EP3559025A1 - Peptides antimicrobiens et leurs utilisations - Google Patents
Peptides antimicrobiens et leurs utilisationsInfo
- Publication number
- EP3559025A1 EP3559025A1 EP17838052.3A EP17838052A EP3559025A1 EP 3559025 A1 EP3559025 A1 EP 3559025A1 EP 17838052 A EP17838052 A EP 17838052A EP 3559025 A1 EP3559025 A1 EP 3559025A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- residue
- peptide
- seq
- sequence
- inflammatory
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108700042778 Antimicrobial Peptides Proteins 0.000 title description 8
- 102000044503 Antimicrobial Peptides Human genes 0.000 title description 8
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 541
- 239000003814 drug Substances 0.000 claims abstract description 101
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 94
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 84
- 230000003110 anti-inflammatory effect Effects 0.000 claims abstract description 63
- 230000000845 anti-microbial effect Effects 0.000 claims abstract description 55
- 208000015181 infectious disease Diseases 0.000 claims abstract description 53
- 208000027866 inflammatory disease Diseases 0.000 claims abstract description 46
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 38
- 201000010099 disease Diseases 0.000 claims abstract description 31
- 230000002265 prevention Effects 0.000 claims abstract description 31
- 230000033115 angiogenesis Effects 0.000 claims abstract description 29
- 230000001772 anti-angiogenic effect Effects 0.000 claims abstract description 16
- 150000001413 amino acids Chemical class 0.000 claims description 129
- 150000003839 salts Chemical class 0.000 claims description 85
- 229910052720 vanadium Inorganic materials 0.000 claims description 64
- 229940079593 drug Drugs 0.000 claims description 61
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 56
- 239000000203 mixture Substances 0.000 claims description 42
- 125000003729 nucleotide group Chemical group 0.000 claims description 33
- 239000002773 nucleotide Chemical group 0.000 claims description 32
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 22
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 14
- 239000003018 immunosuppressive agent Substances 0.000 claims description 13
- 239000004037 angiogenesis inhibitor Substances 0.000 claims description 11
- 230000000843 anti-fungal effect Effects 0.000 claims description 10
- 229940121375 antifungal agent Drugs 0.000 claims description 10
- 206010028980 Neoplasm Diseases 0.000 claims description 9
- 239000003242 anti bacterial agent Substances 0.000 claims description 8
- 239000003429 antifungal agent Substances 0.000 claims description 8
- 229940125721 immunosuppressive agent Drugs 0.000 claims description 5
- 206010038923 Retinopathy Diseases 0.000 claims description 3
- 201000001320 Atherosclerosis Diseases 0.000 claims description 2
- 206010003246 arthritis Diseases 0.000 claims description 2
- 201000008482 osteoarthritis Diseases 0.000 claims description 2
- 206010036030 Polyarthritis Diseases 0.000 claims 1
- 208000030428 polyarticular arthritis Diseases 0.000 claims 1
- 230000000813 microbial effect Effects 0.000 abstract description 25
- 235000001014 amino acid Nutrition 0.000 description 111
- 229940024606 amino acid Drugs 0.000 description 111
- 210000002865 immune cell Anatomy 0.000 description 35
- 210000004027 cell Anatomy 0.000 description 32
- 241000894006 Bacteria Species 0.000 description 27
- 238000000034 method Methods 0.000 description 27
- 230000000694 effects Effects 0.000 description 23
- 241000699670 Mus sp. Species 0.000 description 18
- 150000007523 nucleic acids Chemical class 0.000 description 17
- 210000003491 skin Anatomy 0.000 description 17
- 102220470372 Thymosin beta-10_K12A_mutation Human genes 0.000 description 16
- 210000003743 erythrocyte Anatomy 0.000 description 16
- 108020004707 nucleic acids Proteins 0.000 description 15
- 102000039446 nucleic acids Human genes 0.000 description 15
- 239000013641 positive control Substances 0.000 description 15
- 241000233866 Fungi Species 0.000 description 14
- 241001529936 Murinae Species 0.000 description 14
- 230000001580 bacterial effect Effects 0.000 description 14
- 230000015572 biosynthetic process Effects 0.000 description 14
- 230000012010 growth Effects 0.000 description 14
- 230000001506 immunosuppresive effect Effects 0.000 description 14
- 244000005700 microbiome Species 0.000 description 14
- 206010012442 Dermatitis contact Diseases 0.000 description 13
- 206010061218 Inflammation Diseases 0.000 description 13
- 229940121363 anti-inflammatory agent Drugs 0.000 description 13
- 208000010247 contact dermatitis Diseases 0.000 description 13
- 230000004054 inflammatory process Effects 0.000 description 13
- 239000013642 negative control Substances 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 230000000699 topical effect Effects 0.000 description 13
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 12
- 206010052428 Wound Diseases 0.000 description 12
- 208000027418 Wounds and injury Diseases 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 230000034994 death Effects 0.000 description 12
- 230000002757 inflammatory effect Effects 0.000 description 12
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 11
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 230000002949 hemolytic effect Effects 0.000 description 10
- 229960002751 imiquimod Drugs 0.000 description 10
- 230000002458 infectious effect Effects 0.000 description 10
- 239000000463 material Substances 0.000 description 10
- 239000000725 suspension Substances 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 201000004681 Psoriasis Diseases 0.000 description 9
- 208000010668 atopic eczema Diseases 0.000 description 9
- 210000004369 blood Anatomy 0.000 description 9
- 239000008280 blood Substances 0.000 description 9
- 210000001185 bone marrow Anatomy 0.000 description 9
- 238000000338 in vitro Methods 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 238000005259 measurement Methods 0.000 description 9
- 238000012360 testing method Methods 0.000 description 9
- 238000007792 addition Methods 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 230000006698 induction Effects 0.000 description 8
- 230000002401 inhibitory effect Effects 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 206010034674 peritonitis Diseases 0.000 description 8
- 208000017520 skin disease Diseases 0.000 description 8
- 230000004083 survival effect Effects 0.000 description 8
- 230000000844 anti-bacterial effect Effects 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 239000003921 oil Substances 0.000 description 7
- 230000007170 pathology Effects 0.000 description 7
- 230000001185 psoriatic effect Effects 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 6
- 206010018910 Haemolysis Diseases 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 239000003246 corticosteroid Substances 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 239000000839 emulsion Substances 0.000 description 6
- 230000008588 hemolysis Effects 0.000 description 6
- 230000001939 inductive effect Effects 0.000 description 6
- 230000003902 lesion Effects 0.000 description 6
- 235000019198 oils Nutrition 0.000 description 6
- 210000003200 peritoneal cavity Anatomy 0.000 description 6
- 229920002401 polyacrylamide Polymers 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 102220496105 5-hydroxytryptamine receptor 3B_M25A_mutation Human genes 0.000 description 5
- 201000004624 Dermatitis Diseases 0.000 description 5
- VYZAHLCBVHPDDF-UHFFFAOYSA-N Dinitrochlorobenzene Chemical compound [O-][N+](=O)C1=CC=C(Cl)C([N+]([O-])=O)=C1 VYZAHLCBVHPDDF-UHFFFAOYSA-N 0.000 description 5
- 102220515734 Methionine-R-sulfoxide reductase B1_A14K_mutation Human genes 0.000 description 5
- 101100515942 Mus musculus Nbl1 gene Proteins 0.000 description 5
- 102220470410 Thymosin beta-4_K12P_mutation Human genes 0.000 description 5
- 229960001334 corticosteroids Drugs 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 210000001616 monocyte Anatomy 0.000 description 5
- 238000010172 mouse model Methods 0.000 description 5
- 210000000440 neutrophil Anatomy 0.000 description 5
- 102200082905 rs35203747 Human genes 0.000 description 5
- 102100036630 60S ribosomal protein L7a Human genes 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 206010012438 Dermatitis atopic Diseases 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 206010039705 Scleritis Diseases 0.000 description 4
- 241000191967 Staphylococcus aureus Species 0.000 description 4
- 210000001744 T-lymphocyte Anatomy 0.000 description 4
- 150000001412 amines Chemical class 0.000 description 4
- 201000008937 atopic dermatitis Diseases 0.000 description 4
- 239000002775 capsule Substances 0.000 description 4
- 229910002091 carbon monoxide Inorganic materials 0.000 description 4
- 230000003833 cell viability Effects 0.000 description 4
- 239000006071 cream Substances 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 230000001472 cytotoxic effect Effects 0.000 description 4
- 230000036074 healthy skin Effects 0.000 description 4
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000007115 recruitment Effects 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 102220131073 rs766853710 Human genes 0.000 description 4
- 238000011287 therapeutic dose Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 238000011740 C57BL/6 mouse Methods 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 241001440205 Phyllomedusinae Species 0.000 description 3
- 239000012979 RPMI medium Substances 0.000 description 3
- 241001303601 Rosacea Species 0.000 description 3
- 206010070834 Sensitisation Diseases 0.000 description 3
- 241000191940 Staphylococcus Species 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 230000000172 allergic effect Effects 0.000 description 3
- 230000009435 amidation Effects 0.000 description 3
- 238000007112 amidation reaction Methods 0.000 description 3
- 210000000709 aorta Anatomy 0.000 description 3
- 210000004204 blood vessel Anatomy 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 208000037976 chronic inflammation Diseases 0.000 description 3
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000004590 computer program Methods 0.000 description 3
- 230000000875 corresponding effect Effects 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 230000035876 healing Effects 0.000 description 3
- 208000021267 infertility disease Diseases 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 210000004400 mucous membrane Anatomy 0.000 description 3
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 3
- 239000002674 ointment Substances 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 235000018102 proteins Nutrition 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 201000004700 rosacea Diseases 0.000 description 3
- 230000008313 sensitization Effects 0.000 description 3
- 206010040882 skin lesion Diseases 0.000 description 3
- 231100000444 skin lesion Toxicity 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 150000003431 steroids Chemical class 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 229940071127 thioglycolate Drugs 0.000 description 3
- CWERGRDVMFNCDR-UHFFFAOYSA-M thioglycolate(1-) Chemical compound [O-]C(=O)CS CWERGRDVMFNCDR-UHFFFAOYSA-M 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 235000001674 Agaricus brunnescens Nutrition 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 244000063299 Bacillus subtilis Species 0.000 description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 206010010741 Conjunctivitis Diseases 0.000 description 2
- 206010048768 Dermatosis Diseases 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 206010015084 Episcleritis Diseases 0.000 description 2
- 206010015150 Erythema Diseases 0.000 description 2
- 241000588722 Escherichia Species 0.000 description 2
- 206010017533 Fungal infection Diseases 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 2
- 206010021531 Impetigo Diseases 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 241000588748 Klebsiella Species 0.000 description 2
- 241000588749 Klebsiella oxytoca Species 0.000 description 2
- 241000588747 Klebsiella pneumoniae Species 0.000 description 2
- 241000579722 Kocuria Species 0.000 description 2
- 241001247311 Kocuria rhizophila Species 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 231100000111 LD50 Toxicity 0.000 description 2
- 241000186781 Listeria Species 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108010036176 Melitten Proteins 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 208000031888 Mycoses Diseases 0.000 description 2
- 208000009525 Myocarditis Diseases 0.000 description 2
- 206010071648 Noninfectious peritonitis Diseases 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 208000003251 Pruritus Diseases 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- 206010040070 Septic Shock Diseases 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 241000607720 Serratia Species 0.000 description 2
- 241000191963 Staphylococcus epidermidis Species 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 206010042566 Superinfection Diseases 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 241000607598 Vibrio Species 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 241000607734 Yersinia <bacteria> Species 0.000 description 2
- 241001148129 Yersinia ruckeri Species 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 229960001138 acetylsalicylic acid Drugs 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000010933 acylation Effects 0.000 description 2
- 238000005917 acylation reaction Methods 0.000 description 2
- 230000016571 aggressive behavior Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 230000003385 bacteriostatic effect Effects 0.000 description 2
- 229960002537 betamethasone Drugs 0.000 description 2
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 2
- 208000010217 blepharitis Diseases 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 230000007123 defense Effects 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 210000005069 ears Anatomy 0.000 description 2
- 206010014665 endocarditis Diseases 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 230000032050 esterification Effects 0.000 description 2
- 238000005886 esterification reaction Methods 0.000 description 2
- 239000003925 fat Substances 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 239000007789 gas Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- ZWCXYZRRTRDGQE-SORVKSEFSA-N gramicidina Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](NC=O)C(C)C)CC(C)C)C(=O)NCCO)=CNC2=C1 ZWCXYZRRTRDGQE-SORVKSEFSA-N 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 230000009036 growth inhibition Effects 0.000 description 2
- 208000008025 hordeolum Diseases 0.000 description 2
- 229960000890 hydrocortisone Drugs 0.000 description 2
- 229960001680 ibuprofen Drugs 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 208000000509 infertility Diseases 0.000 description 2
- 230000036512 infertility Effects 0.000 description 2
- 239000002054 inoculum Substances 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 206010023332 keratitis Diseases 0.000 description 2
- 108010082117 matrigel Proteins 0.000 description 2
- VDXZNPDIRNWWCW-JFTDCZMZSA-N melittin Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-JFTDCZMZSA-N 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 235000008390 olive oil Nutrition 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 230000036303 septic shock Effects 0.000 description 2
- 206010040872 skin infection Diseases 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000007480 spreading Effects 0.000 description 2
- 238000003892 spreading Methods 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 229940021506 stye Drugs 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- 241000588626 Acinetobacter baumannii Species 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 101000968061 Agalychnis dacnicolor Dermaseptin-DA2 Proteins 0.000 description 1
- 206010001488 Aggression Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 108020004256 Beta-lactamase Proteins 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006458 Bronchitis chronic Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 206010062746 Carditis Diseases 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000588697 Enterobacter cloacae Species 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241001480035 Epidermophyton Species 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- 206010016936 Folliculitis Diseases 0.000 description 1
- 206010017553 Furuncle Diseases 0.000 description 1
- 208000007882 Gastritis Diseases 0.000 description 1
- 208000005577 Gastroenteritis Diseases 0.000 description 1
- 108010026389 Gramicidin Proteins 0.000 description 1
- 208000023661 Haematological disease Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000270974 Hylidae Species 0.000 description 1
- 241001440201 Hylinae Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- 241000588915 Klebsiella aerogenes Species 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 241000194040 Lactococcus garvieae Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000234435 Lilium Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 244000062730 Melissa officinalis Species 0.000 description 1
- 235000010654 Melissa officinalis Nutrition 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241000192041 Micrococcus Species 0.000 description 1
- 241001480037 Microsporum Species 0.000 description 1
- CMWTZPSULFXXJA-UHFFFAOYSA-N Naproxen Natural products C1=C(C(C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-UHFFFAOYSA-N 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 241001293420 Pachymedusa dacnicolor Species 0.000 description 1
- 206010034016 Paronychia Diseases 0.000 description 1
- 241000029132 Paronychia Species 0.000 description 1
- 241001440203 Pelodryadinae Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 241000101040 Pityriasis Species 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- -1 SEQ ID NO: 1 Chemical class 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000607715 Serratia marcescens Species 0.000 description 1
- 206010040799 Skin atrophy Diseases 0.000 description 1
- 241000295644 Staphylococcaceae Species 0.000 description 1
- 206010041925 Staphylococcal infections Diseases 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 208000007712 Tinea Versicolor Diseases 0.000 description 1
- 206010056131 Tinea versicolour Diseases 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 241000607272 Vibrio parahaemolyticus Species 0.000 description 1
- 241000222126 [Candida] glabrata Species 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 206010000269 abscess Diseases 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 230000004721 adaptive immunity Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 229940060265 aldara Drugs 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 230000003444 anaesthetic effect Effects 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 230000002491 angiogenic effect Effects 0.000 description 1
- 230000000947 anti-immunosuppressive effect Effects 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 230000001420 bacteriolytic effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 125000006367 bivalent amino carbonyl group Chemical group [H]N([*:1])C([*:2])=O 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 208000032343 candida glabrata infection Diseases 0.000 description 1
- 125000006297 carbonyl amino group Chemical group [H]N([*:2])C([*:1])=O 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 208000007451 chronic bronchitis Diseases 0.000 description 1
- 230000007012 clinical effect Effects 0.000 description 1
- 229960004703 clobetasol propionate Drugs 0.000 description 1
- CBGUOGMQLZIXBE-XGQKBEPLSA-N clobetasol propionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CCl)(OC(=O)CC)[C@@]1(C)C[C@@H]2O CBGUOGMQLZIXBE-XGQKBEPLSA-N 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 238000004163 cytometry Methods 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 231100000708 dermatoxin Toxicity 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960001259 diclofenac Drugs 0.000 description 1
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 210000002249 digestive system Anatomy 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 230000000437 effect on angiogenesis Effects 0.000 description 1
- 239000003974 emollient agent Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 229940092559 enterobacter aerogenes Drugs 0.000 description 1
- 229940032049 enterococcus faecalis Drugs 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 231100000321 erythema Toxicity 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 238000005187 foaming Methods 0.000 description 1
- 235000012631 food intake Nutrition 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000000855 fungicidal effect Effects 0.000 description 1
- 230000001408 fungistatic effect Effects 0.000 description 1
- 210000005095 gastrointestinal system Anatomy 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 239000003349 gelling agent Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 229960004905 gramicidin Drugs 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229960002453 hydrocortisone aceponate Drugs 0.000 description 1
- MFBMYAOAMQLLPK-FZNHGJLXSA-N hydrocortisone aceponate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(C)=O)(OC(=O)CC)[C@@]1(C)C[C@@H]2O MFBMYAOAMQLLPK-FZNHGJLXSA-N 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 230000001861 immunosuppressant effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 208000021646 inflammation of heart layer Diseases 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 230000007803 itching Effects 0.000 description 1
- 210000001503 joint Anatomy 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 150000003951 lactams Chemical group 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000000865 liniment Substances 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 208000002780 macular degeneration Diseases 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 238000013178 mathematical model Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- VDXZNPDIRNWWCW-UHFFFAOYSA-N melitten Chemical compound NCC(=O)NC(C(C)CC)C(=O)NCC(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)O)C(=O)NC(C(C)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)N1CCCC1C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)NC(C(C)CC)C(=O)NC(CO)C(=O)NC(C(=O)NC(C(C)CC)C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-UHFFFAOYSA-N 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 208000015688 methicillin-resistant staphylococcus aureus infectious disease Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229960002009 naproxen Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-N naproxen Chemical compound C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-N 0.000 description 1
- 230000004719 natural immunity Effects 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 235000015927 pasta Nutrition 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 208000008494 pericarditis Diseases 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 201000000508 pityriasis versicolor Diseases 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 125000000561 purinyl group Chemical class N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000008261 resistance mechanism Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 208000013223 septicemia Diseases 0.000 description 1
- 229920002545 silicone oil Polymers 0.000 description 1
- 230000008591 skin barrier function Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000003637 steroidlike Effects 0.000 description 1
- 238000005728 strengthening Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000007939 sustained release tablet Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 230000009424 thromboembolic effect Effects 0.000 description 1
- 210000002303 tibia Anatomy 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- 230000000472 traumatic effect Effects 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 230000036269 ulceration Effects 0.000 description 1
- 238000000870 ultraviolet spectroscopy Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 235000019871 vegetable fat Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/463—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from amphibians
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention provides peptides with anti-inflammatory, anti-angiogenic and / or antimicrobial activity and their use in the prevention or treatment of inflammatory and / or angiogenesis-related diseases.
- Inflammation or inflammatory reaction is a response to an aggression of exogenous origin (infectious, traumatic cause) or endogenous (encounter of an "abnormal” or a large quantity of antigen, immunological cause, ischemi - irreperfusion syndrome). It is involved in natural immunity in response to a danger signal as well as in the induction of the specific immune response and is therefore associated with a very wide variety of pathological situations (infections, systemic diseases, cancers, thromboembolic pathologies ). The inflammatory reaction, initially intended to protect the body against external aggressions, can lead to deleterious effects.
- the inflammation can affect the structure as well as the function of the affected organ and must be treated.
- the skin and the mucous membranes are the seat of many pathologies including an inflammatory component.
- Eczema and psoriasis are examples of dermatoses characterized by an inappropriate, excessive or chronic inflammatory reaction resulting in tissue damage.
- Atopic dermatitis is a chronic inflammatory disease involving innate alteration of the skin barrier and inflammation involving innate and adaptive immunity, including specific T cells directed against environmental protein allergens (extrinsic AD or allergic) or cutaneous auto-antigens (intrinsic or non-allergic AD).
- AD atopic dermatitis
- DA seems correlated with skin colonization by Staphylococcus aureus (Lin et al., 2007 Clinic Rev Allerg Immunol; 33: 167-177).
- Psoriasis is a chronic inflammatory disease whose precise cause is not known. Several factors would be involved in the onset of the disease, especially genetic and environmental factors. Microorganisms could also be the cause of psoriasis (Munz et al, 2010. Arch Dermatol Res, 302 (7): 495-8). At the cellular level, T lymphocytes seem to play a central role. A frequent complication of inflammatory dermatoses is impetiginisation, that is to say the superinfection of skin lesions initially uninfected, most often by streptococci or staphylococci.
- Anti-inflammatory drugs include anti-inflammatory steroids (derived from cortisol or cortisone) and non-steroids (e.g., aspirin, ibuprofen), and compounds with immunosuppressive activity.
- anti-inflammatory steroids derived from cortisol or cortisone
- non-steroids e.g., aspirin, ibuprofen
- compounds with immunosuppressive activity e.g., aspirin, ibuprofen
- the most commonly used anti-inflammatory agents on the skin are topical corticosteroids such as hydrocortisone or betamethasone. There are four groups of topical corticosteroids divided according to the intensity of their activity (power level), from class I (very strong activity) to class IV (weak activity).
- the choice of activity level and dosage of the local corticosteroid depends on the nature of the lesion, the sensitivity and the age of the patient, and may require various adjustments during treatment.
- the side effects of topical corticosteroids range from skin atrophy (reversible) to the appearance of skin infections, requiring discontinuation of treatment via contact dermatitis associated with corticosteroids.
- Anti-inflammatory agents are contraindicated when the skin is infected or if it presents ulcerations (wounds) and are avoided in case of infectious dermatosis or superinfection of a pre-existing dermatosis because of the risk of a low noise evolution of infectious pathology, masked by an apparent favorable clinical effect. Thus, it is often recommended to treat any skin infection prior to the application of topical corticosteroids, which further complicates the treatment.
- Antimicrobial peptides are defense peptides considered to be one of the key components of the innate immune system, which provides the first line of defense for multicellular organisms against pathogens.
- the interest aroused by these peptides comes in particular from their broad spectrum of activity. Their mode of action is based on a rapid permeabilization or fragmentation of the membranes of microorganisms, unlikely to generate the appearance of resistance mechanisms.
- Antimicrobial peptides have been identified in plants, insects, amphibians and mammals. The skin of amphibians is an important source of antimicrobial peptides and each frog species has its own peptide repertoire consisting generally of 10 to 15 PAMs.
- the Phyllomedusinae subfamily synthesizes and secretes a large diversity of PAMs that have been classified into seven families: dermaseptins (17 peptides), phylloseptins (17 peptides), plasticins (6 peptides), dermatoxins (4 peptides), phylloxins (2 peptides ), hyposines (5 peptides) and 4 orphan peptides (Amiche et al., 2008, Peptides, 29: 2074-2082).
- the object of the present invention is to provide novel peptides with anti-inflammatory and / or antimicrobial activity, particularly for the treatment of inflammatory diseases, in particular inflammatory diseases due to or associated with an infection.
- the present invention relates to a peptide having an anti-inflammatory and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-ÎC-KVG-X4-X5- X6-G- [CA-9 (SEQ ID NO: 29), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- - ⁇ is X7-L-N-A, X7-L-N-A-V-T-N-X8-A, X7-L-N-A-V-T-N-X8-A-N-Q-N-X9-X10, or is absent; and wherein:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue; and functional derivatives and pharmaceutically acceptable salts of said peptide, with the proviso that the peptide is not a peptide of sequence SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4.
- the peptide having anti-inflammatory and / or antimicrobial activity has a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6. -GKA-X7-LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4.
- the peptide has a sequence selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18 , SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28 and functional derivatives and pharmaceutically acceptable salts of this peptide.
- the invention further relates to a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA-X7-LNAVT-N-X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2, or a nucleotide sequence coding for at least one of these peptides, for use as a medicament.
- the present invention relates to a medicament comprising a peptide having a sequence of 17 to 100 amino acids comprising the sequence A-L-X1-X2-T-L-X3-K-K-V-G-X4-X5-X6-
- G- ⁇ - ⁇ - ⁇ (SEQ ID NO: 29), wherein: -Xi is a residue W or A;
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xg is an M or A residue
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2, or a nucleotide sequence coding for at least one such peptide.
- the drug comprises a peptide having a 29 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN-X8 -ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xe is a residue M or A
- -X10 represents no residue or is a Q residue
- the invention also relates to a pharmaceutical composition comprising at least one peptide as described above or a nucleotide sequence coding for at least one of these peptides, and one or more pharmaceutically acceptable excipients.
- Another subject of the invention is a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-Xi-X2-TL-X3-KKVG-X4-X5-3 ⁇ 4-GKA-9 (SEQ ID NO: 29) , in which :
- -Xi is a residue W or A
- -Xi is a residue K or D
- -X3 is an L or A residue
- -XA is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide has a sequence of 29 to 100 amino acids comprising the sequence AL-X1 -TL-Xs-KKVGX-Xs-Xe-GKA-LNAVT-N-X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein: -Xi is a residue W or A;
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xe is a residue M or A
- -X10 represents no residue or is a Q residue
- One aspect of the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-Xi-X2-TL-X3-KKVG-X4-Xs-X6-GKA-9 (SEQ ID NO: 29) , in which :
- -Xi is a residue W or A; -X2 is a residue K or D;
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- - ⁇ is a residue A, K or D;
- - ⁇ is X7-LNA, X7-LNAVTN-X8-A, X7-LNAVTN-X8-ANQN-X9-X10, or is absent; and wherein:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide has a sequence of 29 to 100 amino acids comprising the sequence AL-X1 -TL-Xs-KKVGX-Xs-Xe-GKA-Xv-LNAVT-N-X8-ANQN-X9- X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide, drug or pharmaceutical composition for its use as described above is characterized in that the inflammatory disease is due to infection.
- One aspect of the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-Xi-X 2 -TL-X3-KKVG-X4-X5-X6-GKA-9 (SEQ ID NO: 29 ), in which :
- -Xi is a residue W or A
- -Xi is a residue K or D
- -X3 is an L or A residue
- -XA is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide has a sequence of 29 to 100 amino acids comprising the sequence AL-X1 -TL-Xs-KKVGX-Xs-Xe-GKA-LNAVT-N-X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein: -Xi is a residue W or A;
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xe is a residue M or A
- -X10 represents no residue or is a Q residue
- the present invention further relates to the use of a peptide having a sequence of 17 to 100 amino acids comprising the sequence A-L-X1-X2-T-L-X3-K-K-V-G-X4-X5-X6-G-K-
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- - ⁇ is a residue A, K or D;
- - ⁇ is X7-LNA, X7-LNAVTN-X8-A, X7-LNAVTN-X8-ANQN-X9-X10, or is absent; and wherein:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- peptide is not a peptide of sequence SEQ ID NO: 2, as antifungal or antibacterial agent.
- the present invention further relates to the use of a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7- LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- X is a residue A, K or D
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the present invention also relates to a kit comprising a peptide, a peptide for its use, a drug, or a pharmaceutical composition as described above, and optionally the instructions for administering the peptide, drug, or pharmaceutical composition to said subject.
- peptide oligopeptide
- polypeptide polypeptide or protein
- peptide bonds irrespective of the number of residues. amino acid constituting this chain.
- C Cys, cysteine
- D Asp, aspartic acid
- E Glu, glutamic acid
- F Phe, phenylalanine
- G Gly, glycine
- H His, histidine
- I Ile, isoleucine
- K Lily, lysine
- L Leu, leucine
- M Met, methionine
- N Asn, asparagine
- P Pro, praline
- Q Gin, glutamine
- R Arg, arginine
- S Ser, serine
- T Thr, threonine
- V Val, valine
- W Trp, tryptophan
- Y Tyr, tyrosine.
- microbe or "microbial” as used herein refers to bacteria, fungi, yeasts, viruses and / or parasites.
- microbial infection refers to an infection due to bacteria, fungi, yeasts, viruses and / or parasites.
- antibacterial activity refers to antibacterial, antiviral, antifungal and / or antiparasitic activity. This activity can be evaluated by measuring different parameters such as the ICso, the MIC or the CMB.
- IC 50 or “inhibitory concentration 50” corresponds to the required concentration of a compound to reduce the in vitro growth of a population of microorganisms by 50%.
- MIC or “mimethal inhibitory concentration” corresponds to the minimum concentration of compound to completely inhibit microbial growth, after 18 hours of incubation, generally at 37 ° C, in the presence of said compound.
- CMB or “minimum bactericidal concentration” is the minimum concentration of compound that can destroy 99.9% of microorganisms after 18 to 24 hours of contact with said compound.
- lethal concentration 50 or "LC 50” as used herein refers to the concentration of compound causing the death of 50% of a cell population.
- LCso is a quantitative indicator of the toxicity of a compound. LCso is used in this document to evaluate the cytotoxicity of PAMs, in particular on immune and erythrocyte cells.
- CL 50 is the peptide concentration that induces the death of 50% of immune cells.
- the CL 50 corresponds to the peptide concentration inducing the death of 50% of the erythrocyte cells.
- anti-inflammatory activity refers to an activity aimed at inhibiting or limiting inflammation. Examples of inflammation include erythema, edema. Inflammation, medically, is defined as the union of the following four phenomena: swelling, redness, heat, and pain.
- immunosuppressive activity refers to an activity aimed at alleviating or suppressing the immune responses of the body.
- a pharmaceutically acceptable excipient does not produce any side effect, allergic or other adverse reaction when administered to an animal, preferably a human.
- the preparations must meet the standard criteria for sterility, pyrogenicity, general safety and purity as required by regulatory authorities, such as the FDA or EM ⁇ .
- subject refers to an animal, including a human being.
- a subject may be a patient, namely a person receiving medical care, undergoing or having undergone medical treatment, or monitored as part of the development of a disease.
- treat or “treatment” refers both to a therapeutic treatment and to prophylactic or preventive measures, in which the objective is to prevent or slow down (decrease) the targeted pathological condition, or the disorder.
- Those who need treatment include those who already have the disorder and those who are predisposed or likely to have it, or those in whom the disorder is to be prevented.
- a subject or a mammal is successfully "treated” if, after receiving a therapeutic dose of the peptide according to the present invention, the patient shows an observable and / or measurable reduction or an absence of one or more of the following: reduction of the number of cells pathogenic, reduction in the total percentage of pathogenic cells, and / or some relief of one or more of the symptoms associated with the targeted disease, reduced morbidity and mortality, and improved quality of life.
- the above parameters for evaluating the success of the treatment and improving the disease situation are easily measurable by routine procedures known to the practitioner.
- the term "therapeutically effective dose” refers to the dose of therapeutic agent necessary and sufficient to slow or stop the progression, aggravation or deterioration of one or more symptoms of the disease or condition; alleviate the symptoms of the disease or condition; cure the disease or condition.
- the condition according to the invention is an inflammatory disease, a microbial disease, or an inflammatory disease with an infectious component.
- the condition according to the invention is a disease related to angiogenesis.
- the invention firstly relates to a peptide having an anti-inflammatory activity and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-ÎC-KVG-X4- X5-X6-G- [CA-9 (SEQ ID NO: 29), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- - ⁇ is X7-LNA (SEQ ID NO: 30), Xv-LNAVTN-Xs-A (SEQ ID NO: 31), Xv- LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 32), or is absent; and wherein:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide with the sequence ALWKTLLKKVGKVAGKAVLNAVTNMANQNEQ-OH (SEQ ID NO: 2), ALWKTLLKKVGKVAGKAVLNAVTNMANQNE-OH (SEQ ID NO: 3) or ALWKTLLKKVGKVAGKAVLNAVTNMANQN-OH (SEQ ID NO: 4).
- the peptide of the invention does not comprise SEQ ID NO: 2. In one embodiment, the peptide of the invention does not include SEQ ID NO: 3. In one embodiment, the peptide of the invention does not comprise SEQ ID NO: 4. According to a mode of the invention, the peptide of the invention is not a peptide of sequence MALViCKSLFLVLFLGLVSLSICEEKRENEDEEEQEDDEQSEEKRALWKTLLKKVG KVAGKAVLNAVTNMANQNEQ (SEQ ID NO: 36).
- the peptide of the invention does not comprise the sequence SEQ ID NO: 36.
- p is X7-L-N-A-V-T-N-X8-A-N-Q-N-X9-X10 (SEQ ID NO:
- X9 and X10 do not represent any residues.
- p is X7-L-N-A-V-T-N-X8-A-N-Q-N-X9-X10 (SEQ ID NO: 32) and X9 and X10 are no residues.
- the peptide having anti-inflammatory and / or antimicrobial activity has a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6 -GKA (SEQ ID NO: 33), in which:
- -Xi is a residue W or A
- -X4 is a residue K, A or P;
- the peptide is not a peptide of sequence SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4.
- the peptide having anti-inflammatory and / or antimicrobial activity has a sequence of 21 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6 -GKA-X7-LNA (SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- the peptide is not a peptide of sequence SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4.
- the peptide having anti-inflammatory and / or antimicrobial activity has a sequence of 26 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6. -GKA-X7-LNAVTN-X8-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X4 is a residue K, A or P;
- -Xs is a residue M or A
- the peptide having an anti-inflammatory and / or antimicrobial activity has a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-Xs-X6-G-C1-A-X7-LNAVTN -X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- -Xe is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide of the invention is provided with anti-inflammatory activity, immunosuppressive activity, anti-angiogenic activity and / or antimicrobial activity.
- the peptide of the invention is provided with antimicrobial activity. In another embodiment of the invention, the peptide of the invention is provided with an anti-inflammatory activity. In another embodiment of the invention, the peptide of the invention is provided with an immunosuppressive effect. In another embodiment of the invention, the peptide of the invention has an anti-angiogenic effect.
- the peptide of the invention is provided with anti-inflammatory activity and antimicrobial activity. In a preferred embodiment of the invention, the peptide of the invention is endowed with an anti-inflammatory activity and an immunosuppressive activity. In a preferred embodiment of the invention, the peptide of the invention is endowed with anti-inflammatory activity and anti-angiogenic activity.
- the peptide of the invention is provided with anti-inflammatory activity, immunosuppressive activity and antimicrobial activity. In a preferred embodiment of the invention, the peptide of the invention is provided with anti-inflammatory activity, anti-angiogenic activity and antimicrobial activity. In a preferred embodiment of the invention, the peptide of the invention is provided with anti-inflammatory activity, immunosuppressive activity and anti-angiogenic activity. In a preferred embodiment of the invention, the peptide of the invention is endowed with anti-immunosuppressive activity, anti-angiogenic activity and antimicrobial activity.
- the peptide of the invention is provided with anti-inflammatory activity, immunosuppressive activity, anti-angiogenic activity and antimicrobial activity.
- the residue Xi is W in SEQ ID NOs 1 and 29 to 32
- the residue X2 is K in SEQ ID NOs 1 and 29 to 32
- the residue XJ is L in SEQ IDs. NOs 1 and 29 to 32
- the residue X4 is K or A in SEQ ID NOs 1 and 29 to 32
- the residue Xs is V in SEQ ID NOs 1 and 29 to 32
- the residue Xe is A in SEQs ID NOs 1 and 29 to 32
- / or the residue X7 is V in SEQ ID NOs 1, 29, 31 and 32
- the residue X9 represents the residue E and the residue Xi 0 represents the residue Q in SEQ ID NO 1.
- the residue 3 ⁇ 4 does not represent any amino acid in SEQ ID NO 1.
- the Xio residue does not represent any amino acid in SEQ ID NO.
- the residue 3 ⁇ 4 is E and the residue Xio is absent in SEQ ID NO 1.
- the residue 3 ⁇ 4 represents the residue E and the residue Xio does not represent any acid amine in SEQ ID NO: 1.
- the X> and Xio residues do not represent any amino acid.
- the peptide of the invention has a sequence of 29 to 100 amino acids comprising the sequence AL-Xi-X2-TL-X3-KKVG-X4-X5-X6-GKA-X7 -LNAVTN-X8-ANQN (SEQ ID NO: 25), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- - ⁇ is a residue A, EC or D;
- -Xs is a residue M or A
- the peptide is not a peptide of sequence SEQ ID NO: 2; SEQ ID NO: 3 or SEQ ID NO: 4.
- the peptide has a size of between 17 and 100 amino acids, preferably between 17 and 50, between 17 and 45, between 17 and 40, between 17 and 35, or between 17 and 30 amino acids. According to another embodiment, the peptide has a size of between 17 and 34, between 17 and 33, between 17 and 32, or between 17 and 31 amino acids. According to one embodiment, the peptide has a size of 17 amino acids.
- the peptide has a size of between 21 and 100 amino acids, preferably between 21 and 50, between 21 and 45, between 21 and 40, between 21 and 35, or between 21 and 30 amino acids. According to another embodiment, the peptide has a size of between 21 and 34, between 21 and 33, between 21 and 32, or between 21 and 31 amino acids. According to one embodiment, the peptide has a size of 21 amino acids.
- the peptide has a size of between 26 and 100 amino acids, preferably between 26 and 50, between 26 and 45, between 26 and 40, between 26 and 35, or between 26 and 30 amino acids. According to another embodiment, the peptide has a size of between 26 and 34, between 26 and 33, between 26 and 32, or between 26 and 31 amino acids. According to one embodiment, the peptide has a size of 26 amino acids.
- the peptide has a size of between 29 and 100 amino acids, preferably between 29 and 50, between 29 and 45, between 29 and 40, between 29 and 35, or between 29 and 30 amino acids. According to another embodiment, the peptide has a size of between 29 and 34, between 29 and 33, between 29 and 32, or between 29 and 31 amino acids.
- the peptide has a size of 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35. amino acids. In a preferred embodiment of the invention, the peptide is 29 amino acids in size.
- the amino acids constituting the peptide according to the invention may be of L or D configuration, preferably of L configuration.
- the peptide according to the invention may contain a combination of amino acids of L configuration and D. configuration
- the peptide according to the invention may have a post-translational modification and / or chemical modification, in particular glycosylation, amidation, esterification, acylation, acetylation or methylation.
- protecting groups can be added to the C- and / or N-terminal ends.
- the protecting group at the N-terminus may be acylation or acetylation and the protective group at the C-terminus may be amidation or esterification.
- the action of proteases can also be counteracted by the use of amino acids of configuration D, the cyclization of the peptide by formation of disulfide bridges, lactam rings or bonds between the N- and C- ends. terminal.
- the peptide of the invention may also comprise pseudopeptide bonds replacing the "conventional" CONH peptide bonds and conferring increased resistance to peptidases, such as CHOH-CH 2, NHCO, CH 2 -O, CH 2 CH 2, CO-CH 2, NN, CH, CH2NH, and CH2-S.
- the peptide according to the invention has an amidation of its C-terminal end.
- the peptide of the present invention consists of or comprises a sequence selected from the following group:
- residues preceded by the letter "d” are amino acids of configuration D, and functional derivatives and pharmaceutically acceptable salts of said peptide.
- the peptide has a sequence comprising or consisting of the sequence SEQ ID NO: 5. In one embodiment, the peptide has a sequence comprising or consisting of the sequence SEQ ID NO: 6. In one embodiment, the peptide has a sequence comprising or consisting of the sequence SEQ ID NO: 7. In one embodiment, the peptide has a sequence comprising or consisting of the sequence SEQ ID NO: 8.
- the invention also covers the functional derivatives of a peptide according to the invention as described above.
- the term "functional derivative” as used herein refers to peptides having substantially the same amino acid sequence, substantially the same helical structure and substantially the same anti-inflammatory, anti-angiogenic and / or antimicrobial activity. .
- the term “functional derivative” as used herein refers to peptides having substantially the same amino acid sequence, substantially the same helical structure, and substantially the same anti-inflammatory and / or antimicrobial activity.
- These functional derivatives may be resistant to proteolysis by one or more chemical (s) modifications or substantially homologous to one or more conservative (s) substitution (s).
- These functional derivatives can be, for example, inverso peptides, retro peptides, retro-inverso peptides and peptides whose side chain of one or more of the amino acids is substituted by groups which do not modify the anti-inflammatory activity.
- -Inflammatory and / or antimicrobial peptide of the invention can be, for example, inverso peptides, retro peptides, retro-inverso peptides and peptides whose side chain of one or more of the amino acids is substituted by groups which do not modify the anti-inflammatory activity.
- the invention also covers the pharmaceutically acceptable salts of a peptide according to the invention.
- the pharmaceutically acceptable salts may be, for example, salts with pharmaceutically acceptable mineral acids such as hydrochloric acid, hydrobromic acid, sulfuric acid and phosphoric acid; salts with pharmaceutically acceptable organic acids such as acetic acid, citric acid, maleic acid, malic acid, succinic acid, ascorbic acid and tartaric acid; salts with pharmaceutically acceptable inorganic bases such as sodium, potassium, calcium, magnesium or ammonium salts; or salts with organic bases which have salifiable nitrogen, commonly used in the pharmaceutical art.
- the methods for preparing these salts are well known to those skilled in the art.
- the peptide according to the invention can be obtained by conventional chemical synthesis (in solid phase or in liquid homogeneous phase) or by enzymatic synthesis (Kullman et al., 1987. Enzymatic peptide synthesis, CRC Press, Florida). It can also be obtained by culturing a host cell, as described hereinafter, comprising a transgene encoding the peptide and expressing said peptide, and extracting said peptide from these host cells or from the culture medium. wherein the peptide has been secreted.
- the peptide is an isolated peptide. In one embodiment, the peptide is a recombinant peptide.
- a second subject of the invention relates to a nucleic acid encoding a peptide according to the first subject of the invention.
- nucleic acid means any molecule based on DNA or RNA. It may be synthetic or semisynthetic, recombinant, possibly amplified or cloned in vectors, chemically modified, comprising non-natural bases or modified nucleotides comprising for example a modified bond, a modified purine or pyrirnidic base, or a modified sugar.
- the nucleic acid according to the invention may be in the form of DNA and / or RNA, single-stranded or double-stranded.
- the nucleic acid is an isolated DNA molecule, synthesized by recombinant techniques well known to those skilled in the art.
- the nucleic acid according to the invention can be deduced from the sequence of the peptide according to the invention and the use of the codons can be adapted according to the host cell in which the nucleic acid is to be transcribed. These steps can be performed according to methods well known to those skilled in the art and some of which are described in the reference manual Sambrook et al. (Sambrook et al., In Vitro Cell, Dev Biol., 28P: 97-105).
- the nucleic acid is the nucleic acid encoding an amino acid sequence selected from the group consisting of or consisting of SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 6, SEQ. ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO : 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 26, SEQ ID NO: 27 , and SEQ ID NO: 28.
- nucleic acid that is selected from the group consisting of or consisting of:
- SEQ ID NO: 24 coding for peptides of sequence SEQ ID NO: 2 and 5, or any sequence exhibiting at least 75%, preferably at least 80, 85, 90, 95, 96, 97, 98 or 99% identity with one of SEQ ID NOs: 22-24.
- Two sequences are said to be optimally aligned when the percentage of identity is maximum. Moreover, as will become clear to those skilled in the art, it may be necessary to use additions of gaps (gaps) so as to obtain an optimal alignment between the two sequences.
- the percentage identity between two nucleic acid sequences can therefore be determined by comparing these two optimally aligned sequences in which the nucleic acid sequence to be compared can comprise additions or deletions with respect to the reference sequence for optimal alignment between these two sequences.
- the percentage of identity is then calculated by determining the number of identical positions for which the nucleotide is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window and by multiplying the result obtained. by 100 to get the percentage of identity between these two sequences.
- the methods of determining the identity are designed to give the greatest possible concordance between the compared sequences.
- the percentage of identity can be determined by a particular mathematical model or by a computer program (generally referred to as an "algorithm").
- Methods for calculating identity between nucleotide sequences are well known to those skilled in the art. Non-limiting examples of such methods include those described in the following documents: Arthur M. Lesk, Computational Molecular Biology: Methods and Methods for Sequence Analysis (New York: Oxford University Press, 1988); Douglas W. Smith, Biocomputing: Informatics and Genome Projects (New York: Academy Press, 1993); Hugh G. Griffin and Annette M.
- GCG software including GAP (Devereux et al., 1984. Nucl Acid Res 12 (1 Pt 1): 387-395; Genetics Computer Group, University of Wisconsin Biotechnology Center, Madison, WI), BLASTP, BLASTN, and FASTA (Altschul et al., 1990. Mol Biol 215 (3): 403-410).
- the BLASTX program is available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al., NCB / NLM / NIH Bethesda, Md., 20894, Altschul et al, 1990. Mol Biol 215 (3 ): 403-410).
- NCBI National Center for Biotechnology Information
- the Smith-Waterman algorithm which is well known to those skilled in the art, can also be used to determine the percent identity between two sequences.
- the invention furthermore relates to a vector or a plasmid in which a nucleic acid according to the invention is associated with elements suitable for the control of transcription (in particular a promoter, an amplifier and optionally a terminator) and, optionally, the translation.
- elements suitable for the control of transcription in particular a promoter, an amplifier and optionally a terminator
- the vector is a recombinant vector.
- a nucleic acid according to the invention has been inserted into the vector.
- the vector may be a cloning vector or an expression vector.
- the invention also relates to a host cell expressing a peptide of the invention, constitutively or transiently.
- the host cell has been transformed with at least one of the nucleic acids according to the invention.
- transformation means the introduction of a "foreign” (ie, extrinsic or extracellular) gene or RNA or DNA sequence (including plasmids and viral vectors) into a host cell. so that the host cell expresses the introduced gene or sequence to produce the desired substance, typically a protein encoded by the gene or sequence.
- a host cell that receives and expresses the introduced DNA or RNA has been "transformed”.
- the construction of the vectors according to the invention and the transformation of the host cells can be carried out by conventional molecular biology techniques.
- the invention also relates to a peptide having an anti-inflammatory activity and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-Xi-X2-TL-X3-KKVG-X4-X5- Xfi-GKA-9 (SEQ ID NO: 29), wherein:
- -Xi is a residue W or A
- -Xi is a residue K or D; -X3 is an L or A residue;
- -X4 is a residue K, A or P;
- -3 ⁇ 4 is a residue A, K or D; - (p is X7-LNA (SEQ ID NO: 30), X 7 -LNAVTNX -A 8 (SEQ ID NO: 31), X -
- -Xe is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence encoding at least one of these peptides for use as a medicament.
- the peptide of the invention does not include SEQ ID NO: 2.
- the peptide for use as a drug has a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-G-IC-A ( SEQ ID NO: 33), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D; functional derivatives and pharmaceutically acceptable salts of said peptide, with the proviso that the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the peptide for use as a drug has a sequence of 21 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA-X7-LNA ( SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- - ⁇ is a residue A, EC or D;
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the peptide for use as a medicament has a sequence of 26 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA-X7-LNAVTN- X8-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- X is a residue A, K or D
- -X7 is a residue V or P; -Xs is a residue M or A;
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the peptide for use as a medicament has a sequence from 29 to 100 amino acids comprising the sequence G-X1-X2-X3-TL-KKVG- X 4 -Xs-X6-G- [CA- X7-LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 1), in which
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2, preferably a peptide having a sequence of 29 to 100 amino acids comprising the sequence SEQ ID NO: 3, 4, 5, 6, 7 or 8; or a nucleotide sequence coding for at least one of these peptides.
- the residue Xi is W in SEQ ID NOs 1 and 29 to 32
- the residue X2 is K in SEQ ID NOs 1 and 29 to 32
- the residue X3 is L in SEQ IDs. NOs 1 and 29 to 32
- the residue X * is K or A in SEQ ID NOs 1 and 29 to 32
- the residue Xs is V in SEQ ID NOs 1 and 29 to 32
- Xe is residue A SEQ ID NOs 1 and 29 to 32
- / or the residue X7 is V in SEQ ID NOs 1, 29, 31 and 32.
- the residue X9 represents the residue E and the residue X10 represents the residue Q in SEQ ID NO 1.
- the residue 3 ⁇ 4 does not represent any amino acid in SEQ ID NO 1.
- the Xio residue does not represent any amino acid in SEQ ID NO.
- the residue 3 ⁇ 4 is E and the residue Xio is absent in SEQ ID NO 1.
- the residue 3 ⁇ 4 represents the residue E and the residue Xio does not represent any acid amine in SEQ ID NO l.
- residues X9 and Xtone represent no amino acid.
- the invention also relates to a medicament comprising at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG -X4-X5-X6-GK-
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- - ⁇ is X7-LNA (SEQ ID NO: 30), Xv-LNAVTN-Xs-A (SEQ ID NO: 31), X7-LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 32), or is absent ; and wherein:
- -Xa is an M or A residue
- -X10 represents no residue or is a Q residue
- the peptide of the invention does not include SEQ ID NO: 2.
- the medicament comprises at least one peptide having anti-inflammatory activity and / or anti-microbial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-XI-X2-TL-3 ⁇ 4-KKVGX 4 -X5-X6-GKA (SEQ ID NO: 33), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- the medicament comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 21 to 100 amino acids comprising the sequence AL-X1OO-TL-X3-KKVG-X4- X5-X6-GK-A-X7-LNA (SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xs is a residue A, K or D;
- -X7 is a residue V or P; functional derivatives and pharmaceutically acceptable salts of said peptide, with the proviso that the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the medicament comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 26 to 100 amino acids comprising the AL-X1 sequence OTL-X3-KKVG-X4-V -X6-GKA-X7-LNAVTN-X8-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the medicament comprises at least one peptide having an anti-inflammatory and / or antimicrobial activity having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4 -X5-X6-GKA-X7-LN-AVTN-Xs-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2, preferably a peptide having a sequence of 29 to 100 amino acids comprising the sequence SEQ ID NO: 3, 4, 5, 6, 7 or 8; or a nucleotide sequence coding for at least one of these peptides.
- the present invention also relates to a composition comprising at least one peptide having an anti-inflammatory activity and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4 -X5-X0-G-
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X9 represents no residue or is a residue E
- -Xio represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the peptide of the invention does not include SEQ ID NO: 2.
- the composition comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG- X4-X5-X6-GKA (SEQ ID NO: 33), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the peptide of the invention does not comprise SEQ ID NO: 2.
- the composition comprises at least one peptide having anti-inflammatory and / or antimicrobial activity having a 21 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-Xfi-LNA (SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P
- -X5 is a residue V or A
- X is a residue A, K or D
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the peptide of the invention does not include SEQ ID NO: 2.
- the composition comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 26 to 100 amino acids comprising the sequence ALX 1 -X2-TL-X1-KKVG-X4 -XS-X6-GK-A-X7-LNAVTN-X8-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- -Xa is an M or A residue
- the peptide is not a peptide of sequence SEQ ID NO: 2; or a nucleotide sequence coding for at least one of these peptides.
- the composition comprises at least one peptide comprising a peptide having an anti-inflammatory and / or antimicrobial activity having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3- KKVG-X4-X5-X6-G-KA-X7-LNAVTN-Xs-ANQN-X9-X10 (SEQ ID NO: 1), in which:
- -Xi is a residue W or A; -X2 is a residue K or D;
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide is not a peptide of sequence SEQ ID NO: 2, preferably a peptide having a sequence of 29 to 100 amino acids comprising the sequence SEQ ID NO: 3, 4, 5, 6, 7 or 8; or a nucleotide sequence coding for at least one of these peptides.
- the invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising at least one peptide having an anti-inflammatory and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence A-L-X1-X2-T-L-X3-K-K-V-G-
- -Xi is a residue W or A; -X2 is a residue K or D;
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- X is a residue A, K or D
- - ⁇ is X7-LNA (SEQ ID NO: 30), X7-LNAVTN-X8-A (SEQ ID NO: 31), X7-LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 32), or is absent ; and wherein:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide of the invention does not include SEQ ID NO: 2.
- the composition comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG- X4-X5-X0-GKA (SEQ ID NO: 33), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- - ⁇ is a residue A, EC or D;
- the peptide is not a peptide of sequence SEQ ID NO: 2, or a nucleotide sequence coding for at least one of these peptides, and one or more pharmaceutically acceptable excipients .
- the pharmaceutical composition comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 21 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG -X4-X5-X0-G- KA-X7-LNA (SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X. is a residue K or D
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- - ⁇ is a residue A, EC or D;
- the peptide is not a peptide of sequence SEQ ID NO: 2, or a nucleotide sequence coding for at least one of these peptides, and one or more pharmaceutically acceptable excipients .
- the pharmaceutical composition comprises at least one peptide having anti-inflammatory activity and / or antimicrobial activity having a sequence of 26 to 100 amino acids comprising the sequence AL-XI-X 2 -TL-X3- KKVG-X4-X5-xo-G- KAX 7 -LNAVTN-Xs-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- the peptide is not a peptide of sequence SEQ ID NO: 2, or a sequence nucleotide encoding at least one of these peptides, and one or more pharmaceutically acceptable excipients.
- the pharmaceutical composition comprises at least one or more peptide comprising a peptide having an anti-inflammatory and / or antimicrobial activity having a sequence of 29 to 100 amino acids comprising the sequence AL-Xi-Xi.
- TL-Xs-KKVGX ⁇ Xs-Xe-GKA-XT-LNAVT-N-X8-ANQN-X9-X10 SEQ ID NO: 1
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -X10 represents no residue or is a Q residue
- peptide of sequence SEQ ID NO: 2 preferably a peptide having a sequence of 29 to 100 amino acids comprising the sequence SEQ ID NO: 3, 4, 5, 6 , 7 or 8, or a nucleotide sequence coding for at least one of these peptides, and one or more pharmaceutically acceptable excipients.
- the invention further relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence A-L-X1 -T-L1-K-K-V-G1-Xs-Xe-G-K-A1 (SEQ ID NO: 29), wherein:
- -Xi is a residue W or A
- -X4 is a residue K, A or P;
- -3 ⁇ 4 is a residue A, K or D; - (p is X7-L-N-A (SEQ ID NO: 30), XT-L-N-A-V-T-N-XS-A (SEQ ID NO: 31), X?
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide having a sequence of 17 to 100 amino acids comprising the sequence SEQ ID NO: 29 and functional derivatives and pharmaceutically acceptable salts of said peptide, is intended for use as an anti-inflammatory agent and / or immunosuppressive.
- the peptide having a sequence of 17 to 100 amino acids comprising the sequence SEQ ID NO: 29 and functional derivatives and pharmaceutically acceptable salts of said peptide, is intended for use as an anti-inflammatory agent and / or anti-angiogenic.
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X0-GKA (SEQ ID NO: 33) , in which :
- -Xi is a residue W or A
- -X4 is a residue K, A or P;
- the invention relates to a peptide having a 21 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNA ( SEQ ID NO: 34), wherein: -Xi is a residue W or A;
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- the invention relates to a peptide having a 26 to 100 amino acid sequence comprising the sequence AL-Xi-X 2 -TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN -X8-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue M or A
- the invention relates to a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN- X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A; -X2 is a residue K or D;
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- - ⁇ is a residue A, EC or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the residue Xi is W in SEQ ID NOs 1 and 29 to 32
- the residue X2 is K in SEQ ID NOs 1 and 29 to 32
- the residue Xs is L in SEQ IDs. NOs 1 and 29 to 32
- the residue X * is K or A in SEQ ID NOs 1 and 29 to 32
- the residue Xs is V in SEQ ID NOs 1 and 29 to 32
- the residue Xe is A in SEQs ID NOs 1 and 29 to 32
- / or the residue X7 is V in SEQ ID NOs 1, 29, 31 and 32.
- the residue X9 represents the residue E and the residue X10 represents the residue Q in SEQ ID NO 1.
- the Xs residue does not represent any amino acid in SEQ ID No. 1.
- the Xio residue does not represent any amino acid in SEQ ID NO.
- the residue 3 ⁇ 4 is E and the residue Xio is absent in SEQ ID NO 1.
- the residue X9 represents the residue E and the residue X10 does not represent any acid amine in SEQ ID NO l.
- residues X9 and X10 do not represent any amino acid.
- the peptide for use as an anti-inflammatory, immunosuppressive and / or anti-angiogenic agent is a peptide comprising a sequence selected from the group comprising or consisting of SEQ ID NO: 2, 3, 4, 5, 6, 7 or 8.
- the peptide for use as an anti-inflammatory and / or anti-angiogenic agent is a peptide comprising a sequence selected from the group comprising or consisting of SEQ ID NOs: 2, 3 sequences, 4, 5, 6, 7 or 8.
- the peptide as described above is useful as an immunosuppressive agent.
- the peptide as described above is used as an immunosuppressive agent.
- the peptide as described above is useful as an anti-inflammatory agent.
- the peptide as described above is used as an anti-inflammatory agent.
- the peptide as described above is useful as an anti-angiogenic agent.
- the peptide as described above is used as an anti-angiogenic agent.
- the peptide as described above is useful as an anti-inflammatory, immunosuppressive and anti-angiogenic agent, preferentially as an anti-inflammatory and immunosuppressive agent.
- the peptide as described above is used as an anti-inflammatory agent, immunosuppressant and anti-angiogenic, preferably as an anti-inflammatory and immunosuppressive agent.
- the invention relates to the peptide as described above for use in the prevention or treatment of an inflammatory disease, preferably a peptide having a sequence of 29 to 100 amino acids including SEQ ID NO: 1, preferably comprising a sequence selected from the group comprising or consisting of SEQ ID NOs: 2, 3, 4, 5, 6, 7 or 8 sequences.
- inflammatory disease refers to any disease in which an inflammatory reaction has pathological consequences for the body. Inflammatory diseases affect organs or tissues such as the digestive system, nervous system, skin, mucous membranes or joints, among others. For example, acute inflammatory diseases within the meaning of the invention include sepsis and septic shock.
- Chronic inflammatory diseases within the meaning of the invention include, but are not limited to, septicemia, septic shock, autoimmune diseases (such as lupus or rheumatoid arthritis), inflammatory heart diseases (carditis, and including endocarditis, pericarditis, myocarditis, especially endocarditis of infectious origin, such as those induced by Staphyfococcus aureus), transplant rejection, trauma, inflammatory joint disease (including various types of arthritis), inflammatory diseases of the gastrointestinal system (including colitis, enteritis, gastritis, gastroenteritis, inflammatory bowel disease (IBD) such as Crohn's disease and ulcerative colitis (UC)), inflammatory skin (including eczema, contact dermatitis, atopic dermatitis, psoriasis, rosacea, dermatoses), inflammatory diseases of the respiratory tract (not asthma, chronic bronchitis), inflammatory diseases of the eye (including conjunctivitis, episcle
- the inflammatory disease is an inflammatory disease of the skin or mucous membranes, in particular chosen from the group comprising or consisting of:
- infections of the skin or integuments especially chosen from the group comprising or consisting of folliculitis, furuncle, abscess, impetigo or paronychia;
- inflammatory dermatoses chosen especially from the group comprising or consisting of eczema, contact dermatitis, atopic dermatitis, rosacea or psoriasis;
- inflammatory pathologies of the eye and its appendages especially chosen from the group comprising or consisting of conjunctivitis, episcleritis, scleritis, keratitis, uveitis, blepharitis and stye.
- the inflammatory disease according to the invention is selected from the group consisting of or consisting of rosacea, psoriasis, eczema, contact dermatitis and impetigo.
- the inflammatory disease is due to or associated with an infection.
- the inflammatory disease is an inflammatory disease with an infectious component.
- the inflammatory disease is caused by or associated with at least one Gram + or Gram- type bacterium.
- the infectious component of the inflammatory disease is due to or associated with at least one bacterium selected from Gram + bacteria belonging to the genus Escherichia, Pseudomonas, Klebsiella, Salmonella, Yersinia, or Vibrio; and Gram-bacteria belonging to the genus Staphylococcus, Listeria, Serratia or Kocuria.
- the infectious component of the inflammatory disease is due to or associated with a bacterium belonging to the genus Staphylococcus, preferentially Staphylococcus aureus.
- the inflammatory disease is due to or associated with at least one fungus.
- the infectious component of the inflammatory disease is due to or associated with a fungus belonging to the genus Candida or Pityriasis.
- the invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising at least one peptide as described above, and one or more pharmaceutically acceptable excipients, for use in the prevention and / or treatment of an inflammatory disease.
- the invention also relates to a medicament comprising at least one peptide as described above for use in the prevention and / or treatment of an inflammatory disease.
- the composition, pharmaceutical composition or medicament of the present invention comprises a therapeutically effective amount of a peptide of the invention.
- the peptide, composition, pharmaceutical composition or drug of the present invention is used in combination with at least one other therapeutic agent to treat an inflammatory disease.
- NSAIDs nonsteroidal anti-inflammatory drugs
- anti-inflammatory steroids such as prednisone, dexamethasone, betamethasone, P hydrocortisone aceponate, clobetasol propionate
- monoclonal anti-inflammatories such as anti-TNF (eg adalimumab, golumumab).
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence A-L-Xi-X2-T-L-X3-K-K-V-G-X4-X5-X6-
- G- ⁇ - ⁇ - ⁇ (SEQ ID NO: 29), wherein: -Xi is a residue W or A; -X2 is a residue K or D;
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- - ⁇ is X7-LNA (SEQ ID NO: 30), X7-LNAVTN-X8-A (SEQ ID NO: 31), X-LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 32), or is absent ; and wherein:
- -X7 is a residue V or P; -Xs is a residue M or A;
- -X10 represents no residue or is a Q residue
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-CKVG-X4-X5-X6-G-EC-A (SEQ ID NO: 33), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- the invention relates to a peptide having a 21 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNA ( SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- the invention relates to a peptide having an anti-inflammatory activity and / or antimicrobial activity having a sequence of 26 to 100 amino acids comprising the sequence AL-X1 -TL-Xa-KKVGX ⁇ Xs- Xe-GKA-Xv-LNAVT-N-Xs-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- the invention relates to a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN- X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -Xi is a residue K, A or P
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the peptide as described above is useful for the prevention or treatment of a disease, wherein the prevention or treatment consists in simultaneously obtaining the following effects: i) an antimicrobial action, for example bacteriostatic, bactericidal, fungistatic or fungicidal; and
- the peptides of the invention when endowed with an antimicrobial and anti-inflammatory activity, have the advantage of being able to be administered to a patient suffering from an inflammatory disease, in particular an inflammatory disease due to or associated with an infection, without risk of masking the signs of the appearance or aggravation of an infection, unlike steroidal or nonsteroidal anti-inflammatory drugs.
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-Xi-X 2 -TL-X3-KKVG-X4-X1-X6-GK-A- (p ( SEQ ID NO: 29), wherein:
- -Xi is a residue W or A
- -X4 is a residue K, A or P;
- -3 ⁇ 4 is a residue A, K or D; - (p is X7-L-N-A (SEQ ID NO: 30), XT-L-N-A-V-T-N-XS-A (SEQ ID NO: 31), X?
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA (SEQ ID NO: 33) , in which :
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- a peptide having a sequence of 21 to 100 amino acids comprising the sequence AL-X1 -TL-Xa-KKVG1-Xs-Xe-GKA-Xv-LNA (SEQ ID NO: 34), in which :
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- the invention relates to a peptide having a 26 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-Xv-LNAVTN- Xs-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- a microbial infection in particular an infection due to to a microorganism such as a bacterium or a fungus.
- the invention relates to a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-XI-X2-TL-3 ⁇ 4-KKVG-X4-X5-X6-GK-A-X7-LNAVTN- X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- -Xa is an M or A residue
- -X10 represents no residue or is a Q residue
- the residue Xi is W in SEQ ID NOs 1 and 29 to 32
- the residue X2 is K in SEQ ID NOs 1 and 29 to 32
- the residue X3 is L in SEQ IDs. NOs 1 and 29 to 32
- the residue Xt is K or A in SEQ ID NOs 1 and 29 to 32
- the residue Xs is V in SEQ ID NOs 1 and 29 to 32
- the residue Xe is A in SEQ IDs NOs 1 and 29 to 32
- / or the residue X7 is V in SEQ ID NOs 1, 29, 31 and 32.
- the residue X9 represents the residue E and the residue X10 represents the Q residue in SEQ ID NO l.
- the X9 residue does not represent any amino acid in SEQ ID NO 1.
- the X10 residue does not represent any amino acid in SEQ ID NO.
- the residue X9 is E and the residue Xio is absent in SEQ ID NO. 1.
- the residue 3 ⁇ 4 represents the residue E and the residue Xio does not represent any amino acid in SEQ ID NO: 1.
- residues X9 and Xione represent no amino acid.
- the peptide for preventing and / or treating a microbial infection is a peptide comprising a sequence selected from the group consisting of or consisting of SEQ ID NOs: 2 to 8.
- the peptide as described above is useful for the treatment of a bacterial infection due to a bacterium belonging to the genus: Escherichia, Pseudomonas, Klebsiella, Salmonella, Yersinia, Vibrio, Staphylococcus, Bacillus , Listeria, Enterococcus, Kocuria, Serratia, Enterobacter, or Micrococcus.
- the peptide as described above is useful for the treatment of an infection at least due to a bacterium selected from the group comprising but not limited to, Staphylococcus aureus, Escherichia coli, Klebsiella oxytoca, Klebsiella pneumoniae Yersinia ruckeri, Staphylococcus epidermidis, Kocuria rhizophila, Bacillus subtilis, Clostridium difficile, Acinetobacter baumanii, Pneumococci, Serratia marcescens, Enterobacter aerogenes, Enterobacter cloacae, and Yersenia pestis.
- a bacterium selected from the group comprising but not limited to, Staphylococcus aureus, Escherichia coli, Klebsiella oxytoca, Klebsiella pneumoniae Yersinia ruckeri, Staphylococcus epidermidis, Kocuria rhizophila, Bacillus subtilis, Clo
- the peptide as described above is also useful for the treatment of a fungal infection due for example to a fungus belonging to the genus Candida, Tricophyton, Microsporum, Epidermophyton, or Aspergillus.
- the peptide as described above is useful for the treatment of an infection at least due to a fungus selected from groups including but not limited to Candida albicans, Candida glabrata or Pityriasis versicolor.
- the invention further relates to a medicament or a pharmaceutical composition comprising a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-Xi-X2-TL-X3-KKVG-X4-X5-X6-GKA-9 (SEQ ID NO: 29), wherein:
- -Xi is a residue W or A; -X2 is a residue K or D;
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- p is X7-LNA (SEQ ID NO: 30), XT-LNAVTN-XS-A (SEQ ID NO: 31), X7-LNAVTN-X8-ANQN-X9-X10 (SEQ ID NO: 32), or is absent, and in which:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the invention relates to a drug or pharmaceutical composition
- a drug or pharmaceutical composition comprising a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA (SEQ ID NO: 33), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xe is a residue A, K or D; functional derivatives and pharmaceutically acceptable salts of said peptide, for its use in the prevention and / or treatment of a microbial infection, in particular an infection due to a microorganism such as a bacterium or a fungus.
- the invention relates to a drug or pharmaceutical composition
- a drug or pharmaceutical composition comprising a peptide having a sequence of 21 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA -X7-LNA (SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- the invention relates to a drug or a pharmaceutical composition
- a drug or a pharmaceutical composition comprising a peptide having a sequence of 26 to 100 amino acids comprising the sequence AL-Xi-Xa-TL-Xa-KKVGX ⁇ Xs-Xe-GKA-Xv -LNAVT-N-Xs-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue M or A
- the invention relates to a medicament or a pharmaceutical composition
- a medicament or a pharmaceutical composition comprising a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-X1 -TL-X1-KKVGX-Xs-Xe-GKA-Xv -LNAVT-N-X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the invention relates to a peptide having an angiogenic activity having a sequence of 17 to 100 amino acids comprising the sequence A-L-X1-X2-T-L-X3-K-K-V-G-
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- - ⁇ is X7-L-N-A (SEQ ID NO: 30), Xv-L-N-A-V-T-N-Xs-A (SEQ ID NO: 31), X?
- -Xe is a residue M or A
- -X10 represents no residue or is a Q residue
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA (SEQ ID NO: 33) , in which :
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, EC or D; functional derivatives and pharmaceutically acceptable salts of said peptide, a pharmaceutical composition or a medicament comprising at least one such peptide, for the prevention and / or treatment of a disease related to angiogenesis.
- the invention relates to a peptide having a 21 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNA ( SEQ ID NO: 34), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- - ⁇ is a residue A, EC or D;
- the invention relates to a peptide having a 26 to 100 amino acid sequence comprising the sequence AL-XI-X 2 -TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN -X8-A (SEQ ID NO: 35), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- X is a residue A, K or D
- -X7 is a residue V or P; -Xs is a residue M or A;
- the invention relates to a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN- X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the invention relates to the peptide as described above for use in the prevention or treatment of a disease related to angiogenesis, preferably a peptide having a sequence of 29 to 100 amino acids comprising SEQ ID NO: 1, preferably comprising a sequence selected from the group consisting of or consisting of SEQ ID Nos: 2, 3, 4, 5, 6, 7 or 8 sequences.
- Angiogenesis is a complex process by which new vessels are formed, typically from the pre-existing vasculature. Angiogenesis plays a key role in some physiological processes such as the healing process of wounds. In addition to healing processes, many pathologies have been described as having a component or stage related to the phenomenon of angiogenesis.
- angiogenesis-related disease includes cancers, retinopathies-related ophthalmological disorders (including retinopathies and macular degeneration), atherosclerosis, osteoarthritis, rheumatoid arthritis, psoriasis, or pathologies related to delayed healing.
- the invention relates to a peptide, a pharmaceutical composition or a medicament as described above for the treatment of cancers, in particular for inhibiting tumor growth and / or the formation of metastases in cancer patients.
- angiogenesis is not only essential for the growth of a tumor but is also involved in the progression of the benign stage to the stage of invasive cancer.
- the possibility of inhibiting angiogenesis makes it possible to reduce tumor growth and metastatic progression of cancers.
- cancers include, but are not limited to, colon cancers; lung; pancreas; breast; kidney such as kidney cell carcinomas; skin such as basal cell carcinoma or melanoma; and glioblastoma.
- the peptide, the pharmaceutical composition or the drug of the invention are used to treat malignant tumors which induce the formation of new blood vessels.
- the peptide, the pharmaceutical composition or the drug according to the invention can be administered by injection, such as for example an intravenous, intramuscular, subcutaneous or direct injection into the tissue.
- the peptides of the invention are in an acceptable form for topical, systemic, oral, subcutaneous, intravitreous, intradermal, transdermal, intraperitoneal, intramuscular administration. or by inhalation.
- the pharmaceutical composition or the drug according to the invention may be in the form of tablets, capsules, capsules, granulates, suspensions, emulsions, solutions, gels, drops, pasta, ointments, creams, plasters, injectables, implants, patches.
- the pharmaceutical composition or the drug according to the invention may comprise one or more usual pharmaceutically acceptable excipients.
- the composition, pharmaceutical composition or medicament of the present invention comprises one or more pharmaceutically acceptable carriers for a formulation adapted for topical administration.
- the pharmaceutically acceptable excipients may in particular be any excipient among those known to those skilled in the art in order to obtain a composition for topical application in the form of a milk, a cream, a balm, d an oil, a lotion, a gel, a foaming gel, an ointment, or a spray.
- the excipients are chosen from the group consisting of an oil, a fat, an emulsion, a gel, an ointment, an excipient based on nanoparticles or liposomes.
- the oils may in particular be chosen from silicone oils, mineral oils (paraffin, petroleum jelly, etc.) or vegetable oils and fats.
- the pharmaceutical composition or the drug according to the invention can be prepared in the form of a water-in-oil (W / O) or oil-in-water (O / W) emulsion, a multiple emulsion, for example a water emulsion. in oil in water (E / HE) or an emulsion oil in water in oil (W / E / H), a microemulsion or in the form of a hydrodispersion or a lipodispersion, a gel or an aerosol.
- W / O water-in-oil
- O / W oil-in-water
- a multiple emulsion for example a water emulsion. in oil in water (E / HE) or an emulsion oil in water in oil (W / E / H), a microemulsion or in the form of a hydrodispersion or a lipodispersion, a gel or an aerosol.
- the composition, the pharmaceutical composition or the drug according to the invention comprises one or more pharmaceutically acceptable vehicles for a formulation suitable for oral administration.
- forms suitable for oral administration include, but are not limited to, tablets (including sustained release tablets), capsules, powders, granules, pills (including sugar-coated pills), capsules (including gelatin capsules flexible), oral suspensions, oral solutions, and other similar forms.
- the composition, pharmaceutical composition or medicament of the present invention comprises one or more pharmaceutically acceptable carriers for a formulation that can be injected.
- forms suitable for administration by injection include, but are not limited to, solutions aqueous steriles, dispersions, emulsions, suspensions, solid forms suitable for the preparation of solutions or suspensions by the addition of a liquid prior to use, such as, for example, powders.
- the pharmaceutical composition or the medicament according to the invention may also contain additives and formulation aids, such as emulsifiers, thickeners, gelling agents, water binders, spreading agents, stabilizers, dyes, perfumes and preservatives.
- additives and formulation aids such as emulsifiers, thickeners, gelling agents, water binders, spreading agents, stabilizers, dyes, perfumes and preservatives.
- the doses are adjusted according to the desired effect and the targeted pathology.
- the therapeutically effective amount is from about 1 to 10,000 mg / mL of peptide, composition, pharmaceutical composition, or drug of the invention, preferably from about 5 to about 5000 mg / mL, preferably about At about 2000 mg / mL, preferably from about 20 to about 100 mg / mL of peptide, composition, pharmaceutical composition or drug of the invention.
- the therapeutically effective amount is from about 1 to 10,000 mg / g of peptide, composition, pharmaceutical composition or drug of the invention, preferably from about 5 to about 5000 mg / g, preferably about At about 2000 mg / g, preferably from about 20 to about 100 mg / g of peptide, composition, pharmaceutical composition or drug of the invention.
- the therapeutically effective amount is from about 0.001 to 500 ⁇ of peptide, composition, pharmaceutical composition or rinenvention drug, preferably from about 0.01 to about 250 ⁇ , preferably from about 0.1 to about 200 ⁇ . ⁇ , preferably from about 0.5 to about 150 ⁇ , composition, pharmaceutical composition or drug of the invention.
- the therapeutically effective amount is from about 1 to 1000 ⁇ of peptide, composition, pharmaceutical composition, or drug of the invention, preferably from about 5 to about 500 ⁇ M, preferably from about 10 to about 250 ⁇ M. ⁇ , preferably from about 10 to about 150 ⁇ , composition, pharmaceutical composition or drug of the invention.
- the therapeutically effective amount is from about 1 to 100 ⁇ peptide, composition, pharmaceutical composition or drug of the invention, preferably from about 5 to about 75 ⁇ , preferably from about 10 to about 50 ⁇ .
- the therapeutically effective amount is from about 10 to 1000 ⁇ of the peptide, composition, pharmaceutical composition or drug of the invention, preferably from about 50 to about 750 ⁇ , preferably from about 100 to about 500 ⁇ . ⁇ .
- the total daily use of peptide, the composition, the pharmaceutical composition or the drug of the invention will be adjusted by the attending physician as part of his medical opinion.
- the therapeutically effective dose specific to each patient will depend on a variety of factors including the disorder being treated and its severity; the activity of the compound used; the specific composition used; age, weight, general health, sex and diet of the patient, duration and mode of administration; the duration of the treatment; drugs used in combination or coinciding with the compound used, and other similar factors known in the medical field. For example, it is common in this field to start with doses of compounds below the recommended doses to achieve the desired therapeutic effect and to gradually increase dosage until the effect is achieved.
- the daily dosage of the compounds may vary over a wide range from about 1 to about 10,000 mg per adult per day, preferably from about 5 to about 5000, preferably from about 10 to about 2000 mg, plus preferably from about 20 to about 100 mg per adult per day.
- the composition comprises 1, 10, 20, 50, 100, 250, 500, 1000 and 2000 mg of the active ingredient for the symptomatic adjustment of the dosage to be administered to the patient to be treated.
- a drug typically contains from about 1 to about 10,000 mg of active ingredient, preferably from 5 to 5000, preferably from 10 to 2000 mg of active ingredient.
- An effective amount of the drug is ordinarily provided at a dose of from about 0.01 mg / kg to about 100 mg kg of body weight per day, preferably from about 0.05 mg kg to about 40 mg / kg, preferably about 0.1 mg / kg to 20 mg / kg body weight per day, more preferably from about 0.2 to about 1 mg / kg body weight per day.
- the daily dose of the peptide of the invention, the composition, the pharmaceutical composition or the medicament of the present invention is adjusted as a function of the potential disorders in the organs and systems, such as, for example, renal, hepatic and / or haematological disorders of the subject.
- the peptide, composition, pharmaceutical composition or drug of the present invention is administered to the subject at least once a day.
- the peptide, composition, pharmaceutical composition or drug of the invention may be administered once daily, twice or three times daily.
- the peptide, the composition, the pharmaceutical composition or the drug of the invention is administered once a day.
- the peptide, composition, pharmaceutical composition or drug of the present invention is administered to the subject at least once a week.
- the peptide, composition, pharmaceutical composition or drug of the invention may be administered once a week, twice, three times, four times or up to seven times a week.
- the invention also relates to a method for preventing and / or treating an inflammatory disease in a subject in need thereof, comprising administering an effective therapeutic dose of at least one peptide, drug or pharmaceutical composition according to the invention.
- the method of the invention for treating an inflammatory disease comprising administering to a therapeutically effective amount of a peptide of the invention as described above, preferably a peptide having a sequence. from 29 to 100 amino acids comprising the sequence SEQ ID NO: 2, 3, 4, 5, 6, 7 or 8.
- the peptide, composition, pharmaceutical composition or drug of the invention is administered to the subject.
- the peptide, drug or pharmaceutical composition according to the invention is administered to a subject suffering or likely to suffer from an inflammatory disease.
- the subject is a subject at risk for the occurrence of an inflammatory disease.
- the subject has not yet been treated with another treatment for the inflammatory disease of the invention. In another embodiment, the subject has already been treated with another treatment for the inflammatory disease of the invention.
- the invention further relates to a method for preventing and / or treating a microbial infection comprising administering an effective therapeutic dose of at least one peptide, drug or pharmaceutical composition according to the invention.
- the method of the invention for treating a microbial infection comprising administering to a therapeutically effective amount of a peptide of the invention as described above, preferably a peptide having a sequence of from 29 to 100 amino acids comprising the sequence SEQ ID NO: 2, 3, 4, 5, 6, 7 or 8.
- the microbial infection is a bacterial or fungal infection as described above.
- the peptide, drug or pharmaceutical composition according to the invention is administered to a subject suffering or likely to suffer from microbial infection.
- the subject is a subject at risk for the occurrence of a microbial infection.
- the subject has not yet been treated with another treatment for microbial infection according to the invention. In another embodiment, the subject has already been treated with another treatment for microbial infection according to the invention.
- the invention further relates to a method for preventing and / or treating a disease related to angiogenesis comprising administering an effective therapeutic dose of at least one peptide, drug or pharmaceutical composition according to the invention .
- the method of the invention for treating an angiogenesis-related disease comprising administering to a subject a therapeutically effective amount of a peptide of the invention as described above, preferably a peptide having a sequence of 29 to 100 amino acids comprising the sequence SEQ ID NO: 2, 3, 4, 5, 6, 7 or 8.
- the peptide, drug or pharmaceutical composition according to the invention is administered to a subject suffering or likely to suffer from a disease related to angiogenesis.
- the subject is a subject at risk for the occurrence of a disease related to angiogenesis.
- the subject has not yet been treated with another treatment for the angiogenesis-related disease of the invention.
- the subject has already been treated with another treatment for the angiogenesis-related disease of the invention.
- Another subject of the invention relates to the use of a peptide having a sequence of 17 to 100 amino acids comprising the sequence A-L-X1-X2-T-L-X3-K-K-V-G-X4-X5-X6-G-K-
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- - ⁇ is ⁇ -L-N-A, XT-L-N-A-V-T-N-XS-A, X7-L-N-A-V-T-N-X8-A-N-Q-N-X9-X10, or is absent; and wherein:
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- peptide is not a peptide of sequence SEQ ID NO: 2, as antifungal or antibacterial agent.
- the invention relates to a peptide having a sequence of 17 to 100 amino acids comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA (SEQ ID NO: 30) , in which : -Xi is a residue W or A;
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- peptide is not a peptide of sequence SEQ ID NO: 2, as antifungal or antibacterial agent.
- a peptide having a 21 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GKA-X7-LNA (SEQ ID NO: 31) , in which :
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- - ⁇ is a residue A, K or D;
- peptide is not a peptide of sequence SEQ ID NO: 2, as antifungal or antibacterial agent.
- the invention relates to a peptide having a 26 to 100 amino acid sequence comprising the sequence AL-X1-X2-TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN- X8-A (SEQ ID NO: 32), wherein:
- -Xi is a residue W or A; -X2 is a residue K or D;
- -X3 is an L or A residue
- -X4 is a residue K, A or P;
- -Xs is a residue V or A
- -Xe is a residue A, K or D;
- -Xs is a residue M or A
- peptide is not a peptide of sequence SEQ ID NO: 2, as antifungal or antibacterial agent.
- the invention relates to a peptide having a sequence of 29 to 100 amino acids comprising the sequence AL-XI-X 2 -TL-X3-KKVG-X4-X5-X6-GK-A-X7-LNAVTN -X8-ANQN-X9-X10 (SEQ ID NO: 1), wherein:
- -Xi is a residue W or A
- -X2 is a residue K or D
- -X4 is a residue K, A or P;
- X is a residue A, K or D
- -Xs is a residue M or A
- -X10 represents no residue or is a Q residue
- the residue Xi is W in SEQ ID NOs 1 and 29 to 32
- the residue 3 ⁇ 4 is K in SEQ ID NOs 1 and 29 to 32
- the residue X3 is L in SEQ IDs.
- the residue X * is K or A in SEQ ID NOs 1 and 29 to 32
- the residue Xs is a residue V in SEQ ID NOs 1 and 29 to 32
- the residue Xe is A in SEQ ID NOs 1 and 29 to 32
- / or the residue X7 is V in SEQ ID NOs 1, 29, 31 and 32.
- the residue X 9 represents the residue E and the residue X10 represents the Q residue in SEQ ID NO 1.
- the X9 residue does not represent any amino acid in SEQ ID NO 1.
- the X10 residue does not represent any amino acid in SEQ ID NO.
- the residue X9 is E and the residue X10 is absent in SEQ ID NO 1.
- the residue X9 represents the residue E and the residue X10 does not represent any acid amine in SEQ ID NO l.
- residues X9 and Xione represent no amino acid.
- the peptide as described above is used for the preparation of antifungal or antibacterial formulation.
- the peptide as described above is especially used to disinfect surfaces (for example walls, doors, medical equipment), a liquid (for example water) or a gas (for example a gas). anesthetic).
- the present invention also relates to a kit comprising a peptide according to the invention, a nucleic acid, a vector, a composition, a pharmaceutical composition or a medicament as described above.
- the kit also comprises an apparatus for administering the peptide, nucleic acid, vector, composition, pharmaceutical composition or drug to a subject.
- the kit further comprises the instructions for administering the peptide, nucleic acid, vector, composition, pharmaceutical composition or drug to said subject.
- the kit comprises an additional therapeutic agent.
- the additional therapeutic agent is another agent for the treatment of the inflammatory disease according to the invention.
- the additional therapeutic agent is another agent for the treatment of the microbial infection according to the invention.
- Figure 1 shows the survival of neutrophils (A), T lymphocytes (B), monocytes (C) and murine and human NK (D) cells in the presence of increasing concentrations of DA2N and DA2NEQ, as a percentage of the number of living cells in the absence of peptide.
- Figure 2 shows the survival of murine and human non-immune cells (epithelial cells) in the presence of increasing concentrations of DA2N and DA2NEQ peptide, as a percentage of the number of living cells in the absence of peptide.
- Figure 3 shows the hemolytic activity of DA2N and DA2NEQ at 10 ⁇ and 50 ⁇ , on human erythrocytes, as a percentage relative to the positive control consisting of Triton XI 00 (100%).
- Figure 4 shows the number of immune cells in the peritoneal cavity 36 hours after 3 regular intraperitoneal (ip) injections of the DA2N peptide (dark gray) or DA2NEQ (light gray) in a mouse model of ip-induced peritonitis. thioglycolate 3%.
- the negative control with respect to the peptide consists of the injection of 0.15M NaCl in place of the solution containing the peptide (in black).
- Control of the induction of peritonitis consists of mice not induced for peritonitis (in white); i.p injection of NaCl.
- Figure 5 shows the protocol used to test the effectiveness of peptides in a model of contact eczema.
- Figure 6 shows the relative change in ear thickness in a mouse model of DNCB1% induced contact eczema after administration of DA2N (A) or DA2NEQ (B).
- the control of induction of contact eczema corresponds to mice not treated with the DNCB1% (line with triangle symbol) and the negative control corresponds to mice treated with DNCB1% without peptide (line with square symbol).
- Figure 7 shows, in a murine model of contact eczema, the effect of DA2N administration on the number of immune cells (A) at the ear, (B) in the general circulation and (C) ) in the spinal cord, after induction of contact eczema by application of DNCB1% (in light gray).
- the control of induction of contact eczema corresponds to mice not treated with DNCB1% (in white) and the negative control corresponds to mice treated with DNCB1% without peptide (in dark gray).
- Figure 8 shows representative images of the effect of topical application of DA2N and DA2NEQ peptides in Balb / c mice on psoriatic skin lesions.
- the images in the left column represent the results on psoriatic skin (skin treated with Imiquimod for 6 days): positive control without peptide application (A), application of the DA2N peptide (B) and application of the DA2NEQ peptide (C).
- the images in the right column show the results on healthy skin (without Imiquimod treatment): negative control without peptide application (A), application of the DA2N peptide (B) and application of the DA2NEQ peptide (C).
- Figure 9 shows an enlargement at the treated regions representative of the skin lesions presented in Figure 8.
- Figure 10 shows representative images of the effect of topical application of the DA2N and DA2NEQ peptides on the angiogenesis conventionally observed in BALB / C mice at the level of psoriatic lesions.
- the images in the left column represent the results on psoriatic skin (skin treated with Imiquimod for 6 days): positive control without peptide application (A), application of the DA2N peptide (B) and application of the DA2NEQ peptide (C).
- the images in the right column show the results on healthy skin (without Imiquimod treatment): negative control without peptide application (A), application of the DA2N peptide (B) and application of the DA2NEQ peptide (C).
- Figure 11 shows representative images of aortic rings and neovascular formation after 3 days of treatment with PBS (A), DA2N (B), DA2NEQ (C).
- Figure 12 shows the inhibition of neovascular formation over time on mouse aortas after addition of DA2N and DA2NEQ at a concentration of 12.5 ⁇ , in percentage relative to the initial diameter of the aortic rings.
- Figure 13 shows the survival of mouse bone marrow cells after 2 hours of incubation in the presence of the DA2N, DA2NE, N (D), DA2Na, K12A peptides at a concentration of 12.5 ⁇ or 25 ⁇ , as a percentage of the number of initial living cells.
- the positive and negative controls consist, respectively, in incubating the cells in the presence of 30% DMSO or PBS.
- Figure 14 shows the survival of murine non-immune cells (epithelial cells) in the presence of increasing concentrations of DA2N, K12A and DA2Na.
- DA2N, DA2Na, and K12A induce the death of 50% of murine bone marrow immune cells (LC50) at a concentration of 5 ⁇ , 3.75 ⁇ , and 6.5 ⁇ , respectively.
- LC50 murine bone marrow immune cells
- Figure 15 shows the hemolytic activity of the peptides DA2Na and K12A at 10 ⁇ and 50 ⁇ on mouse erythrocytes, in percentage relative to the positive control, consisting of Triton X100 (100%).
- the peptides used in the examples were synthesized in FMOC / tBu strategy on a solid support by an Activo Pli automatic synthesizer (Activotec). The purification is carried out by HPLC (Waters, Cl 8 column) and the identity of the peptides is verified by MALDI-TOF spectrometry (MS Voyager Applied Biosystems). Due to the presence of a tryptophan residue in the sequence, the concentrations of the solutions are determined by UV spectroscopy (Nanodrop, Labtech.com).
- cytotoxic effects of DA2N SEQ ID NO: 4
- DA2NEQ SEQ ID NO: 2
- mice The immune cells of mice are derived from the bone marrow of C57BL6 mice. Human immune cells were purified from whole blood from healthy donors (blood bank, IMSS, Cuernavaca, Mexico).
- non-immune cells were removed after sacrifice of C57BL6 mice or in surgery: epithelial cells, adipocytes, hepatocytes.
- the peptides are incubated at 37 ° C, 5% CO 2 in the presence of 500,000 immune or non-immune cells in RPMI medium at various concentrations and at various times. Cells without peptides serve as a negative control and cells incubated for 5 min at 50 ° C or in the presence of DMSO (30%) serve as a positive control. After incubation, the cells are washed and then labeled with propidium iodide to measure cell viability. Cell viability is analyzed by counting or flow cytometry in the presence of antibodies coupled to fluorochromes corresponding to markers characteristic of each cell population. The CLso is then calculated as the concentration of the DA2N and DA2NEQ peptides inducing the death of 50% of each of the immune cell populations.
- Cytometry data processing is performed with FlowJo software.
- Table 1 shows the concentrations of the DA2N and DA2NEQ peptides inducing the death of 50% of murine and human immune cells (CL 50).
- Table 1 CL50 on immune cells.
- Escherichia coli ATCC 8739, ATCC ML35p and P7 ESBL
- Pseudomonas aeruginosa ATCC 9027 and ATCC 27853
- Klebsiella oxytoca CIP 7932
- Klebsiella pneumoniae CIP 52.211
- Sahnonella enterica CIP 8297
- Yersinia ruckeri ATCC 29473
- Vibrio parahemolyticus IREMER 01 01/252
- Staphylococcus aureus ATCC 6538, ST 1065 and MRSA
- Staphylococcus epidermidis BM 3302
- Listeria monocytogenes SOR 100
- Enterococcus faecalis CIP A186, CIP 103015)
- Kocuria rhizophila ATCC 9341
- Lactococcus garviae ATCC 43921
- Bacillus subtilis CIP 52.65).
- a preculture of 5 ml in LB medium is prepared by seeding of a colony of the bacterial strain of interest.
- the preculture is incubated at 37 ° C with stirring overnight.
- the culture is subcultured (30 ⁇ ) in 5 ml.
- the concentration of the culture is evaluated by measuring the optical density at 620 nm. The concentration is adjusted by dilution so as to obtain a suspension at an OD of 0.05 at 620 nm.
- the MIC is determined by a growth inhibition test in a liquid medium. MIC is defined as the lowest concentration of peptide capable of inhibiting the growth of the bacterial strain tested after 18 h incubation at 37 ° C. The test was performed in a sterile microtiter plate containing 96 wells. A range of increasing concentrations of each peptide (0.2 to 100 ⁇ l) was previously prepared in sterile MilliQ water. In each well, 10 of peptide were incubated with 90 ⁇ l of bacterial suspension (10 7 cfu / ml) in LB medium without yeast extract. The microplate was incubated at 37 ° C for 18h. Bacterial growth was assessed by measuring the OD at 620 nm using a plate reader.
- the negative growth inhibition control was obtained by replacing the solution containing the peptide with sterile MilliQ water.
- the positive control for completely inhibiting the growth of bacterial strains was obtained by replacing the solution containing the peptide with formaldehyde.
- - OD of the Tioo OD of the growth control (bacterial suspension without test sample, 100% growth),
- CMB Minimal Bactericidal Concentration
- CMB is defined as the minimum peptide concentration that does not leave surviving bacteria in the inoculum after incubation at 37 ° C for 24 hours. This test consists in spreading the contents of the wells where the peptide inhibited the bacterial growth on a Petri dish (LB agar), then incubation for 24 hours at 37 ° C. The inhibition is said to be bacteriostatic when the peptide inhibits bacterial growth but does not lyse bacteria and is said to be bacteriolytic when the peptide has completely lysed the bacteria and thus prevents the regrowth of bacteria in the culture medium after transplanting. .
- Table 2 Antimicrobial Activities of DA2N and DA2NEQ.
- the haemolytic activity of antimicrobial peptides has been demonstrated using murine or human red blood cells from healthy adult donors.
- Mouse or donor blood is washed three times in 10 volumes of PBS at 4 ° C by centrifugation at 800 xg for 10 minutes.
- the blood pellet is finally diluted to 4% (v / v) in PBS buffer.
- the test was carried out as follows: either 10 ⁇ , 50 ⁇ peptide were added to 100 ⁇ ⁇ suspension of red blood cells.
- the negative control for this test (0% hemolysis) contains 5 ⁇ l of PBS buffer instead of the solution containing the peptide and the positive control (100% hemolysis) contains 5 ⁇ l of Triton XI 00 1%. instead of the solution containing the peptide.
- Mouse erythrocytes are derived from the bone marrow of C57BL6 mice.
- Human erythrocytes were purified from whole blood from healthy donors (blood bank, IMSS, Cuernavaca, Mexico).
- the peptides are incubated at 37 ° C., 5% CO 2 in the presence of 500,000 erythrocytes in RPMI medium at various concentrations and at various times. Cells without peptides serve as a negative control and cells incubated for 5 min at 50 ° C or in the presence of DMSO (30%) serve as a positive control.
- the CLso is then calculated as the concentration of the DA2N and DA2NEQ peptides inducing the death of 50% of the erythrocytes.
- Figure 3 shows the percentage of hemolysis of human erythrocytes by the peptides DA2N and DA2NEQ, relative to the positive control in reference to 100%. The results show that the DA2N and DA2NEQ peptides do not cause haemolysis of human erythrocytes (FIG. 3) or murine erythrocytes (results not shown). Table 3 shows the concentrations of the DA2N and DA2NEQ peptides inducing the death of 50% of human and murine erythrocytes (CL 50).
- the anti-inflammatory activity of DA2N and DA2NEQ was evaluated in a murine model of non-infectious peritonitis.
- Non-infectious peritonitis is induced by intraperitoneal injection of 3% thioglycolate.
- Six hours after the induction of peritonitis three intraperitoneal injections of peptide (90 ⁇ g / injection / mouse) were made at regular intervals (every 6 hours). At 36h, the mice are sacrificed to observe the recruitment of immune cells into the peritoneal cavity.
- the cells obtained from washing the peritoneal cavity are washed and then labeled with propidium iodide in order to measure cell viability as well as in the presence of antibodies coupled to fluorochromes corresponding to markers characteristic of each population. cellular.
- the evaluation of the anti-inflammatory potential is based on the measurement of the number of neutrophils, monocytes and macrophages recruited in the murine peritoneal cavity.
- the negative control with respect to the peptide for this test consists of 50 ⁇ l of 0.15M NaCl by injection in place of the solution containing the peptide.
- Control of induction of peritonitis consists of mice not induced for peritonitis. Data processing is realized with FlowJo software.
- Figure 4 shows the number of immune cells in the peritoneal cavity in the murine model of thioglycolate peritonitis, and thus the effect of DA2N and DA2NEQ in a model of inflammatory disease.
- the results show that, in vivo, the peptides cause a decrease in the recruitment of neutrophils and monocytes / macrophages in the peritoneal cavity after induction of peritonitis.
- the peptides of the invention therefore have an anti-inflammatory activity.
- the study is conducted to determine the activity of peptides DA2N (SEQ K> NO: 4) and DA2NEQ (SEQ ID NO: 2) with respect to contact sensitization.
- Mice are sensitized with 1% DNCB for 5 days.
- 30 ⁇ l of a mixture of olive oil / acetone (vehicle) 1: 1 in which are dissolved 50 ⁇ g of peptide DA2N or DA2NEQ is applied at the level of the ear.
- the contact reaction is caused by re-exposure to 1% DNCB at the ear.
- the intensity of the inflammatory reaction is evaluated locally 24, 48, 72 and 96 hours after re-exposure to DNCB by measuring the thickness of the ear. Moreover, the number of immune cells (dendritic cells, T cells, neutrophils, monocytes, macrophages) is measured 24h after DNCB re-exposure in the ear at the DNCB 1% application site (number of immune cells counted in the 2 ears), in the blood (number of immune cells counted in 50 ⁇ LL of blood) and in the bone marrow (number of immune cells counted in a tibia).
- the protocol is shown schematically in Figure 5.
- the ears are digested by addition of collagenase IV and the number of immune cells is determined by flow cytometry using antibodies coupled to fluorochromes corresponding to markers characteristic of each cell population.
- the negative control of inhibition of the contact reaction was obtained by replacing the solution containing the peptide with the 1: 1 olive oil / acetone solution (indicated as "vehicle” in FIG. 6, and with the symbol "-" in Figure 7).
- Figure 7 shows a decrease in the number of monocytes, dendritic cells and neutrophils, either at the level of the ear (Figure 7A), in the blood ( Figure 7B) or in the bone marrow ( Figure 7C). mouse after topical application of DA2N.
- the peptides of the invention therefore have an anti-inflammatory effect in an in vivo model of inflammatory disease.
- DA2N and DA2NEQ peptides were tested in an Imiquimod-induced psoriasis model described by Van der Fits (Van der Fits et al., Journal of Immunology, 182 (9): 5836-5845) on female Balb / c mice. , 7 to 8 weeks old.
- 31 mg of commercial cream containing 5% Imiquimod (Aldara, 3M Pharmaceuticals) is applied topically to approximately 2.5 cm of the ventral portion shaved beforehand of the mice for 6 days.
- the first psoriatic lesions appear on the 3rd day.
- the peptides resuspended in the cream are applied topically or intravenously (10 ⁇ g) during the first 3 days of treatment with Imiquimod.
- Mice without Imiquimod treatment and / or without application of the peptides were used as controls.
- the mice are sacrificed and the skin removed is analyzed by microscopy (cutaneous lesions and angiogenesis). 6.2 Results
- Figures 8 and 9 show representative images of a topical treatment with DA2N and DA2NEQ at a dose of 10 ⁇ on psoriatic lesions induced by application of Imiquimod for 6 days.
- DA2N reduces the psoriatic lesions conventionally observed after 6 days of treatment with Irniquimod.
- DA2N and DA2NEQ have no effect on healthy skin.
- DA2N and DA2NEQ peptides were tested on the model of the aorta rings which allows to study the influence of various molecules on the formation of new blood vessels.
- Aortas from C57BL / 6 or Balb / c mice are removed, washed with PBS and then cut into rings.
- the rings are then deposited in a Matrigel matrix (BD® Matrigel TM) in 24-well plates, incubated for 1 h at 37 ° C., 5% CO 2, before adding 1 ml of DMEM (DMEM Advanced IX, Gibco) supplemented. with 5% fetal calf serum (S VF), 2 ⁇ glutamine, 100 U penicillin and 50 ⁇ g / ml streptomycin.
- DMEM DMEM Advanced IX, Gibco
- S VF fetal calf serum
- the rings are then incubated at 37 ° C, 5% CO2 for 3 days.
- the medium is then removed and replaced with medium containing or not the peptides at a concentration of 12.5 ⁇ M.
- the aortic rings are again incubated for 3 days under the same conditions. Photos of the rings are made daily to measure the formation of neo-vessels.
- the image processing and the measurement of the area formed by the neo-vessels are realized by the software Image J 1.50i.
- Figure 10 presents representative images of a topical treatment with DA2N and DA2NEQ at a dose of 10 ⁇ g on angiogenesis, conventionally observed after application of Imiquimod for 6 days.
- DA2N and DA2NEQ appear to decrease neovascular formation after 6 days of Irniquimod treatment.
- DA3N and DA2NEQ have no effect on angiogenesis on healthy skin.
- Figure 11 shows representative images showing the formation of neo-vessels (angiogenesis) at 0, J1, J2 and J3 from aortic rings after addition of DA2N or DA2NEQ at 0.
- the control corresponds to the formation of neovessels, after addition of PBS only.
- Figure 12 shows the formation of neovessels as a percentage of the initial diameter of the aortic annulus. Compared to the control (PBS), the addition of DA2N or DA2NEQ significantly inhibits the formation of neovessels.
- Example 8 In vitro study of the immunosuppressive activity of DA2NE, DA2N (D), K12A and DA
- DA2NE SEQ ID NO: 3
- D DA2N
- K12A SEQ ID NO: 11
- DANa DANa
- mice The immune cells of mice are derived from the bone marrow of C57BL / 6 or Balb / c mice.
- the peptides are incubated at 37 ° C., 5% CO 2 in the presence of 500,000 immune cells in RPMI medium at various concentrations for 2 hours. Cells without peptide serve as a negative control and cells in the presence of DMSO (30%) serve as a positive control. After incubation, the cells are washed and then labeled with Trypan blue to measure cell viability by counting under a microscope. The LC 50 is then calculated as the concentration of the peptides DA2N, Kl 2 A and DANa inducing the death of 50% of the immune cells.
- the survival of immune cells derived from mouse bone marrow in the presence of DA2NE, DA2N (D), K12A and DANa peptides at 12.5 and 25 ⁇ concentrations is shown in Figure 13 and compared to DA2N.
- the DA2NE, DA2N (D), K12A and DANa peptides appear to induce immune cell death at a concentration of 12.5 ⁇ M with efficacy comparable to DA2N.
- DA2N, DA2Na and Kl2A induce the death of 50% of murine bone marrow immune cells (CL 50) at a concentration of 5 ⁇ M, 3.75 ⁇ M and 6.5 ⁇ M, respectively.
- the haemolytic activity of the antimicrobial peptides was measured according to the protocol set out in part 3.1 of Example 3.
- Figure 15 shows the percentage of hemolysis of mouse erythrocytes after incubation with the peptides for 1 hour, relative to the positive control in reference to 100%. The results show that the DA2Na and K12A peptides do not show significant haemolytic activity (less than 40% haemolysis) at concentrations of 10 and 50 ⁇ ).
- Example 10 In vitro study of the antimicrobial activity of DA2NE, DA2Na, K4D, L7A, K12A, K12P, V13A, A14D, A14K, M25A, DA2NEQ (D) and DA2N (D)
- DA2N SEQ ID NO: 4
- DA2NEQ SEQ ID NO: 2
- DA2NE SEQ ID NO: 3
- DA2Na SEQ ID NO: 7
- K4D SEQ ID NO: 13
- L7A SEQ ID NO: 14
- K12A SEQ ID NO: 11
- K12P SEQ ID NO: 12
- V13A SEQ ID NO: 17
- A14D SEQ ID NO: 10
- A14K SEQ ID NO: 8
- M25A SEQ ID NO: 16
- DA2NEQ D
- SEQ ID NO: 18 DA2N
- D DA2N
- ScrL NLGAKNQVAWEKKAATTKGNVNLKLLQMVAV; SEQ ID NO: 37
- ScrC KGNVLVKAAMLTKVLAKNKGVQNANALTW; SEQ ID NO: 38
- the MIC and CMB were determined according to the protocol set out in part 2.1 of Example 2.
- Example 2 Table 2 which demonstrate that DA2N and DA2NEQ exhibit antimicrobial activity on Gram-positive and Gram-negative bacteria.
- DA2NE, DA2Na, K4D, L7A, K12A, K12P, V13A, A14D, A14K, M25A, DA2NEQ (D) and DA2N (D) is shown in Table 5:
- Table 5 Antimicrobial Activities of DA2NE, DA2Na, K4D, L7A, K12A, K12P,
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Communicable Diseases (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Oncology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Transplantation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR1663231A FR3061178B1 (fr) | 2016-12-22 | 2016-12-22 | Peptides antimicrobiens et leurs utilisations |
| PCT/FR2017/053835 WO2018115798A1 (fr) | 2016-12-22 | 2017-12-22 | Peptides antimicrobiens et leurs utilisations |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP3559025A1 true EP3559025A1 (fr) | 2019-10-30 |
Family
ID=58645166
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP17838052.3A Withdrawn EP3559025A1 (fr) | 2016-12-22 | 2017-12-22 | Peptides antimicrobiens et leurs utilisations |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20230192772A1 (fr) |
| EP (1) | EP3559025A1 (fr) |
| FR (1) | FR3061178B1 (fr) |
| MX (1) | MX2019007390A (fr) |
| WO (1) | WO2018115798A1 (fr) |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2365099C (fr) * | 1999-03-17 | 2012-05-29 | University Of Victoria Innovation And Development Corporation | Plantes transgeniques resistant a une large variete de pathogenes |
| AU2007230887A1 (en) * | 2006-03-23 | 2007-10-04 | Amylin Pharmaceuticals, Inc. | Endothelin and endothelin receptor agonists in the treatment of metabolic diseases |
| FR2947455B1 (fr) * | 2009-07-01 | 2014-01-03 | Centre Nat Rech Scient | La dermaseptine b2 comme inhibiteur de la croissance tumorale |
| WO2013039861A2 (fr) * | 2011-09-12 | 2013-03-21 | modeRNA Therapeutics | Acides nucléiques modifiés et leurs procédés d'utilisation |
-
2016
- 2016-12-22 FR FR1663231A patent/FR3061178B1/fr not_active Expired - Fee Related
-
2017
- 2017-12-22 MX MX2019007390A patent/MX2019007390A/es unknown
- 2017-12-22 US US16/472,447 patent/US20230192772A1/en not_active Abandoned
- 2017-12-22 WO PCT/FR2017/053835 patent/WO2018115798A1/fr not_active Ceased
- 2017-12-22 EP EP17838052.3A patent/EP3559025A1/fr not_active Withdrawn
Also Published As
| Publication number | Publication date |
|---|---|
| FR3061178B1 (fr) | 2021-02-12 |
| WO2018115798A1 (fr) | 2018-06-28 |
| FR3061178A1 (fr) | 2018-06-29 |
| MX2019007390A (es) | 2019-12-05 |
| US20230192772A1 (en) | 2023-06-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP4129318A1 (fr) | Composition pharmaceutique à base de protéines à activité neuroprotectrice, immunomodulatrice, anti-inflammatoire et antimicrobienne | |
| WO2013100721A1 (fr) | Nouveau peptide antibactérien et fongicide dans lequel les résidus de lysine et de tryptophane sont répétés quatre fois, et utilisation de celui-ci | |
| Kosikowska et al. | Synthesis and evaluation of biological activity of antimicrobial–pro-proliferative peptide conjugates | |
| Húmpola et al. | Biological and structural effects of the conjugation of an antimicrobial decapeptide with saturated, unsaturated, methoxylated and branched fatty acids | |
| EP1879654B1 (fr) | Combinaison pharmaceutique comprenant un agent antifongique et un actif qui est notamment l'eugénol ou le carvacrol | |
| FR2766191A1 (fr) | Peptides anti-microbiens de crustaces | |
| CA2755472C (fr) | Analogues de la temporine-sha et leurs utilisations | |
| WO2014107042A1 (fr) | Nouveau peptide antibiotique dérivé de la protéine ribosomique l1 de la bactérie helicobacter pylori, et son utilisation | |
| EP1519951B1 (fr) | Peptides lineaires cationiques ayant des proprietes antifongiques | |
| EP3559025A1 (fr) | Peptides antimicrobiens et leurs utilisations | |
| WO2000032237A1 (fr) | Composition pharmaceutique comprenant un agent anti-cancereux et au moins un peptide | |
| FR2695392A1 (fr) | Peptides possédant notamment des propriétés antibactériennes, leur procédé d'obtention, et leurs applications biologiques. | |
| CN114650835A (zh) | 高效杀灭耐药病害菌的药物及在抑制耐药病害菌中的应用 | |
| EP2197899B1 (fr) | Peptides cycliques comprenant au moins un residu aza-beta-3 aminoacycle et leurs utilisations | |
| WO2002085934A2 (fr) | Peptides antibacteriens, les compositions les contenant et leurs utilisations | |
| Wang et al. | A novel antimicrobial peptide AH-12 attenuates mitochondrial response to inflammatory stimuli and prevents periodontitis via antibacterial and anti-inflammatory effects | |
| EP1601768B1 (fr) | Peptide antimicrobien appele halocyntin, gene codant ledit peptide, vecteur, organisme transforme et composition le contenant. | |
| EP1299416A2 (fr) | Peptides antifongiques et/ou antibacteriens, leurs preparations et les compositions les contenant | |
| JP2025525682A (ja) | 抗菌ペプチド化合物及び使用方法 | |
| CA3049714A1 (fr) | Peptide immunomodulateur | |
| FR2992319A1 (fr) | Peptides cycliques incluant alpha-amino et aza-beta 3 aminoacide en tant que fongicides | |
| WO2003095482A2 (fr) | Nouveaux peptides cycliques, leur utilisation comme agents anti-microbiens. | |
| JP2023540630A (ja) | 薬物耐性微生物の処置のためのデフェンシン断片由来のリポペプチド | |
| EP1351977A1 (fr) | Pseudopeptides antimicrobiens | |
| FR2925502A1 (fr) | Pseudopeptides antimicrobiens, medicament et composition pharmaceutique les contenant. |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20190722 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: SACHON, EMMANUELLE Inventor name: ROSENSTEIN, YVONNE Inventor name: LACOMBE, CLAIRE Inventor name: AUVYNET, CONSTANCE |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: INSERM - INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE Owner name: UNIVERSITE PARIS-SACLAY Owner name: SORBONNE UNIVERSITE Owner name: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE Owner name: UNIVERSIDAD NACIONAL AUTONOMA DE MEXICO |
|
| RAP3 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: UNIVERSIDAD NACIONAL AUTONOMA DE MEXICO Owner name: UNIVERSITE PARIS-SACLAY Owner name: INSERM - INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE Owner name: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE Owner name: SORBONNE UNIVERSITE |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20220701 |