SV40 polyadenylation signal Rabbit β-Globin polyadenylation signal CMV promoter and CMV enhancer sequence Hepatocyte control region (HCR) enhancer from apolipoprotein E mini/aP2 promoter
mini/UCPl promoter
C5-12 promoter
pAAV-EFla-mmFGF21-pA Amino acid sequence of homo sapiens FGF21 (SEQ ID NO: 1)
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDD AQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPD GALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRG PARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Nuleotide sequence oi homo sapiens FGF21 (SEQ ID NO: 4)
ATGGACTCGGACGAGACCGGGTTCGAGCACTCAGGACTGTGGGTTTCTGTG CTGGCTGGTCTTCTGCTGGGAGCCTGCCAGGCACACCCCATCCCTGACTCCA GTCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGGTACCTCTACACAG ATGATGCCCAGCAGACAGAAGCCCACCTGGAGATCAGGGAGGATGGGACG GTGGGGGGCGCTGCTGACCAGAGCCCCGAAAGTCTCCTGCAGCTGAAAGCC TTGAAGCCGGGAGTTATTCAAATCTTGGGAGTCAAGACATCCAGGTTCCTG TGCCAGCGGCCAGATGGGGCCCTGTATGGATCGCTCCACTTTGACCCTGAG GCCTGCAGCTTCCGGGAGCTGCTTCTTGAGGACGGATACAATGTTTACCAG TCCGAAGCCCACGGCCTCCCGCTGCACCTGCCAGGGAACAAGTCCCCACAC CGGGACCCTGCACCCCGAGGACCAGCTCGCTTCCTGCCACTACCAGGCCTG CCCCCCGCACTCCCGGAGCCACCCGGAATCCTGGCCCCCCAGCCCCCCGAT GTGGGCTCCTCGGACCCTCTGAGCATGGTGGGACCTTCCCAGGGCCGAAGC CCCAGCTACGCTTCCTGA
Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 1 (SEQ ID NO: 5)
ATGGATTCTGATGAGACAGGCTTCGAGCACAGCGGCCTGTGGGTTTCAGTT CTGGCTGGACTGCTGCTGGGAGCCTGTCAGGCACACCCTATTCCAGATAGC AGCCCTCTGCTGCAGTTCGGCGGACAAGTGCGGCAGAGATACCTGTACACC GACGACGCCCAGCAGACAGAAGCCCACCTGGAAATCAGAGAGGATGGCAC AGTTGGCGGAGCCGCCGATCAGTCTCCTGAATCTCTGCTCCAGCTGAAGGC CCTGAAGCCTGGCGTGATCCAGATCCTGGGCGTGAAAACCAGCCGGTTCCT GTGCCAAAGACCTGACGGCGCCCTGTATGGCAGCCTGCACTTTGATCCTGA GGCCTGCAGCTTCAGAGAGCTGCTGCTTGAGGACGGCTACAACGTGTACCA GTCTGAGGCCCATGGCCTGCCTCTGCATCTGCCTGGAAACAAGAGCCCTCA CAGAGATCCCGCTCCTAGAGGCCCTGCCAGATTTCTGCCTCTTCCTGGATTG CCTCCTGCTCTGCCAGAGCCTCCTGGAATTCTGGCTCCTCAGCCTCCTGATG TGGGCAGCTCTGATCCTCTGAGCATGGTCGGACCTAGCCAGGGCAGATCTC CTAGCTACGCCTCTTGA
Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 2 (SEQ ID NO: 6)
ATGGACAGCGATGAAACCGGGTTCGAGCACAGCGGTCTGTGGGTGTCCGTG CTGGCCGGACTGCTCCTGGGAGCCTGTCAGGCGCACCCCATCCCTGACTCC TCGCCGCTGCTGCAATTCGGCGGACAAGTCCGCCAGAGATACCTGTACACC GACGACGCCCAGCAGACCGAAGCCCACCTGGAAATTCGGGAGGACGGGAC TGTGGGAGGCGCTGCAGATCAGTCACCCGAGTCCCTCCTCCAACTGAAGGC CTTGAAGCCCGGCGTGATTCAGATCCTGGGCGTGAAAACTTCCCGCTTCCTT TGCCAACGGCCGGATGGAGCTCTGTACGGATCCCTGCACTTCGACCCCGAA GCCTGCTCATTCCGCGAGCTGCTCCTTGAGGACGGCTATAACGTGTACCAG TCTGAGGCCCATGGACTCCCCCTGCATCTGCCCGGCAACAAGTCCCCTCAC CGGGATCCTGCCCCAAGAGGCCCAGCTCGGTTTCTGCCTCTGCCGGGACTG CCTCCAGCGTTGCCCGAACCCCCTGGTATCCTGGCCCCGCAACCACCTGAC GTCGGTTCGTCGGACCCGCTGAGCATGGTCGGTCCGAGCCAGGGAAGGTCC CCGTCCTACGCATCCTGA
Codon optimized nucleotide sequence of homo sapiens FGF21 - variant 3 (SEQ ID NO: 7)
ATGGATTCCGACGAAACTGGATTTGAACATTCAGGGCTGTGGGTCTCTGTG CTGGCTGGACTGCTGCTGGGGGCTTGTCAGGCTCACCCCATCCCTGACAGC TCCCCTCTGCTGCAGTTCGGAGGACAGGTGCGGCAGAGATACCTGTATACC GACGATGCCCAGCAGACAGAGGCACACCTGGAGATCAGGGAGGACGGAAC CGTGGGAGGAGCAGCCGATCAGTCTCCCGAGAGCCTGCTGCAGCTGAAGG CCCTGAAGCCTGGCGTGATCCAGATCCTGGGCGTGAAGACATCTCGGTTTC TGTGCCAGCGGCCCGACGGCGCCCTGTACGGCTCCCTGCACTTCGATCCCG AGGCCTGTTCTTTTAGGGAGCTGCTGCTGGAGGACGGCTACAACGTGTATC AGAGCGAGGCACACGGCCTGCCACTGCACCTGCCTGGCAATAAGTCCCCTC ACCGCGATCCAGCACCCAGGGGCCCAGCACGCTTCCTGCCTCTGCCAGGCC TGCCCCCTGCCCTGCCAGAGCCACCCGGCATCCTGGCCCCCCAGCCTCCAG ATGTGGGCTCCAGCGATCCTCTGTCAATGGTGGGGCCAAGTCAGGGGCGGA GTCCTTCATACGCATCATAA
Nucleotide sequence encoding miRT122a (target sequence of microRNA 122a) (SEQ ID NO: 12)
5' CAAACACCATTGTCACACTCCA 3'
Nucleotide sequence encoding miRTl (target sequence of microRNA 1) (SEQ ID NO: 13)
5' TTACATACTTCTTTACATTCCA 3'
Nucleotide sequence encoding miRT152 (target sequence of microRNA 152) (SEQ ID NO: 14)
5' CCAAGTTCTGTCATGCACTGA 3'
Nucleotide sequence encoding miRTl 99a-5p (target sequence of microRNA 199a) (SEQ ID NO: 15)
5' GAACAGGTAGTCTGAACACTGGG 3' Nucleotide sequence encoding miRTl 99a-3p (target sequence of microRNA 199a) (SEQ ID NO: 16)
5' TAACCAATGTGCAGACTACTGT 3' Nucleotide sequence encoding miRT215 (target sequence of microRNA 215) (SEQ ID NO: 17)
5' GTCTGTCAATTCATAGGTCAT 3' Nucleotide sequence encoding miRT192 (target sequence of microRNA 192) (SEQ ID NO: 18)
5' GGCTGTCAATTCATAGGTCAG 3'
Nucleotide sequence encoding miRT148a (target sequence of microRNA 148a) (SEQ ID NO: 19)
5' ACAAAGTTCTGTAGTGCACTGA 3'
Nucleotide sequence encoding miRT194 (target sequence of microRNA 194) (SEQ ID NO: 20)
5 ' TCC AC ATGGAGTTGCTGTTAC A 3 '
Nucleotide sequence encoding miRT124 (target sequence of microRNA 124) (SEQ ID NO: 21)
5' GGCATTCACCGCGTGCCTTA 3'
Nucleotide sequence encoding miRT216 (target sequence of microRNA 216) (SEQ ID NO: 22)
5' TCACAGTTGCCAGCTGAGATTA 3' Nucleotide sequence encoding miRT125 (target sequence of microRNA 125) (SEQ ID NO: 23)
5' TCACAGGTTAAAGGGTCTCAGGGA 3'
Nucleotide sequence encoding miRT133a (target sequence of microRNA 133a) (SEQ ID NO: 24)
5' C AGCTGGTTGAAGGGGACC AAA 3 '
Nucleotide sequence encoding miRT206 (target sequence of microRNA 206) (SEQ ID NO: 25)
5 ' CCACACACTTCCTTACATTCCA 3 '
Nucleotide sequence encoding miRT130 (target sequence of microRNA 130) (SEQ ID NO: 26) 5' ATGCCCTTTTAACATTGCACTG 3'
Nucleotide sequence encoding miRT99 (target sequence of microRNA 99) (SEQ ID NO: 27)
5 ' CACAAGATCGGATCTACGGGTT 3 '
Nucleotide sequence encoding miRT208-5p (target sequence of microRNA 208a) (SEQ ID NO: 28)
5' GTATAACCCGGGCCAAAAGCTC 3'
Nucleotide sequence encoding miRT208a-3p (target sequence of microRNA 208a) (SEQ ID NO: 29)
5' ACAAGCTTTTTGCTCGTCTTAT 3'
Nucleotide sequence encoding miRT499-5p (target sequence of heart-specific microRNA 499) (SEQ ID NO: 30)
5'AAACATCACTGCAAGTCTTAA 3'
Nucleotide sequence of CAG promoter (SEQ ID NO: 44)
GACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGT TCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCC GCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTA TGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGA GTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCC AAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTA TGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTA TTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCTTCACTC TCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAA TTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGG CGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCG GCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCCTTTTATGGCGAGG CGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGCGGGCGGGAGT CGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCCGCCCG CCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGC CCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGTTTCTTT TCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGG GGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCGCCG CGTGCGGCTCCGCGCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGG GGCTTTGTGCGCTCCGCAGTGTGCGCGAGGGGAGCGCGGCCGGGGGCGGT GCCCCGCGGTGCGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTG TGTGCGTGGGGGGGTGAGCAGGGGGTGTGGGCGCGTCGGTCGGGCTGCAA CCCCCCCTGCACCCCCCTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGT GCGGGGCTCCGTACGGGGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGGG GTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGCCGCCTCGGGCCGGGG AGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGCGGCTGTCGA GGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAGGGCG CAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGC CGCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAG GAAGGAAATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCT TCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGG GGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAG AGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAG
Nucleotide sequence of CMV promoter (SEQ ID NO: 45)
GTGATGCGGTTTTGGCAGTACACCAATGGGCGTGGATAGCGGTTTGACTCA CGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGC ACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTGCGATCGCCCGC CCCGTTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAG CAGAGCT
Nucleotide sequence of CMV enhancer (SEQ ID NO: 46)
GGCATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGT TCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCC GCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTA TGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGA GTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCC AAGTCCGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTA TGCCCAGTACATGACCTTACGGGACTTTCCTACTTGGCAGTACATCTACGTA TTAGTCATCGCTATTACCATG
Nucleotide sequence of hAAT promoter (SEQ ID NO: 47)
GATCTTGCTACCAGTGGAACAGCCACTAAGGATTCTGCAGTGAGAGCAGAG GGCCAGCTAAGTGGTACTCTCCCAGAGACTGTCTGACTCACGCCACCCCCT CCACCTTGGACACAGGACGCTGTGGTTTCTGAGCCAGGTACAATGACTCCT TTCGGTAAGTGCAGTGGAAGCTGTACACTGCCCAGGCAAAGCGTCCGGGCA GCGTAGGCGGGCGACTCAGATCCCAGCCAGTGGACTTAGCCCCTGTTTGCT CCTCCGATAACTGGGGTGACCTTGGTTAATATTCACCAGCAGCCTCCCCCGT TGCCCCTCTGGATCCACTGCTTAAATACGGACGAGGACAGGGCCCTGTCTC CTCAGCTTCAGGCACCACCACTGACCTGGGACAGTGAAT
Truncated AAV2 5'ITR (SEQ ID NO: 48)
GCGCGCTC GCTCGCTCAC TGAGGCCGCC CGGGCAAAGC CCGGGCGTCG GGCGACCTTT GGTCGCCCGG CCTCAGTGAG CGAGCGAGCG
CGCAGAGAGG GAGTGGCCAA CTCCATCACT AGGGGTTCCT
Truncated AAV2 3'ITR (SEQ ID NO: 49)
AGGAACCCCT AGTGATGGAG TTGGCCACTC CCTCTCTGCG CGCTCGCTCG CTCACTGAGG CCGGGCGACC AAAGGTCGCC
CGACGCCCGG GCTTTGCCCG GGCGGCCTCA GTGAGCGAGC GAGCGCGC
SV40 polyadenylation signal (SEQ ID NO: 50)
TAAGATACATTGATGAGTTTGGACAAACCACAACTAGAATGCAGTGAAAA AAATGCTTTATTTGTGAAATTTGTGATGCTATTGCTTTATTTGTAACCATTAT AAGCTGCAATAAACAAGTT
Rabbit β-Globin polyadenylation signal (SEQ ID NO: 51)
GATCTTTTTCCCTCTGCCAAAAATTATGGGGACATCATGAAGCCCCTTGAGC ATCTGACTTCTGGCTAATAAAGGAAATTTATTTTCATTGCAATAGTGTGTTG GAATTTTTTGTGTCTCTCACTCGGAAGGACATATGGGAGGGCAAATCATTT AAAACATCAGAATGAGTATTTGGTTTAGAGTTTGGCAACATATGCCCATAT GCTGGCTGCCATGAACAAAGGTTGGCTATAAAGAGGTCATCAGTATATGAA ACAGCCCCCTGCTGTCCATTCCTTATTCCATAGAAAAGCCTTGACTTGAGGT TAGATTTTTTTTATATTTTGTTTTGTGTTATTTTTTTCTTTAACATCCCTAAAA TTTTCCTTACATGTTTTACTAGCCAGATTTTTCCTCCTCTCCTGACTACTCCC AGTCATAGCTGTCCCTCTTCTCTTATGGAGATC CMV promoter and CMV enhancer sequence (SEQ ID NO: 52)
GGCATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGT TCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCC GCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTA TGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGA GTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCC AAGTCCGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTA TGCCCAGTACATGACCTTACGGGACTTTCCTACTTGGCAGTACATCTACGTA TTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACACCAATGGGC GTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACG TCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTC GTAACAACTGCGATCGCCCGCCCCGTTGACGCAAATGGGCGGTAGGCGTGT ACGGTGGGAGGTCTATATAAGCAGAGCT
Hepatocyte control region (HCR) enhancer from apolipoprotein E (SEQ ID NO: 53)
CAGAGAGGTCTCTGACCTCTGCCCCAGCTCCAAGGTCAGCAGGCAGGGAGG
GCTGTGTGTTTGCTGTTTGCTGCTTGCAATGTTTGCCCATTTTAGGGACATG
AGTAGGCTGAAGTTTGTTCAGTGTGGACTTCAGAGGCAGCACACAAACAGC miniaP2 promoter (SEQ ID NO: 54)
GATTA
ACCCGCCATG CTACTTATCT ACTCGACATT GATTATTGAC TAGGGGAATT CCAGCAGGAA TCAGGTAGCT GGAGAATCGC ACAGAGCCAT GCGATTCTTG GCAAGCCATG CGACAAAGGC AGAAATGCAC ATTTCACCCA
GAGAGAAGGG
ATTGATGTCA GCAGGAAGTC ACCACCCAGA GAGCAAATGG AGTTCCCAGA TGCCTGACAT TTGCCTTCTT ACTGGATCAG AGTTCACTAG TGGAAGTGTC ACAGCCCAAA CACTCCCCCA AAGCTCAGCC CTTCCTTGCC TTGTAACAAT CAAGCCGCTC CTGGATGAAC TGCTCCGCCC TCTGTCTCTT TGGCAGGGTT GGAGCCCACT GTGGCCTGAG CGACTTCTAT GGCTCCCTTT TCTGTGATTT TCATGGTTTC TGAGCTCTTT TCCCCCGCTT TATGATTTTC TCTTTTTGTC TCTCTCTTGC TAAACCTCCT TCGTATATAT GCCCTCTCAG GTTTCATTTC TGAATCATCT ACTGTGAACT ATTCCCATTG TTTGCCAGAA GCCCCCTGGT TCTTCCTTCT AGACACCAGG CAAGGGGCAG GAGGTAAGAG GCAGGAGTCC
ATAAAACAGC CCTGAGAGCC TGCTGGGTCA GTGCCTGCTG TCAGAA miniUCPl promoter (SEQ ID NO: 55)
GACGTCACAG TGGGTCAGTC ACCCTTGATC ACACTGCACC AGTCTTCACC TTTCCACGCT TCCTGCCAGA GCATGAATCA GGCTCTCTGG GGATACCGGC CTCACCCCTA CTGAGGCAAA CTTTCTCCCA CTTCTCAGAG GCTCTGAGGG CAGCAAGGTC AGCCCTTTCT TTGGAATCTA GAACCACTCC CTGTCTTGAG CTGACATCAC AGGGCAGGCA GATGCAGCAG GGAAGGGCCT GGGACTGGGA
CGTTCATCCT ACAAGAAAGC TGTGGAACTT TTCAGCAACA TCTCAGAAAT CAGATCGCAC TTATTCAAAG GAGCCAGGCC CTGCTCTGCG CCCTGGTGGA GGCTCCTCAT GTGAAGAGTG ACAAAAGGCA CCATGTTGTG GATACGGGGC
GAAGCCCCTC CGGTGTGTCC TCCAGGCATC ATCAGGAACT AGTGCCAAAG
CAGAGGTGCT GGCCAGGGCT TTGGGAGTGA CGCGCGTCTG GGAGGCTTGT
GCGCCCAGGG CACGCCCCTG CCGATTCCCA CTAGCAGGTC TTGGGGGACC
TGGGCCGGCT CTGCCCCTCC TCCAGCAATC GGGCTATAAA GCTCTTCCAA GTCAGGGCGC AGAAGTGCCG GGCGATCCGG GCTTAAAGAG CGAGAGGAAG
GGACGCTCAC CTTTGAGCTC CTCCACAAAT AGCCCTGGTG GCTGCCACAG AAGTTC G AAG TTGAGAGTTC GG
C5-12 promoter (SEQ ID NO: 56)
CGGCCGTCCG CCTTCGGCAC CATCCTCACG ACACCCAAAT ATGGCGACGG GTGAGGAATG
GTGGGGAGTT ATTTTTAGAG CGGTGAGGAA GGTGGGCAGG CAGCAGGTGT TGGCGCTCTA
AAAATAACTC CCGGGAGTTA TTTTTAGAGC GGAGGAATGG TGGACACCCA AATATGGCGA CGGTTCCTCA CCCGTCGCCA TATTTGGGTG TCCGCCCTCG GCCGGGGCCG CATTCCTGGG
GGCCGGGCGG TGCTCCCGCC CGCCTCGATA AAAGGCTCCG GGGCCGGCGG CGGCCCACGA GCTACCCGGA GGAGCGGGAG GCGCCA pAAV-EFla-mmFGF21-pA (SEQ ID NO: 57)
CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGC CCGGGCGTCGGGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGC GCAGAGAGGGAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCGCGGCT CCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGT TGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAGAGAAGGTGGCGCGGG GTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCGCCTTTTTCCCGAGGGT GGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGC AACGGGTTTGCCGCCAGAACACAGGTAAGTGCCGTGTGTGGTTCCCGCGGG CCTGGCCTCTTTACGGGTTATGGCCCTTGCGTGCCTTGAATTACTTCCACTG GCTGCAGTACGTGATTCTTGATCCCGAGCTTCGGGTTGGAAGTGGGTGGGA GAGTTCGAGGCCTTGCGCTTAAGGAGCCCCTTCGCCTCGTGCTTGAGTTGA GGCCTGGCCTGGGCGCTGGGGCCGCCGCGTGCGAATCTGGTGGCACCTTCG CGCCTGTCTCGCTGCTTTCGATAAGTCTCTAGCCATTTAAAATTTTTGATGA CCTGCTGCGACGCTTTTTTTCTGGCAAGATAGTCTTGTAAATGCGGGCCAAG ATCTGCACACTGGTATTTCGGTTTTTGGGGCCGCGGGCGGCGACGGGGCCC GTGCGTCCCAGCGCACATGTTCGGCGAGGCGGGGCCTGCGAGCGCGGCCAC CGAGAATCGGACGGGGGTAGTCTCAAGCTGGCCGGCCTGCTCTGGTGCCTG GCCTCGCGCCGCCGTGTATCGCCCCGCCCTGGGCGGCAAGGCTGGCCCGGT CGGCACCAGTTGCGTGAGCGGAAAGATGGCCGCTTCCCGGCCCTGCTGCAG GGAGCTCAAAATGGAGGACGCGGCGCTCGGGAGAGCGGGCGGGTGAGTCA CCCACACAAAGGAAAAGGGCCTTTCCGTCCTCAGCCGTCGCTTCATGTGAC TCCACGGAGTACCGGGCGCCGTCCAGGCACCTCGATTAGTTCTCGAGCTTTT GGAGTACGTCGTCTTTAGGTTGGGGGGAGGGGTTTTATGCGATGGAGTTTC CCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGT AATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAG CCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGAGGAA TTTCGACTGCTAGCACGCGTGATATCAATGGAATGGATGAGATCTAGAGTT GGGACCCTGGGACTGTGGGTCCGACTGCTGCTGGCTGTCTTCCTGCTGGGG GTCTACCAAGCATACCCCATCCCTGACTCCAGCCCCCTCCTCCAGTTTGGGG GTCAAGTCCGGCAGAGGTACCTCTACACAGATGACGACCAAGACACTGAA GCCCACCTGGAGATCAGGGAGGATGGAACAGTGGTAGGCGCAGCACACCG CAGTCCAGAAAGTCTCCTGGAGCTCAAAGCCTTGAAGCCAGGGGTCATTCA AATCCTGGGTGTCAAAGCCTCTAGGTTTCTTTGCCAACAGCCAGATGGAGC TCTCTATGGATCGCCTCACTTTGATCCTGAGGCCTGCAGCTTCAGAGAACTG CTGCTGGAGGACGGTTACAATGTGTACCAGTCTGAAGCCCATGGCCTGCCC CTGCGTCTGCCTCAGAAGGACTCCCCAAACCAGGATGCAACATCCTGGGGA CCTGTGCGCTTCCTGCCCATGCCAGGCCTGCTCCACGAGCCCCAAGACCAA GCAGGATTCCTGCCCCCAGAGCCCCCAGATGTGGGCTCCTCTGACCCCCTG AGCATGGTAGAGCCTTTACAGGGCCGAAGCCCCAGCTATGCGTCCTGAGAT ATCAAAGAATTCTAAGCTTGTCGACGAATGCAATTGTTGTTAATTAATTGTT AACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACA AATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCA AACTCATCAATGTATCTTAGTCGAGTTAATTAACGGCGGCCGCAGGAACCC CTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGG CCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAG TGAGCGAGCGAGCGCGCAGCTGCCTGCAGGGGCGCCTGATGCGGTATTTTC TCCTTACGCATCTGTGCGGTATTTCACACCGCATACGTCAAAGCAACCATA GTACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCG CAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTC TTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCG GGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAA AAACTTGATTTGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACG GTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTT CCAAACTGGAACAACACTCAACCCTATCTCGGGCTATTCTTTTGATTTATAA GGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAA AAATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTTTATGGTGCA CTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACC CGCCAACACCCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGGCATCCG CTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTT CACCGTCATCACCGAAACGCGCGAGACGAAAGGGCCTCGTGATACGCCTAT TTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCAC TTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACAT TCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAA TATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTC CCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTG AAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGA ACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACG TTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCC CGTATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAG AATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGC ATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACT GCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCT TTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCG GAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGT AGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCT AGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAG GACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATC TGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGA TGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAAC TATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAA GCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTA AAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATC TCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCC CGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATC TGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCG GATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCG CAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCA AGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGT GGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACG ATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCA CACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGC GTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGG TATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCC AGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGA CTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAA AACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTG CTCACATGT
Elongation factor 1 alpha promoter: from 150 to 1327 (1178bp)
Mus musculus FGF21: from 1359 to 1991 (633bp)
SEQ ID NO: 57 also contains the truncated AAV2 5' and 3' ITR and the SV40 polyA (already included in sequence listing, SEQ ID NO: 48, 49 and 50)

Claims

Claims
1. A viral expression construct suitable for expression in a mammal and comprising a nucleotide sequence encoding a Fibroblast growth factor 21 (FGF21) to be expressed in liver, adipose tissue and/or skeletal muscle.
2. A viral expression construct according to claim 1 comprising a nucleotide sequence encoding a FGF21 suitable for expression in a mammal and at least one of elements a), b), c), d) and e):
(a) a liver- specific promoter
(b) an adipose tissue-specific promoter
(c) a combination of an ubiquitous promoter and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and at least one nucleotide sequence encoding a target sequence of a microRNA expressed in the heart, wherein said combination enables specific expression in adipose tissue
(d) a skeletal muscle promoter and
(e) a combination of an ubiquitous promoter and an adeno-associated virus (AAV) vector sequence, wherein said combination enables specific expression in skeletal muscle.
3. A viral expression construct according to claim 1 or 2, wherein the nucleotide sequence encoding a FGF21 suitable for expression in a mammal is selected from the group consisting of:
(a) a nucleotide sequence encoding a polypeptide comprising an amino acid sequence that has at least 60% sequence identity with the amino acid sequence of SEQ ID NO: 1, 2 or 3
(b) a nucleotide sequence that has at least 60%> sequence identity with the nucleotide sequence of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11
(c) a nucleotide sequence the sequence of which differs from the sequence of a nucleotide sequence of (b) due to the degeneracy of the genetic code.
4. A viral expression construct according to claim 2 or 3, wherein the nucleotide sequence encoding a target sequence of a microRNA expressed in the liver and the nucleotide sequence encoding a target sequence of a microR A expressed in the heart is selected from a group consisting of sequences SEQ ID NO: 12 to 30 and/or combinations thereof.
5. A viral expression construct according to any one of claims 2 to 4, wherein the liver- specific promoter is the human a 1 -antitrypsin (hAAT) promoter and/or the adipose tissue-specific promoter is the mini/aP2 and/or the mini/UCPl promoter and/or the skeletal muscle promoter is the C5-12 promoter and/or the ubiquitous promoter is the cytomegalovirus (CMV) promoter and/or the CAG promoter.
6. A viral vector comprising a viral expression construct according to any one of claims 1 to 5, wherein said viral vector is an adenovirus vector, an adeno-associated virus vector, a retrovirus vector or a lentivirus vector, preferably an adeno-associated virus vector selected from the group consisting of an adeno-associated virus 1 (AAVl) vector, an adeno-associated virus 8 (AAV8) vector, and an adeno-associated virus 9 (AAV9) vector.
7. A nucleic acid molecule suitable for expression in a mammal and represented by a mammalian codon optimized nucleotide sequence encoding a FGF21 to be expressed in liver, adipose tissue and/or skeletal muscle.
8. A nucleic acid molecule according to claim 7, wherein the nucleotide sequence has at least 70% sequence identity with the nucleotide sequence of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10 or 11.
9. A composition comprising a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8, together with one or more pharmaceutically acceptable excipients or vehicles.
10. A viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9, for use as a medicament.
11. A viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9, for use in the treatment and/or prevention of a metabolic disorder.
12. A viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition according to claim 11, wherein the metabolic disorder is a diabetes and/or obesity.
13. A viral expression construct and/or a viral vector and/or a nucleic acid molecule and/or a composition according to claim 11, wherein the metabolic disorder is NASH.
14. A viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9, for use in the treatment and/or prevention of liver inflammation and/or fibrosis.
15. A viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9, for use in extending healthy lifespan.
16. A viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9, for use in the treatment and/or prevention of cancer, preferably liver cancer.
17. A method for preventing, delaying, reverting, curing and/or treating a metabolic disorder comprising the use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9.
18. A method according to claim 17, wherein the metabolic disorder is diabetes and/or obesity.
19. A method according to claim 17, wherein the metabolic disorder is NASH.
20. A method for preventing, delaying, reverting, curing and/or treating liver inflammation and/or fibrosis, comprising the use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9.
21. A method for extending healthy lifespan, comprising the use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9.
22. A method for preventing, delaying, reverting, curing and/or treating cancer, preferably liver cancer, comprising the use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9.
23. A use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9 for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating a metabolic disorder.
24. A use according to claim 23, wherein the metabolic disorder is obesity and/or diabetes.
25. A use according to claim 23, wherein the metabolic disorder is NASH.
26. A use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9 for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating liver inflammation and/or fibrosis.
27. A use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9 for the manufacture of a medicament for extending healthy lifespan.
28. A use of a viral expression construct as defined in any one of claims 1 to 5 and/or a viral vector as defined in claim 6 and/or a nucleic acid molecule as defined in claim 7 or 8 and/or a composition as defined in claim 9 for the manufacture of a medicament for preventing, delaying, reverting, curing and/or treating cancer, preferably liver cancer.
EP18731359.8A 2017-05-24 2018-05-24 Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence Pending EP3630160A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP17172818 2017-05-24
ES201700615 2017-05-24
PCT/EP2018/063707 WO2018215613A1 (en) 2017-05-24 2018-05-24 Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence

Publications (1)

Publication Number Publication Date
EP3630160A1 true EP3630160A1 (en) 2020-04-08

Family

ID=62620819

Family Applications (1)

Application Number Title Priority Date Filing Date
EP18731359.8A Pending EP3630160A1 (en) 2017-05-24 2018-05-24 Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence

Country Status (8)

Country Link
US (1) US20200102361A1 (en)
EP (1) EP3630160A1 (en)
JP (2) JP7778469B2 (en)
CN (1) CN110913886A (en)
AU (2) AU2018274655B2 (en)
BR (1) BR112019024608A2 (en)
MX (1) MX2019013982A (en)
WO (1) WO2018215613A1 (en)

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102765034B1 (en) 2017-05-24 2025-02-11 유니버시타트 아우토노마 데 바르셀로나 Viral expression construct containing the coding sequence of fibroblast growth factor 21 (FGF21)
CN110913886A (en) * 2017-05-24 2020-03-24 巴塞罗那自治大学 Viral expression construct comprising fibroblast growth factor 21(FGF21) coding sequence
GB201818816D0 (en) * 2018-11-19 2019-01-02 Synpromics Ltd Regulatory nucleic acid sequences
MX2021005824A (en) * 2018-11-26 2021-10-13 UNIV AUTòNOMA DE BARCELONA GENOTHERAPY WITH FIBROBLAST GROWTH FACTOR 21 (FGF21).
EP3914720B9 (en) * 2019-07-10 2023-09-27 Masonic Medical Research Laboratory Vgll4 with ucp-1 cis-regulatory element and method of use thereof
KR20220083708A (en) 2019-10-17 2022-06-20 스트라이드바이오 인코포레이티드 AAV delivery cassette
MX2022014754A (en) * 2020-05-26 2023-01-16 UNIV AUTòNOMA DE BARCELONA Fibroblast growth factor 21 (fgf21) gene therapy for central nervous system disorders.
CN113956344A (en) * 2021-10-14 2022-01-21 江南大学 Novel FGF analogue for treating liver cancer and application thereof
CN114010666B (en) * 2021-10-22 2024-05-07 上海交通大学 Application of oncolytic viruses, PARP inhibitors and PD-1 antibodies in the preparation of anti-tumor drugs
CN114316018A (en) * 2021-11-26 2022-04-12 江南大学 FGF21 protein analogue and application thereof
EP4509606A4 (en) * 2022-04-19 2025-12-10 Kanglin Biotech Hangzhou Co Ltd Nucleic acid construct for the treatment of hereditary ceremia factor deficiency and its use
CN118715025A (en) * 2022-10-08 2024-09-27 凌意(杭州)生物科技有限公司 Constructs for enhancing gene expression
WO2025158406A1 (en) * 2024-01-26 2025-07-31 Source Bio, Inc. Compositions for adipose tissue targeting and uses thereof
CN118389554A (en) * 2024-05-10 2024-07-26 三峡大学 AAV recombinant virus for improving continuous expression level and stability of FGF-21 and application thereof
WO2026028137A1 (en) * 2024-07-31 2026-02-05 Universitat Autònoma De Barcelona Fibroblast growth factor 21 (fgf21) gene therapy

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002024234A2 (en) * 2000-09-20 2002-03-28 The Regents Of The University Of California Use of recombinant gene delivery vectors for treating or preventing diseases of the eye
WO2013006486A2 (en) * 2011-07-01 2013-01-10 Ngm Biopharmaceuticals, Inc. Compositions, uses and methods for treatment of metabolic disorders and diseases
WO2013033452A2 (en) * 2011-08-31 2013-03-07 Amgen Inc. Method of treating or ameliorating type 1 diabetes using fgf21
WO2014085365A2 (en) * 2012-11-28 2014-06-05 Ngm Biopharmaceuticals, Inc. Compositions and methods for treatment of metabolic disorders and diseases
US20140194352A1 (en) * 2012-11-28 2014-07-10 Ngm Biopharmaceuticals, Inc. Compositions and Methods for Treatment of Metabolic Disorders and Diseases
WO2017201527A2 (en) * 2016-05-20 2017-11-23 President And Fellows Of Harvard College Gene therapy methods for age-related diseases and conditions

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5436146A (en) 1989-09-07 1995-07-25 The Trustees Of Princeton University Helper-free stocks of recombinant adeno-associated virus vectors
US6268213B1 (en) 1992-06-03 2001-07-31 Richard Jude Samulski Adeno-associated virus vector and cis-acting regulatory and promoter elements capable of expressing at least one gene and method of using same for gene therapy
US5869305A (en) 1992-12-04 1999-02-09 The University Of Pittsburgh Recombinant viral vector system
US5464758A (en) 1993-06-14 1995-11-07 Gossen; Manfred Tight control of gene expression in eucaryotic cells by tetracycline-responsive promoters
US6204059B1 (en) 1994-06-30 2001-03-20 University Of Pittsburgh AAV capsid vehicles for molecular transfer
US5741683A (en) 1995-06-07 1998-04-21 The Research Foundation Of State University Of New York In vitro packaging of adeno-associated virus DNA
US6093570A (en) 1995-06-07 2000-07-25 The University Of North Carolina At Chapel Hill Helper virus-free AAV production
US5952221A (en) 1996-03-06 1999-09-14 Avigen, Inc. Adeno-associated virus vectors comprising a first and second nucleic acid sequence
US6133027A (en) 1996-08-07 2000-10-17 City Of Hope Inducible expression system
AU728220B2 (en) 1997-04-14 2001-01-04 Cell Genesys, Inc. Methods for increasing the efficiency of recombinant AAV product
US6207455B1 (en) 1997-05-01 2001-03-27 Lung-Ji Chang Lentiviral vectors
EP0981636B1 (en) 1997-05-13 2005-03-23 University Of North Carolina At Chapel Hill Lentivirus-based gene transfer vectors
US5994136A (en) 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors
US6218181B1 (en) 1998-03-18 2001-04-17 The Salk Institute For Biological Studies Retroviral packaging cell line
EP1080218A1 (en) 1998-05-27 2001-03-07 University of Florida Method of preparing recombinant adeno-associated virus compositions by using an iodixanol gradient
ATE454445T1 (en) 1998-11-10 2010-01-15 Univ North Carolina VIRUS VECTORS AND METHODS FOR THEIR PRODUCTION AND ADMINISTRATION.
DE19909769A1 (en) 1999-03-05 2000-09-07 Bundesrepublik Deutschland Let SIVagm-derived lentiviral vectors, processes for their preparation and their use for gene transfer in mammalian cells
CA2410901C (en) 2000-06-01 2012-03-20 University Of North Carolina At Chapel Hill Methods and compounds for controlled release of recombinant parvovirus vectors
US20070015238A1 (en) 2002-06-05 2007-01-18 Snyder Richard O Production of pseudotyped recombinant AAV virions
EP2692868A1 (en) * 2012-08-02 2014-02-05 Universitat Autònoma De Barcelona Adeno-associated viral (AAV) vectors useful for transducing adipose tissue
CN105916990B (en) * 2013-08-02 2020-02-04 巴塞罗那自治大学 Adeno-associated virus vector for transduction of adipose tissue
CN110913886A (en) * 2017-05-24 2020-03-24 巴塞罗那自治大学 Viral expression construct comprising fibroblast growth factor 21(FGF21) coding sequence

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002024234A2 (en) * 2000-09-20 2002-03-28 The Regents Of The University Of California Use of recombinant gene delivery vectors for treating or preventing diseases of the eye
WO2013006486A2 (en) * 2011-07-01 2013-01-10 Ngm Biopharmaceuticals, Inc. Compositions, uses and methods for treatment of metabolic disorders and diseases
WO2013033452A2 (en) * 2011-08-31 2013-03-07 Amgen Inc. Method of treating or ameliorating type 1 diabetes using fgf21
WO2014085365A2 (en) * 2012-11-28 2014-06-05 Ngm Biopharmaceuticals, Inc. Compositions and methods for treatment of metabolic disorders and diseases
US20140194352A1 (en) * 2012-11-28 2014-07-10 Ngm Biopharmaceuticals, Inc. Compositions and Methods for Treatment of Metabolic Disorders and Diseases
WO2017201527A2 (en) * 2016-05-20 2017-11-23 President And Fellows Of Harvard College Gene therapy methods for age-related diseases and conditions

Non-Patent Citations (10)

* Cited by examiner, † Cited by third party
Title
ALEX MAS ET AL: "Reversal of Type 1 Diabetes by Engineering a Glucose Sensor in Skeletal Muscle", DIABETES, AMERICAN DIABETES ASSOCIATION, US, vol. 55, no. 6, 1 June 2006 (2006-06-01), pages 1546 - 1553, XP002659438, ISSN: 0012-1797, DOI: 10.2337/DB05-1615 *
COSKUN TAMER ET AL: "Fibroblast Growth Factor 21 Corrects Obesity in Mice", ENDOCRINOLOGY, THE ENDOCRINE SOCIETY, US, vol. 149, no. 12, 1 December 2008 (2008-12-01), pages 6018 - 6027, XP009122247, ISSN: 0013-7227, DOI: 10.1210/EN.2008-0816 *
F. M. FISHER ET AL: "FGF21 regulates PGC-1 and browning of white adipose tissues in adaptive thermogenesis", GENES & DEVELOPMENT, vol. 26, no. 3, 1 February 2012 (2012-02-01), pages 271 - 281, XP055160186, ISSN: 0890-9369, DOI: 10.1101/gad.177857.111 *
HUANG XINQIANG ET AL: "Forced expression of hepatocyte-specific fibroblast growth factor 21 delays initiation of chemically induced hepatocarcinogenesis", MOLECULAR CARCINOGENESIS, JOHN WILEY & SONS, INC, US, vol. 45, no. 12, 1 December 2006 (2006-12-01), pages 934 - 942, XP002496728, ISSN: 0899-1987, DOI: 10.1002/MC.20241 *
JUN ZHANG ET AL: "Chronic Over-expression of Fibroblast Growth Factor 21 Increases Bile Acid Biosynthesis by Opposing FGF15/19 Action", EBIOMEDICINE, vol. 15, 1 February 2017 (2017-02-01), NL, pages 173 - 183, XP055423138, ISSN: 2352-3964, DOI: 10.1016/j.ebiom.2016.12.016 *
KHARITONENKOV A ET AL: "FGF-21 as a novel metabolic regulator", THE JOURNAL OF CLINICAL INVESTIGATION, B M J GROUP, GB, vol. 115, no. 6, 1 June 2005 (2005-06-01), pages 1627 - 1635, XP002362553, ISSN: 0021-9738, DOI: 10.1172/JCI23606 *
N/A: "Abstracts of 17th Annual Meeting of the American-Society-of-Gene-and-Cell-Therapy (ASGCT),", MOLECULAR THERAPY, vol. 22, no. Suppl.1., 1 June 2014 (2014-06-01), US, pages S1 - S306, XP055310541, ISSN: 1525-0016, DOI: 10.1038/mt.2014.64 *
RAYMOND NG ET AL: "miRNA-32 Drives Brown Fat Thermogenesis and Trans-activates Subcutaneous White Fat Browning in Mice", CELL REPORTS, vol. 19, no. 6, 1 May 2017 (2017-05-01), US, pages 1229 - 1246, XP055423161, ISSN: 2211-1247, DOI: 10.1016/j.celrep.2017.04.035 *
See also references of WO2018215613A1 *
TAKESHI INAGAKI ET AL: "Endocrine Regulation of the Fasting Response by PPAR-alpha--Mediated Induction of Fibroblast Growth Factor 21", CELL METABOLISM, CELL PRESS, UNITED STATES, vol. 5, no. 6, 6 June 2007 (2007-06-06), pages 415 - 425, XP008151942, ISSN: 1550-4131, [retrieved on 20070605], DOI: 10.1016/J.CMET.2007.05.003 *

Also Published As

Publication number Publication date
BR112019024608A2 (en) 2020-06-23
AU2025203001A1 (en) 2025-05-22
RU2019142845A3 (en) 2021-09-20
MX2019013982A (en) 2020-07-22
AU2025203001A9 (en) 2026-03-05
WO2018215613A1 (en) 2018-11-29
AU2018274655B2 (en) 2025-01-30
JP7778469B2 (en) 2025-12-02
CN110913886A (en) 2020-03-24
JP2023109992A (en) 2023-08-08
AU2018274655A1 (en) 2019-12-19
JP2020530977A (en) 2020-11-05
US20200102361A1 (en) 2020-04-02
RU2019142845A (en) 2021-06-24

Similar Documents

Publication Publication Date Title
US20200102361A1 (en) Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence
Jimenez et al. FGF21 gene therapy as treatment for obesity and insulin resistance
Pozsgai et al. Systemic AAV-mediated β-sarcoglycan delivery targeting cardiac and skeletal muscle ameliorates histological and functional deficits in LGMD2E mice
US20220186251A1 (en) Viral vectors for the treatment of diabetes
JP2022088645A (en) Treatment of hyperbilirubinemia
O'Neill et al. Targeting adipose tissue via systemic gene therapy
US11207361B2 (en) AAV mediated exendin-4 gene transfer to salivary glands to protect subjects from diabetes or obesity
US20200289673A1 (en) Treatment of glycogen storage disease iii
JP7061067B2 (en) Composition for the treatment of Crigler-Najer syndrome
Galon-Tilleman et al. Apelin-36 modulates blood glucose and body weight independently of canonical APJ receptor signaling
JP2026034616A (en) Modified insulin and glucokinase nucleic acids for treating diabetes
EP3390623B1 (en) Wilson&#39;s disease gene therapy
US12559533B2 (en) Viral expression construct comprising a fibroblast growth factor 21 (FGF21) coding sequence
US20260139021A1 (en) Viral expression construct comprising a fibroblast growth factor (fgf21) coding sequence
CA3179874A1 (en) Fibroblast growth factor 21 (fgf21) gene therapy for central nervous system disorders
CA3063979A1 (en) Viral expression construct comprising a fibroblast growth factor 21 (fgf21) coding sequence
JP2022513127A (en) Fibroblast Growth Factor 21 (FGF21) Gene Therapy
BR122025000954A2 (en) VIRAL EXPRESSION CONSTRUCT COMPRISING A FIBROBLAST GROWTH FACTOR 21 (FGF21) CODING SEQUENCE
US20260022402A1 (en) Recombinant adeno-associated viral vector for gene delivery
US20250288693A1 (en) Insulin and glucokinase gene therapy compositions and its use for treating diabetes
Rajendiran et al. Combination Gene Therapy with AAV-Based Vectors Ameliorates the Phenotype of Type 2 Diabetes in Diet-Induced Obese and db/db Mice
CA2969599C (en) Viral vectors for the treatment of diabetes
EP4284440A1 (en) Gene therapy for monogenic diabetes
Muñoz et al. Research Article FGF21 gene therapy as treatment for obesity and insulin resistance Veronica Jimenez1, 2, 3,†, Claudia Jambrina1, 2, 3,†, Estefania Casana1, 2, 3, Victor Sacristan1, 2, 3
HK40045274A (en) Mini-gde for the treatment of glycogen storage disease iii

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20191209

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 40027095

Country of ref document: HK

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20220512