EP3097117B1 - Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules - Google Patents

Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules Download PDF

Info

Publication number
EP3097117B1
EP3097117B1 EP15704414.0A EP15704414A EP3097117B1 EP 3097117 B1 EP3097117 B1 EP 3097117B1 EP 15704414 A EP15704414 A EP 15704414A EP 3097117 B1 EP3097117 B1 EP 3097117B1
Authority
EP
European Patent Office
Prior art keywords
cell
cells
car
nucleic acid
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
EP15704414.0A
Other languages
German (de)
French (fr)
Other versions
EP3097117A1 (en
Inventor
Carl H. June
Xiaojun LUI
Devon J. Shedlock
Yangbing Zhao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
University of Pennsylvania Penn
Original Assignee
Novartis AG
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG, University of Pennsylvania Penn filed Critical Novartis AG
Priority to EP23193480.3A priority Critical patent/EP4303229A3/en
Publication of EP3097117A1 publication Critical patent/EP3097117A1/en
Application granted granted Critical
Publication of EP3097117B1 publication Critical patent/EP3097117B1/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/10—Cellular immunotherapy characterised by the cell type used
    • A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31—Chimeric antigen receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41—Vertebrate antigens
    • A61K40/42—Cancer antigens
    • A61K40/4202—Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224—Molecules with a "CD" designation not provided for elsewhere
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41—Vertebrate antigens
    • A61K40/42—Cancer antigens
    • A61K40/4254—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
    • A61K40/4255—Mesothelin [MSLN]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00—Cellular immunotherapy
    • A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41—Vertebrate antigens
    • A61K40/42—Cancer antigens
    • A61K40/4271—Melanoma antigens
    • A61K40/4272—Melan-A/MART
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/5418—IL-7
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/5443—IL-15
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/55—IL-2
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70532—B7 molecules, e.g. CD80, CD86
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G01N33/5047—Cells of the immune system
    • G01N33/505—Cells of the immune system involving T-cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515—Animal cells
    • A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/53—Hinge
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00—Active agents used in cell culture processes, e.g. differentation
    • C12N2501/50—Cell markers; Cell surface determinants
    • C12N2501/51—B7 molecules, e.g. CD80, CD86, CD28 (ligand), CD152 (ligand)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00—Active agents used in cell culture processes, e.g. differentation
    • C12N2501/50—Cell markers; Cell surface determinants
    • C12N2501/515—CD3, T-cell receptor complex
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/16011—Orthomyxoviridae
    • C12N2760/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Chimeric antigen receptors are molecules that combine antibody-based specificity for disease-associated surface antigens with T cell receptor-activating intracellular domains with disease-directed cellular immune activity. This configuration allows T cells engineered to express a CAR to achieve MHC-independent primary activation through single chain Fv (scFv) antigen-specific extracellular regions fused to intracellular domains that provide T cell activation and co-stimulatory signals.
  • scFv single chain Fv
  • Second and third generation CARs also provide appropriate co-stimulatory signals via CD28 and/or CD 137 (4- IBB) intracellular activation motifs, which augment cytokine secretion and anti-tumor activity in a variety of solid tumor and leukemia models ( Pinthus, et al,, 2004, J Clin Invest 114(12): 1774-1781 ; Milone, et al, 2009, Mol Ther 17(8): 1453- 1464 ; Sadelain, et al, 2009, Curr Opin Immunol 21(2):215-223 ).
  • CD28 and/or CD 137 (4- IBB) intracellular activation motifs
  • CTLs cytotoxic T lymphocytes
  • improved culture systems and cell engineering technologies have made possible CAR T cells with more potent antitumor effects ( Sadelain et al, 2009, Curr Opin Immunol 21 :215-23 ).
  • the technology has also been successfully applied in the clinical context, with improved clinical results being reported for CARs introduced with retroviral vectors ( Till et al, 2008, Blood 112:2261-71 ; Pule et al, 2008, Nat Med 14: 1264-70 ).
  • These CAR T cells also exhibit enhanced toxicity ( Brentjens et al, 2010, Mol Ther 18:666-8 ; Morgan et al, 2010, Mol Ther 18:843-51 ).
  • US 2013/071414 A1 relates to engineered CD19-specific T lymphocytes that coexpress IL-15 and an inducible Caspase-9 based suicide gene for the treatment of B-cell malignancies.
  • WO 2013/126712 A1 relates to compositions and methods for generating a persisting population of T cells useful for the treatment of cancer.
  • WO 2008/121420 A1 relates to constitutive expression of costimulatory ligands on adoptively transferred T-lymphocytes.
  • the present invention provides a T cell comprising exogenous nucleic acid, wherein: (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein: the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence, and the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  • CAR chimeric antigen receptor
  • the present invention also provides a composition comprising such a T cell and optionally further comprising a second therapeutic agent.
  • the present invention also provides such a T cell for use in a method of:
  • the present invention also provides a method of generating a T cell having enhanced anti-tumor activity, the method comprising introducing a nucleic acid, wherein: (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein: the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  • CAR chimeric antigen receptor
  • the present invention also provides a T cell engineered to express a chimeric antigen receptor (CAR), for use in the treatment of cancer by CAR-mediated cancer cell killing and enhanced priming of T cells with tumor antigen, wherein the CAR-engineered T cell comprises exogenous nucleic acid comprising: (a) a first nucleic acid sequence encoding the CAR, wherein said CAR comprises an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
  • the present invention provides T cells engineered to exhibit increased anti-tumor activity by co-expressing a chimeric antigen receptor (CAR) and one or more enhancers of T cell priming (hereafter "ETPs").
  • CAR chimeric antigen receptor
  • ETPs enhancers of T cell priming
  • the ETP is selected from the group of CD70, CD86 and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • the addition of an ETP component to the CAR T cell confers enhanced "professional" antigen-presenting cell (APC) function, which confers permanent anti-tumor immunity.
  • the CAR and one or more ETPs are transiently co-expressed in a T cell.
  • the engineered T cells are safe (given the transient nature of the CAR / ETP expression), and induce prolonged (even permanent) immunity via APC function.
  • the T cells can be used to treat a wide variety of diseases associated with cell surface (target) antigens.
  • T cell comprising exogenous nucleic acid, wherein
  • the CAR may further comprise a second intracellular signaling domain, e.g., a costimulatory signaling domain.
  • a second intracellular signaling domain e.g., a costimulatory signaling domain.
  • the first and second nucleic acid sequences are disposed on a single nucleic acid molecule.
  • the nucleic acid molecule comprises RNA.
  • the first and second nucleic acid sequences are disposed on two or more distinct nucleic acid molecules.
  • one or both nucleic acid molecules comprise RNA molecules.
  • one nucleic acid molecule comprises an RNA molecule and the other nucleic acid comprises a DNA molecule.
  • the second intracellular signaling domain comprises a costimulatory signaling domain.
  • the CAR comprises one or more costimulatory signaling domains.
  • the intracellular signaling domain comprises a CD3zeta domain and the second intracellular signaling domain comprises a 4-1BB domain.
  • the first nucleic acid sequence comprises an RNA.
  • the second nucleic acid sequence comprises an RNA.
  • the first and the second nucleic acid sequence each comprise RNA.
  • the T cell is transfected to transiently express the first and/or second RNAs.
  • the T cell does not comprise an exogenous DNA encoding the first or second RNA.
  • the first and/or second RNAs are generated by in vitro transcription.
  • the first and/or second RNAs are synthetic RNAs.
  • the first and/or second RNAs are introduced into the T cell by electroporation.
  • the CAR further comprises one or more costimulatory signaling domains, and wherein the first or second nucleic acid sequence comprises DNA or cDNA.
  • the first or second nucleic acid sequence comprises a vector.
  • the vector is a viral vector.
  • the viral vector is a retroviral vector or a lentiviral vector.
  • the T cell is virally transduced to express the first or second nucleic acid sequence.
  • the extracellular domain of the CAR comprises an antigen-binding domain.
  • the antigen-binding domain is a scFv domain.
  • the transmembrane domain comprises the transmembrane portion of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154.
  • the intracellular signaling domain comprises a functional signaling domain of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
  • FCER1G common FcR gamma
  • Fc gamma RIIa FcR beta
  • CD3 gamma CD3 delta
  • CD3 epsilon CD79a, CD79b, DAP10, and DAP12.
  • the extracellular domain is connected to the transmembrane domain by a hinge region.
  • the CAR further comprises one or more costimulatory signaling domains.
  • the costimulatory signaling domain is a functional signaling domain from a protein selected from the group consisting of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD11a/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
  • Polypeptides which enhance T cell priming can be selected from the group consisting of a costimulatory molecule, a soluble cytokine, a polypeptide involved in antigen presentation, a polypeptide involved in trafficking and/or migration, or a polypeptide involved in dendritic cell targeting, or a functional fragment or variant thereof.
  • a costimulatory molecule ETP may be selected from the group consisting of CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD 112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, and functional fragments and variants thereof.
  • a soluble cytokine may be selected from the group consisting of: IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, IL-27, and functional fragments and variants thereof.
  • a polypeptide involved in antigen presentation may be selected from the group consisting of CD64, MHC I, MHC II, and functional fragments and variants thereof.
  • a polypeptide involved in trafficking and/or migration may be selected from the group consisting of CD183, CCR2, CCR6, CD50, CD197, CD58, CD62L, and functional fragments and variants thereof.
  • a polypeptide involved in DC targeting may be selected from the group consisting of TLR ligands, anti-DEC-205 antibody, an anti-DC-SIGN antibody, and functional fragments and variants thereof.
  • the present invention utilises an ETP that is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure which do not utilise such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention
  • the antigen-binding domain binds to an antigen associated with a disease state.
  • the disease state is selected from the group consisting of a proliferative disease, a precancerous condition, a non-cancer indication, a viral infection, and a bacterial infection.
  • the antigen-binding domain binds to a tumor antigen, a viral antigen, or a bacterial antigen.
  • the tumor antigen is an antigen associated with a cancer selected from the group consisting of brain cancer, bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  • a cancer selected from the group consisting of brain cancer, bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma
  • the T cell has enhanced antigen presentation ability relative to a T cell which lacks the second nucleic acid sequence.
  • the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence.
  • the T cell is transfected to transiently express a nucleic acid comprising a third nucleic acid sequence encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof, which differs from the polypeptide encoded by the second nucleic acid sequence.
  • the T cell has increased T cell priming ability relative to a T cell comprising the first nucleic acid sequence and second nucleic acid sequence, but not the third nucleic acid sequence.
  • the third nucleic acid sequence comprises an RNA.
  • the T cell is transfected to transiently express the third RNA.
  • the cell does not comprise an exogenous DNA encoding the third RNA.
  • the CAR comprises one or more costimulatory signaling domains, and wherein the third nucleic acid sequence comprises DNA.
  • the T cell further comprises one or more additional distinct nucleic acid sequences encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof, which differ from the polypeptides encoded by the second and third nucleic acid sequences.
  • the one or more additional nucleic acid sequences comprises RNA.
  • the CAR comprises one or more costimulatory signaling domains, and wherein the one or more additional nucleic acids comprise DNA.
  • the first, second, and/or additional nucleic acid sequences are transcribed from one or more in vitro transcription vectors.
  • expression of the polypeptide encoded by the second and/or additional nucleic acid sequences does not substantially affect, e.g., decrease, reduce, or inhibit, the cell-killing function of the CAR encoded by the first nucleic acid sequence.
  • the T cell has increased efficacy in killing tumor cells or reducing tumor size in a subject with a tumor relative to a T cell comprising only the CAR encoded by the first nucleic acid sequence.
  • the T cell enhances the priming of T cells with a tumor antigen, a viral antigen, a bacterial antigen.
  • the T cells described herein may be made by introducing a nucleic acid wherein (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof; provided that the first and/or second nucleic acid sequence comprises an RNA.
  • CAR chimeric antigen receptor
  • the invention provides a method of generating a T cell having enhanced anti-cancer activity, e.g., anti-tumor activity, the method comprising introducing a nucleic acid, wherein:
  • the first and second nucleic acid sequences are disposed on a single nucleic acid molecule.
  • the nucleic acid molecule comprises RNA.
  • the first and second nucleic acid sequences are disposed on two or more distinct nucleic acid molecules.
  • one or both nucleic acid molecules comprise RNA molecules.
  • one nucleic acid molecule comprises an RNA molecule and the other nucleic acid comprises a DNA molecule.
  • the second intracellular signaling domain comprises a costimulatory signaling domain.
  • the CAR comprises one or more costimulatory signaling domains.
  • the intracellular signaling domain comprises a CD3zeta domain and the second intracellular signaling domain comprises a 4-1BB domain.
  • the first nucleic acid sequence comprises an RNA.
  • the second nucleic acid sequence comprises an RNA.
  • the first and the second nucleic acid sequence each comprise RNA.
  • the T cell is transfected to transiently express the first and/or second RNAs.
  • the Tcell does not comprise an exogenous DNA encoding the first or second RNA.
  • the first and/or second RNAs are generated by in vitro transcription.
  • the first and/or second RNAs are synthetic RNAs.
  • the first and/or second RNAs are introduced into the T cell by electroporation.
  • the CAR further comprises one or more costimulatory signaling domains, and wherein the first or second nucleic acid sequence comprises DNA or cDNA.
  • the first or second nucleic acid sequence comprises a vector.
  • the vector is a viral vector.
  • the viral vector is a retroviral vector or a lentiviral vector.
  • the T cell is virally transduced to express the first or second nucleic acid sequence.
  • the T cell may be used in a method of vaccinating a subject comprising administering to the subject the T cell.
  • the method may further comprise administering to the subject an antigen.
  • the antigen may be a tumor antigen, a viral antigen, or a bacterial antigen.
  • RNA transfected to transiently express two or more distinct exogenous RNAs, wherein (a) the first RNA comprises a nucleic acid sequence encoding a CAR comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the second RNA comprises a nucleic acid sequence encoding a polypeptide which enhances T cell priming (i.e., an ETP).
  • first RNA comprises a nucleic acid sequence encoding a CAR comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain
  • the second RNA comprises a nucleic acid sequence encoding a polypeptide which enhances T cell priming (i.e., an ETP).
  • the ETP is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, and the T cell has enhanced T cell priming ability relative to a T cell which lacks the second RNA.
  • the T cells of the invention are transfected to transiently express a third distinct RNA comprising a nucleic acid sequence encoding an ETP, or a functional fragment or variant thereof, which differs from that encoded by the second RNA.
  • Exemplary extracellular domains of the CAR include, for example, an antigen-binding moiety, e.g., an scFv domain, which binds a disease-associated antigen (i.e., an antigen that is either unique, or expressed more highly in diseased cells compared to normal cells).
  • a disease-associated antigen i.e., an antigen that is either unique, or expressed more highly in diseased cells compared to normal cells.
  • Such antigens can be associated with a proliferative disease, a precancerous condition, and a non-cancer indication.
  • the antigen-binding moiety binds a tumor antigen, for example, an antigen associated with brain cancer (e.g., a glioma), bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  • brain cancer e.g., a glioma
  • bladder cancer e.g., breast cancer, cervical cancer, colorectal cancer
  • liver cancer e.g., kidney cancer
  • lymphoma e.g., leukemia, lung cancer, melanoma, metastatic melanoma
  • the transmembrane domain of the CAR is a transmembrane domain described herein.
  • Exemplary transmembrane domains of the CAR include a transmembrane domain of, for example, the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154.
  • the extracellular domain can be connected to the transmembrane domain by a hinge region.
  • the intracellular domain of the CAR is an intracellular domain described herein.
  • Exemplary intracellular domains of the CAR include, for example, the functional signaling domain of TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, 4-1BB, and/or CD3-zeta.
  • the intracellular signaling domain comprises a functional signaling domain of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
  • FCER1G common FcR gamma
  • Fc gamma RIIa FcR beta
  • CD3 gamma CD3 delta
  • CD3 epsilon CD79a, CD79b, DAP10, and DAP12.
  • the CAR may also comprise one or more costimulatory signaling domains, e.g., a costimulatory signaling domain described herein.
  • the costimulatory signaling domain can be a costimulatory signaling domain of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD11a/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
  • the ETP encoded by the second RNA is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure in which the second RNA does not encode such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention.
  • ETPs include, for example, a costimulatory molecule (e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, for functional fragments or variants thereof), a soluble cytokine (e.g., IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, and IL-27, or functional fragments or variants thereof), a poly
  • RNA ETP-CAR T cells of the invention have enhanced T cell priming ability relative to a T cell which lacks the RNA encoding the ETP and optionally antigen presentation ability relative to a T cell which lacks the RNA encoding the ETP.
  • the additional ETPs enhance the antigen presentation and/or T cell priming ability of a T cell lacking the additional ETPs.
  • the T cell is transfected to transiently express a third distinct RNA comprising a nucleic acid sequence encoding an ETP which differs from the ETP encoded by the second RNA. In this case, the T cell has increased antigen presentation and/or T cell priming ability relative to a T cell comprising the first RNA and second RNA, but not the third RNA.
  • the expression of the CAR or CARs does not substantially affect the level of expression of the ETP or ETPs in the RNA ETP-CAR T cell, wherein the CAR comprises an antigen binding domain that binds the antigen, and the expression of the ETP or ETPs does not substantially affect the level of expression or cell-killing function of the CAR or CARs in the RNA ETP-CAR T cell.
  • RNA ETP-CAR T cells of the invention have, for example, increased efficacy in killing tumor cells and/or reducing tumor size and/or priming of T cells with a tumor antigen in a subject with a tumor relative to a RNA CAR T cell, i.e., a T cell transiently expressing the CAR alone.
  • RNAs encoding the CAR or CARs and ETP or ETPs are transcribed from, e.g., an in vitro transcription vector, and introduced into T cells by, e.g., electroporation.
  • compositions for example, a pharmaceutical composition comprising a pharmaceutically acceptable carrier, comprising an RNA ETP-CAR T cell as defined in the claims.
  • the invention in another aspect, relates to method of generating a T cell having enhanced anti-tumor activity, the method comprising transiently transfecting a T cell with two or more distinct exogenous RNAs, wherein: (a) the first RNA comprises a nucleic acid sequence encoding a CAR comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and b) the second RNA comprises a nucleic acid sequence encoding an ETP, or a functional fragment or variant thereof, as defined in the claims.
  • the invention in another aspect, relates to a RNA ETP-CAR T cell of the invention for use in a method of providing anti-tumor immunity in a subject comprising administering to the subject, for example, a human subject, an effective amount of the RNA ETP-CAR T cell.
  • the invention relates to a RNA ETP-CAR T cell of the invention for use in a method of treating a subject, for example, a human subject, having a disease associated with a disease-associated antigen comprising administering to the subject an effective amount of the RNA ETP-CAR T cell.
  • the disease is a proliferative disease, a precancerous condition, or a non-cancer-related indication.
  • the cancer is a cancer described herein.
  • the non-cancer-related indication is a viral infection or a bacterial infection.
  • the invention in another aspect, relates to an RNA ETP-CAR T cell of the invention for use in a method of enhancing epitope spreading in a subject, for example, a human subject, with cancer comprising administering to the subject the RNA ETP-CAR T cell.
  • RNA ETP-CAR T cells and RNA ETP-CAR T cell compositions of the invention and their use for preparing medicaments or use for treating, diseases associated with disease-associated antigens, such as cancer, autoimmune diseases, inflammatory diseases, and infectious diseases.
  • an element means one element or more than one element.
  • a 5' cap (also termed an RNA cap, an RNA 7- methylguanosine cap or an RNA m 7 G cap) is a modified guanine nucleotide that has been added to the "front" or 5' end of a eukaryotic messenger RNA shortly after the start of transcription.
  • the 5' cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co- transcriptionally, such that each influences the other.
  • RNA polymerase Shortly after the start of transcription, the 5' end of the mRNA being synthesized is bound by a capsynthesizing complex associated with RNA polymerase. This enzymatic complex catalyzes the chemical reactions that are required for mRNA capping. Synthesis proceeds as a multi-step biochemical reaction.
  • the capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation.
  • polyadenylation refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNAmolecule.
  • Most messenger RNA(mRNA) molecules are polyadenylated at the 3' end.
  • the 3' poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase.
  • the poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal.
  • the poly(A) tail and the protein bound to it aid in protecting mRNA from degradation by exonucleases.
  • Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm. After transcription has been terminated, the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase. The cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site. After the mRNA has been cleaved, adenosine residues are added to the free 3' end at the cleavage site.
  • in vitro transcribed RNA refers to RNA, preferably mRNA, that has been synthesized in vitro.
  • the in vitro transcribed RNA is generated from an in vitro transcription vector.
  • the in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
  • CAR Chimeric Antigen Receptor
  • a cytoplasmic signaling domain also referred to as an intracellular signaling domain
  • a functional signaling domain derived from a stimulatory molecule as defined below also referred to herein as a "primary signaling domain”
  • the stimulatory molecule is TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, 4-1BB or CD3-zeta.
  • the stimulatory molecule is the zeta chain associated with the T cell receptor complex.
  • the stimulatory molecule is 4-1BB.
  • the cytoplasmic signaling domain further comprises one or more functional signaling domains derived from at least one costimulatory molecule as defined below (also referred to as a "costimulatory signaling domain").
  • the costimulatory molecule is chosen from a costimulatory molecule described herein, e.g., OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 1a/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule (a primary signaling domain).
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a co-stimulatory molecule (a costimulatory signaling domain) and a functional signaling domain derived from a stimulatory molecule (a primary signaling domain).
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising at least two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises an optional leader sequence at the amino-terminus (N-ter) of the CAR fusion protein.
  • the CAR further comprises a leader sequence at the N-terminus of the extracellular antigen binding domain, wherein the leader sequence is optionally cleaved from the scFv domain during cellular processing and localization of the CAR to the cellular membrane.
  • the leader sequence comprises (e.g., consists of) the amino acid sequence of SEQ ID NO: 2.
  • the CAR is a regulatable chimeric antigen receptor (RCAR).
  • chimeric antigen receptor refers to a set of polypeptides, typically two in the simplest embodiments, which when expressed in a cell, e.g., an RCARX cell, provides the cell with specificity for a target cell, typically a cancer cell, and with regulatable intracellular signal generation or proliferation, which can optimize an immune effector property of the RCAR-expressing cell.
  • An RCAR-expressing cell relies at least in part, on an antigen binding domain to provide specificity to a target cell that comprises the antigen bound by the antigen binding domain.
  • an RCAR includes a dimerization switch that, upon the presence of a dimerization molecule, can couple a polypeptide comprising an intracellular signaling domain to a polypeptide comprising an antigen binding domain.
  • dimerization molecule refers to a molecule that promotes the association of a first switch domain with a second switch domain.
  • the dimerization molecule does not naturally occur in the subject, or does not occur in concentrations that would result in significant dimerization.
  • the dimerization molecule is a small molecule, e.g., rapamycin or a rapalogue, e.g, RAD001.
  • signaling domain refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
  • antibody refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen.
  • Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact immunoglobulins, and may be derived from natural sources or from recombinant sources. Antibodies are typically tetramers of immunoglobulin molecules.
  • antibody fragment refers to at least one portion of an antibody, that retains the ability to specifically interact with (e.g., by binding, steric hinderance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen.
  • antibody fragments include, but are not limited to, Fab, Fab', F(ab') 2 , Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CH1 domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide brudge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody.
  • An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005 ).
  • Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3)(see U.S.
  • scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked, e.g., via a synthetic linker, e.g., a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
  • a synthetic linker e.g., a short flexible polypeptide linker
  • an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
  • the portion of the CAR of use in the invention comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv),a humanized antibody or bispecific antibody ( Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY ; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York ; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883 ; Bird et al., 1988, Science 242:423-426 ).
  • the antigen binding domain of a CAR composition of use in the invention comprises an antibody fragment.
  • the CAR comprises an antibody fragment that comprises a scFv.
  • antibody heavy chain refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
  • antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa ( ⁇ ) and lambda ( ⁇ ) light chains refer to the two major antibody light chain isotypes.
  • recombinant antibody refers to an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
  • the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
  • anti-cancer effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of cancer cells, a decrease in the number of metastases, an increase in life expectancy, decrease in cancer cell proliferation, decrease in cancer cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
  • An "anti-cancer effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies in prevention of the occurrence of cancer in the first place.
  • anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, or a decrease in tumor cell survival.
  • autologous refer to any material derived from the same individual to whom it is later to be re-introduced into the individual.
  • allogeneic refers to any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.
  • xenogeneic refers to a graft derived from an animal of a different species.
  • proliferative disease refers to any disease or disorder including cancers, malignancies, benign growths and other conditions that result from hyperactivity or hyperplasia of somatic cells.
  • cancer refers to a disease characterized by the uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
  • T cell priming refers to the process by which a naive T cell undergoes clonal expansion and differentiation into an effector cytotoxic T cell (CTL) after being stimulated by contact with an antigen.
  • CTL effector cytotoxic T cell
  • ETP Endothelial of T cell priming
  • exemplary ETPs include, but are not limited to, costimulatory molecules (e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD 112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, and ligands thereof), soluble cytokines (e.g., IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21,
  • costimulatory molecules e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4
  • the present invention utilises an ETP that is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure which do not utilise such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention.
  • Candidate ETPs can be tested for T cell priming activity using assays described in the Examples.
  • T cells comprising a nucleic acid sequence encoding a CAR and a nucleic acid encoding an ETP are referred to herein as "ETP-CAR T cells”.
  • T cells transiently transfected with an RNA encoding a CAR and an RNA encoding an ETP are referred to herein as "RNA ETP-CAR T cells.”
  • epitopope spreading or “antigen spreading” refers to the ability of the immune system to attack new targets beyond that to which a vaccine is designed to attack, by recognizing antigenic fragments of killed cells as new targets.
  • conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or antibody fragment of use in the invention by standard techniques known in the art, such as sitedirected mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • stimulation refers to a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
  • a stimulatory molecule e.g., a TCR/CD3 complex
  • Stimulation can mediate the altered expression of certain molecules, such as downregulation of TGF- ⁇ , and/or reorganization of cytoskeletal structures, and the like.
  • the term "stimulatory molecule,” refers to a molecule expressed by an immune cell, e.g., a T cell, a NK cell, or a B cell, that provide the cytoplasmic signaling sequence(s) that regulate activation of the immune cellin a stimulatory way for at least some aspect of the immune cell signaling pathway.
  • the signal is a primary signal that is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with a peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing cytoplasmic signaling sequences that are of particular use in the invention include those derived from CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
  • the cytoplasmic signaling molecule in any one or more CARs of use in the invention comprises a cytoplasmic signaling sequence derived from CD3-zeta.
  • the cytoplasmic signaling sequence derived from CD3-zeta is the sequence provided as SEQ ID NO: 18 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • antigen presenting cell refers to an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays foreign antigens complexed with major histocompatibility complexes (MHC's) on their surfaces.
  • T-cells may recognize these complexes using their T-cell receptors (TCRs).
  • APCs process antigens and present them to T-cells.
  • zeta or alternatively “zeta chain”, “CD3-zeta” or “TCR-zeta” is defined as the protein provided as GenBank Acc No. BAG36664.1, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like, and a "zeta stimulatory domain” or alternatively a “CD3-zeta stimulatory domain” or a “TCR-zeta stimulatory domain” is defined as the amino acid residues from the cytoplasmic domain of the zeta chain, or functional derivatives thereof, that are sufficient to functionally transmit an initial signal necessary for T cell activation.
  • the cytoplasmic domain of zeta comprises residues 52 through 164 of GenBank Acc No. BAG36664.1 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like, that are functional orthologs thereof.
  • the "zeta stimulatory domain” or a "CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO:18.
  • costimulatory molecule refers to a cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
  • Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response.
  • Costimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and a Toll ligand receptor, as well as CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD43, CD48, CD 112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), and CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (O
  • a costimulatory intracellular signaling domain of a CAR described herein can be the intracellular portion of a costimulatory molecule.
  • a costimulatory molecule can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors.
  • Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, ICAM-1, lymphocyte function-associated antigen-1 (LFA-1), CD2, CDS, CD7, CD287, LIGHT, NKG2C, NKG2D, SLAMF7, NKp80, NKp30, NKp44, NKp46, CD160, B7-H3, and a ligand that specifically binds with CD83, and the like.
  • the intracellular signaling domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment or derivative thereof.
  • 4-1BB refers to member of the TNFR superfamily with an amino acid sequence provided as GenBank accno. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like; and a "4-1BB costimulatory domain" are defined amino acid residues 214-255 of GenBank accno. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • the "4-1BB costimulatory domain” is the sequence provided as SEQ ID NO: 14 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA, and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • nucleic acid sequence encoding an amino acid sequence includes all nucleic acid sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleic acid sequence that encodes a protein or a RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • an effective amount or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result. Such results may include, but are not limited to, the inhibition of virus infection as determined by any means suitable in the art.
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • expression refers to the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
  • expression vector refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
  • An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
  • Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
  • homologous refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules.
  • two nucleic acid molecules such as, two DNA molecules or two RNA molecules
  • polypeptide molecules between two polypeptide molecules.
  • a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position.
  • the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • CDR complementary-determining region
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies/antibody fragments can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody or antibody fragment performance.
  • the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
  • the humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • variant refers to an RNA or polypeptide that differs from a wild-type ETP encoding RNA or polypeptide respectively, but retains essential properties of the wild-type ETP (e.g., ability to enhance antigen presentation and/or T cell priming).
  • the term "fully human” refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
  • the term "functional fragment,” in connection with an ETP, is intended to mean a portion of the ETP that maintains the ability to enhance T cell priming.
  • isolated means altered or removed from the natural state.
  • a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • A refers to adenosine
  • C refers to cytosine
  • G refers to guanosine
  • T refers to thymidine
  • U refers to uridine.
  • lentivirus refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
  • lentiviral vector refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009 ).
  • Other examples of lentivirus vectors that may be used in the clinic include but are not limited to, e.g., the LENTIVECTOR ® gene delivery technology from Oxford BioMedica, the LENTIMAX TM vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
  • Membrane anchor or “membrane tethering domain”, as that term is used herein, refers to a polypeptide or moiety, e.g., a myristoyl group, sufficient to anchor an extracellular or intracellular domain to the plasma membrane.
  • Substantially complementary refers to sequences of nucleotides where a majority or all of the bases in the primer sequence are complementary, or one or more bases are non-complementary, or mismatched. Substantially complementary sequences are able to anneal or hybridize with the intended DNA target under annealing conditions used for PCR.
  • the primers can be designed to be substantially complementary to any portion of the DNA template.
  • the primers can be designed to amplify the portion of a gene that is normally transcribed in cells (the open reading frame), including 5' and 3' UTRs.
  • the primers can also be designed to amplify a portion of a gene that encodes a particular domain of interest.
  • the primers are designed to amplify the coding region of a human cDNA, including all or portions of the 5' and 3' UTRs. Primers useful for PCR are generated by synthetic methods that are well known in the art.
  • an ETP co-expressed with a CAR in a T cell does not inhibit the cell killing function of a CAR by more than about 40%.
  • Forward primers are primers that contain a region of nucleotides that are substantially complementary to nucleotides on the DNA template that are upstream of the DNA sequence that is to be amplified.
  • Upstream is used herein to refer to a location 5, to the DNA sequence to be amplified relative to the coding strand.
  • Reverse primers are primers that contain a region of nucleotides that are substantially complementary to a double-stranded DNA template that are downstream of the DNA sequence that is to be amplified.
  • Downstream is used herein to refer to a location 3' to the DNA sequence to be amplified relative to the coding strand.
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • Operably linked DNA sequences can be contiguous with each other and, where necessary to join two protein coding regions, are in the same reading frame.
  • parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
  • nucleic acid refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
  • DNA deoxyribonucleic acids
  • RNA ribonucleic acids
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues ( Batzer et al., Nucleic Acid Res. 19:5081 (1991 ); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985 ); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994 )).
  • peptide refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
  • the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
  • Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
  • the polypeptides include natural peptides, recombinant peptides, recombinant peptides, or a combination thereof.
  • promoter refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • promoter/regulatory sequence refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • flexible polypeptide linker refers to a peptide linker that consists of amino acids such as glycine and serine residues used alone or in combination, to link variable heavy and variable light chain regions together.
  • the flexible polypeptide linkers include, but are not limited to, (Gly4 Ser)4 or (Gly4 Ser)3
  • the linkers include multiple repeats of (Gly2Ser), (GlySer) or (Gly3Ser). Also included within the scope of the invention are linkers described in WO2012/138475 .
  • signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
  • cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
  • subject refers to any living organisms in which an immune response can be elicited (e.g., mammals, human).
  • switch domain refers to an entity, typically a polypeptide-based entity, that, in the presence of a dimerization molecule, associates with another switch domain. The association results in a functional coupling of a first entity linked to, e.g., fused to, a first switch domain, and a second entity linked to, e.g., fused to, a second switch domain.
  • a first and second switch domain are collectively referred to as a dimerization switch.
  • the first and second switch domains are the same as one another, e.g., they are polypeptides having the same primary amino acid sequence, and are referred to collectively as a homodimerization switch. In embodiments, the first and second switch domains are different from one another, e.g., they are polypeptides having different primary amino acid sequences, and are referred to collectively as a heterodimerization switch. In embodiments, the switch is intracellular. In embodiments, the switch is extracellular. In embodiments, the switch domain is a polypeptide-based entity, e.g., FKBP or FRB-based, and the dimerization molecule is small molecule, e.g., a rapalogue.
  • the switch domain is a polypeptide-based entity, e.g., an scFv that binds a myc peptide
  • the dimerization molecule is a polypeptide, a fragment thereof, or a multimer of a polypeptide, e.g., a myc ligand or multimers of a myc ligand that bind to one or more myc scFvs.
  • the switch domain is a polypeptide-based entity, e.g., myc receptor
  • the dimerization molecule is an antibody or fragments thereof, e.g., myc antibody.
  • substantially purified cell refers to a cell that is essentially free of other cell types.
  • a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
  • a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
  • the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
  • terapéutica as used herein means a treatment.
  • a therapeutic effect is obtained by reduction, suppression, remission, or eradication of a disease state.
  • prophylaxis means the prevention of or protective treatment for a disease or disease state.
  • tumor antigen or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders.
  • the hyperproliferative disorder antigens of use with the present invention are derived from, cancers including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, non-Hodgkin's lymphoma, non-Hodgkins lymphoma, leukemias, uterine cancer, cervical cancer, bladder cancer, kidney cancer and adenocarcinomas such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, and the like.
  • transfected refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a "transfected” cell is one which has been transfected with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of use in the invention).
  • the terms “treat”, “treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
  • the terms “treat”, “treatment” and “treating” - refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or stabilization of tumor size or cancerous cell count.
  • the term “specifically binds,” refers to an antibody, or a ligand, which recognizes and binds with a binding partner (e.g., a tumor antigen) protein present in a sample, but which antibody or ligand does not substantially recognize or bind other molecules in the sample.
  • a binding partner e.g., a tumor antigen
  • ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
  • the present invention is based on the discovery that the anti-tumor activities of T cells that express nucleic acid sequences encoding CARs can be further enhanced by the co-expression of nucleic acid sequences encoding molecules that enhance T cell priming (i.e., hereafter, "ETPs"), e.g., molecules involved in cellular co-stimulation and/or antigen presentation.
  • T cell priming i.e., hereafter, "ETPs”
  • T cells are referred to herein as "ETP-CAR T cells”.
  • ETP-CAR T cells are armed not only with CAR T cell-directed cell killing ability, they also exhibit enhanced antigen presenting function, allowing for ETP-CAR T cell-mediated priming of non-engineered tumor-reactive T cells, both naive and antigen experienced.
  • the ETP-CAR T cells are dual functional T cells with both killer and "professional" APC function, creating a transient therapy with permanent anti-tumor effects.
  • the T cells transiently express RNAs encoding CARs and/or RNAs encoding ETPs.
  • T cells can also exhibit prolonged expression of CAR or ETPs, e.g., by virus-mediated transduction of nucleic acids encoding CARs and/or ETPs.
  • the ETP is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • ETP-CAR T cells e.g., RNA ETP-CAR T cells
  • ETP-CAR T cells e.g., RNA ETP-CAR T cells
  • reacting specifically to a given tumor antigen via the CAR induces an inflammatory cascade at the site of antigen encounter.
  • ETP-CAR T cells which have been endowed with enhanced antigen-presenting and T cell priming abilities via the ETP component
  • RNA ETP-CAR T cells e.g., RNA ETP-CAR T cells, and other antigen-presenting cells
  • the T cells disclosed herein can be genetically modified, e.g., by transfection or transduction, to express a nucleic acid sequence encoding a CAR described herein and a nucleic acid sequence encoding an ETP described herein.
  • a nucleic acid sequence encoding a CAR described herein and a nucleic acid sequence encoding an ETP described herein.
  • prolonged or permanent expression of the CAR and/or the ETP may be desired, e.g., for robust and long-lasting CAR activity, e.g., anti-tumor activity, and ETP-based T cell priming activity.
  • the T cells can be genetically modified, e.g., transduced, e.g., virally transduced, using vectors comprising nucleic acid sequences encoding a CAR and/or ETP described herein to confer prolonged expression of the CAR and/or the ETP.
  • transient expression of the CAR and/or the ETP may be desired.
  • the transient presence of RNA ETP-CAR T cells i.e., the reversibility of CAR and ETP expression
  • RNA ETP-CAR T cells i.e., the reversibility of CAR and ETP expression
  • a host presents a flexible platform for the fine tuning of and patient-tailored adoptive T cell therapy, which distinct from the strategy of permanently genetically modifying T cells with, e.g., virus-mediated CAR delivery.
  • RNA ETP-CAR T cells can be administered to subjects as needed (e.g., with single or multiple infusions), and the expression of the components (ETP and CAR) can be controlled by altering the amount of RNA encoding each for fine tuning of CAR-based cell killing or ETP-based T cell priming activity, depending on the patient's condition.
  • This strategy may be particularly attractive in certain clinical contexts, for example, when there is a desire to limit the duration of on-target off-tumor toxicity, particularly in cases where disease-associated antigens are also expressed on normal tissues.
  • the present invention utilises nucleic acid sequences encoding chimeric antigen receptors (CAR) for expression in T cells with nucleic acid sequences encoding polypeptides that enhance T cell priming (ETP). Components of the CARs are further described herein.
  • CAR chimeric antigen receptors
  • a CAR described herein is used to generate a T cell with enhanced T cell priming activity.
  • the present invention utilises a nucleic acid sequence, e.g., a DNA or an RNA construct, encoding a CAR, wherein the CAR further comprises an antibody fragment that binds to a disease-associated antigen.
  • the sequence encoding the antibody fragment is contiguous with, and in the same reading frame as a nucleic acid sequence encoding an intracellular domain.
  • the intracellular domain comprises, a costimulatory signaling region and/or a zeta chain.
  • the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • the CAR construct comprises an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, and an intracellular stimulatory domain. In one aspect, the CAR construct comprises an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, an intracellular costimulatory domain and an intracellular stimulatory domain.
  • An exemplary leader sequence is provided as SEQ ID NO: 2.
  • An exemplary hinge/spacer sequence is provided as SEQ ID NO: 4, SEQ ID NO: 6, or SEQ ID NO: 8.
  • An exemplary transmembrane domain sequence is provided as SEQ ID NO: 12.
  • An exemplary sequence of the intracellular stimulatory domain, e.g., intracellular costimulatory domain, of the 4-1BB protein is provided as SEQ ID NO: 14.
  • Another exemplary sequence of an intracellular stimulatory domain, e.g., costimulatory signaling domain, of the CD27 protein is provided as SEQ ID NO: 16.
  • An exemplary CD3zeta domain sequence is provided as SEQ ID NO: 18 or 20.
  • transmembrane domains that can be used in the CAR include, but are not limited to, a transmembrane domain from alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, and the like.
  • Exemplary intracellular domains that can be used in the CAR include, but are not limited to, one or more intracellular signaling domains including, but not limited to, e.g., CD3-zeta, CD28, 4-1BB, and the like.
  • the CAR can comprise any combination of CD3-zeta, CD28, 4-1BB, and the like.
  • Exemplary costimulatory signaling domains that can be used in the CAR include, but are not limited to, any combination of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 1a/CD18), ICOS, 4-1BB (CD137), and the like.
  • nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques.
  • the gene of interest can be produced synthetically, rather than cloned.
  • the present invention includes an RNA construct that can be directly transfected or electroporated into a cell.
  • a method for generating mRNA for use in transfection involves in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3' and 5' untranslated sequence ("UTR"), a 5' cap and/or Internal Ribosome Entry Site (IRES), the gene to be expressed, and a polyA tail, typically 50-2000 bases in length.
  • RNA so produced can efficiently transfect different kinds of cells.
  • the template includes sequences for the CAR.
  • the CAR of use in the invention comprises a target-specific binding element otherwise referred to as an antigen binding domain.
  • the choice of moiety depends upon the type and number of ligands that define the surface of a target cell.
  • the antigen binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • examples of cell surface markers that may act as ligands for the antigen moiety domain in the CAR of use in the invention include those associated with viral, bacterial and parasitic infections, autoimmune disease, and cancer cells.
  • the CAR-mediated T-cell response can be directed to an antigen of interest by way of engineering an antigen binding domain that specifically binds a desired antigen into the CAR.
  • the present invention utilises CAR comprising an antigen binding domain on the CAR that is specific for a tumor antigen.
  • CAR comprising an antigen binding domain on the CAR that is specific for a tumor antigen.
  • tumor antigens that are expressed on the surface of cancer cells
  • tumor antigens that itself is intracellar, however, a fragment of such antigen (peptide) is presented on the surface of the cancer cells by MHC (major histocompatibility complex).
  • the present invention utilises CARs that target the following cancer associated antigens (tumor antigens): CD19, CD123, CD22, CD30, CD171, CS-1, CLL-1 (CLECL1), CD33, EGFRvIII, GD2, GD3, BCMA, Tn Ag, PSMA, ROR1, FLT3, FAP, TAG72, CD38, CD44v6, CEA, EPCAM, B7H3, KIT, IL-13Ra2, Mesothelin, IL-11Ra, PSCA, VEGFR2, LewisY, CD24, PDGFR-beta, PRSS21, SSEA-4, CD20, Folate receptor alpha, ERBB2 (Her2/neu), MUC1, EGFR, NCAM, Prostase, PAP, ELF2M, Ephrin B2, IGF-I receptor, CAIX, LMP2, gp100, bcr-abl, tyrosinase, EphA2, Fucosyl GM1, s
  • the present invention also utilises a CAR comprising an antigen binding domain that is specific for a viral antigen or a bacterial antigen.
  • the antigen binding domain can be any domain that binds to the antigen including but not limited to antigen binding domains derived from any one or more of monoclonal antibodies, polyclonal antibodies, recombinant antibodies, human antibodies, humanized antibodies, and fragments thereof, including but not limited to single-domain antibodies such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to alternative scaffolds known in the art that function as antigen binding domains, such as recombinant fibronectin domains, and the like.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • VHH variable domain of camelid derived nanobody
  • the antigen binding domain of the CAR may comprise human or humanized residues for the antigen binding domain of an antibody or antibody fragment.
  • the antigen binding domain comprises a humanized antibody or an antibody fragment.
  • a non-human antibody is humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human or fragment thereof.
  • the antigen binding domain is humanized.
  • a humanized antibody can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (see, e.g., European Patent No. EP 239,400 ; International Publication No. WO 91/09967 ; and U.S. Pat. Nos. 5,225,539 , 5,530,101 , and 5,585,089 ), veneering or resurfacing (see, e.g., European Patent Nos.
  • framework substitutions are identified by methods well-known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089 ; and Riechmann et al., 1988, Nature, 332:323 .)
  • a humanized antibody or antibody fragment has one or more amino acid residues remaining in it from a source which is nonhuman. These nonhuman amino acid residues are often referred to as "import” residues, which are typically taken from an “import” variable domain.
  • humanized antibodies or antibody fragments comprise one or more CDRs from nonhuman immunoglobulin molecules and framework regions wherein the amino acid residues comprising the framework are derived completely or mostly from human germline.
  • humanized chimeric antibodies and antibody fragments substantially less than an intact human variable domain has been substituted by the corresponding sequence from a nonhuman species.
  • humanized antibodies are typically human antibodies in which some CDR residues and possibly some framework (FR) residues are substituted by residues from analogous sites in rodent antibodies.
  • variable domains both light and heavy
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is to reduce antigenicity.
  • sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody ( Sims et al., J. Immunol., 151:2296 (1993 ); Chothia et al., J. Mol. Biol., 196:901 (1987 )).
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • the same framework may be used for several different humanized antibodies (see, e.g., Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285 (1992 ); Presta et al., J. Immunol., 151:2623 (1993 )).
  • the portion of the CAR composition of use in the invention that comprises an antibody fragment is humanized with retention of high affinity for the target antigen and other favorable biological properties.
  • humanized antibodies and antibody fragments are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind the target antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody or antibody fragment characteristic, such as increased affinity for the target antigen, is achieved.
  • the CDR residues are directly and most substantially involved in influencing antigen binding.
  • the antibodies of use in the invention may exist in a variety of other forms including, for example, Fv, Fab, and (Fab')2, as well as bi-functional (i.e. bispecific) hybrid antibodies (e.g., Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987 )).
  • the antibody fragment provided herein is a scFv.
  • a human scFv may also be derived from a yeast display library.
  • scFvs can be prepared according to method known in the art (see, for example, Bird et al., (1988) Science 242:423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883 ).
  • ScFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers.
  • the scFv molecules comprise flexible polypeptide linker (e.g., a Ser-Gly linker) with an optimized length and/or amino acid composition.
  • the flexible polypeptide linker length can greatly affect how the variable regions of an scFv fold and interact.
  • a short polypeptide linker e.g., between 5-10 amino acids
  • intrachain folding is prevented.
  • Interchain folding is also required to bring the two variable regions together to form a functional epitope binding site.
  • linker orientation and size see, e.g., Hollinger et al. 1993 Proc Natl Acad. Sci. U.S.A. 90:6444-6448 , U.S. Patent Application Publication Nos. 2005/0100543 , 2005/0175606 , 2007/0014794 , and PCT publication Nos. WO2006/020258 and WO2007/024715 .
  • the scFv can comprise a polypeptide linker sequence of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, or more amino acid residues between its VL and VH regions.
  • the flexible polypeptide linker sequence may comprise any naturally occurring amino acid.
  • the flexible polypeptide linker sequence comprises amino acids glycine and serine.
  • the flexible polypeptide linker sequence comprises sets of glycine and serine repeats such as (Gly 4 Ser)n, where n is a positive integer equal to or greater than 1.
  • the flexible polypeptide linkers include, but are not limited to, (Gly 4 Ser) 4 or (Gly 4 Ser) 3 . Variation in the flexible polypeptide linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
  • the present invention contemplates modifications of the starting antibody or fragment (e.g., svFv) amino acid sequence that generate functionally equivalent molecules.
  • the VH or VL of an scFv comprised in the CAR can be modified to retain at least about 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity of the starting VH or VL framework region of the scFv.
  • the present invention also contemplates modifications of the entire CAR construct, e.g., modifications in one or more amino acid sequences of the various domains of the CAR construct in order to generate functionally equivalent molecules.
  • the CAR construct can be modified to retain at least about 70%, 71%. 72%. 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity of the starting CAR construct.
  • the CAR is designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR.
  • the transmembrane domain is one that naturally is associated with one of the domains in the CAR.
  • the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
  • the transmembrane domain is capable of homodimerization with another CAR on the CAR T cell surface.
  • the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CAR T cell.
  • a transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the intracellular region).
  • one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the extracellular region
  • additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the intracellular region
  • the transmembrane domain is one that is associated with one of the other domains of the CAR e.g., in one embodiment, the transmembrane domain may be from the same protein that the signaling domain, costimulatory domain or the hinge domain is derived from. In another aspect, the transmembrane domain is not derived from the same protein that any other domain of the CAR is derived from. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex.
  • the transmembrane domain is capable of homodimerization with another CAR on the cell surface of a CAR-expressing cell.
  • the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CAR-expressing cell.
  • the transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one embodiment, the transmembrane region is capable of signaling to the intracellular domain(s) whenever the CAR has bound to a target.
  • Transmembrane regions of particular use in this invention may be derived from (i.e., comprise at least the transmembrane region(s) of), but not limited to, e.g., regions selected from any one or more of e.g., the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
  • a transmembrane domain may include at least the transmembrane region(s) of, e.g., KIRDS2, OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, IL2R beta, IL2R gamma, IL7R ⁇ , ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1 (CD22
  • hinges can be employed as well, e.g., including but not limited to the human Ig (immunoglobulin) hinge (e.g., an IgG4 hinge, an IgD hinge), a GS linker (e.g., a GS linker described herein), a KIR2DS2 hinge or a CD8 ⁇ hinge.
  • the hinge or spacer is the amino acid sequence provided as SEQ ID NO:4.
  • the transmembrane domain is a transmembrane domain from the sequence provided as SEQ ID NO: 12.
  • the transmembrane domain may be recombinant, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine will be found at each end of a recombinant transmembrane domain.
  • a short oligo- or polypeptide linker between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
  • a glycine-serine doublet provides a particularly suitable linker, e.g., GGGGSGGGGS (SEQ ID NO: 35).
  • the linker is encoded by a nucleotide sequence of GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 36).
  • Other suitable linkers can be found in Table 2.
  • the hinge or spacer comprises a KIR2DS2 hinge.
  • the cytoplasmic domain or intracellular signaling domain of the CAR of use in the invention is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed in.
  • effector function refers to a specialized function of a cell.
  • the effector function of a T cell for example, may be cytolytic activity or helper activity, including the secretion of cytokines.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • intracellular signaling domains for use in the CAR of use in the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
  • TCR T cell receptor
  • co-receptors that act in concert to initiate signal transduction following antigen receptor engagement
  • T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic signaling sequences).
  • Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing primary intracellular signaling domains examples include those of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta , CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
  • a CAR of use in the invention comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3-zeta.
  • the cytoplasmic domain of the CAR is designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of use in the invention.
  • the cytoplasmic domain of the CAR can comprise a CD3 zeta chain portion and a costimulatory signaling region.
  • the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
  • Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
  • costimulatory molecules include CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT
  • cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR of use in the invention may be linked to each other in a random or specified order.
  • a short oligo- or polypeptide linker for example, between 2 and 10 amino acids in length may form the linkage.
  • a glycine-serine doublet provides a particularly suitable linker.
  • Exemplary glycine-serine linkers are listed in Table 2, e.g., SEQ ID NOs: 22, 24, 25, 26, or 27.
  • the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28. In one aspect, the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of 4-1BB. In one aspect, the signaling domain of 4-1BB is a signaling domain set forth in SEQ ID NO: 14. In one aspect, the signaling domain of CD3-zeta is a signaling domain set forth in SEQ ID NO: 18 or SEQ ID NO: 20.
  • a regulatable CAR where the CAR activity can be controlled is desirable to optimize the safety and efficacy of a CAR therapy.
  • An RCAR can be used substituted for a CAR in any of the embodiments described herein.
  • a RCAR comprises a set of polypeptides, typically two in the simplest embodiments, in which the components of a standard CAR described herein, e.g., an antigen binding domain and an intracellular signaling domain, are partitioned on separate polypeptides or members.
  • the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
  • an RCAR comprises two polypeptides or members: 1) an intracellular signaling member comprising an intracellular signaling domain, e.g., a primary intracellular signaling domain described herein, and a first switch domain; 2) an antigen binding member comprising an antigen binding domain, e.g., that targets a tumor antigen, as described herein and a second switch domain.
  • the RCAR comprises a transmembrane domain described herein.
  • a transmembrane domain can be disposed on the intracellular signaling member, on the antigen binding member, or on both.
  • the order is as set out in the text, but in other embodiments, the order can be different.
  • the order of elements on one side of a transmembrane region can be different from the example, e.g., the placement of a switch domain relative to a intracellular signaling domain can be different, e.g., reversed).
  • the first and second switch domains can form an intracellular or an extracellular dimerization switch.
  • the dimerization switch can be a homodimerization switch, e.g., where the first and second switch domain are the same, or a heterodimerization switch, e.g., where the first and second switch domain are different from one another.
  • an RCAR can comprise a "multi switch.”
  • a multi switch can comprise heterodimerization switch domains or homodimerization switch domains.
  • a multi switch comprises a plurality of, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10, switch domains, independently, on a first member, e.g., an antigen binding member, and a second member, e.g., an intracellular signaling member.
  • the first member can comprise a plurality of first switch domains, e.g., FKBP-based switch domains
  • the second member can comprise a plurality of second switch domains, e.g., FRB-based switch domains.
  • the first member can comprise a first and a second switch domain, e.g., a FKBP-based switch domain and a FRB-based switch domain
  • the second member can comprise a first and a second switch domain, e.g., a FKBP-based switch domain and a FRB-based switch domain.
  • the intracellular signaling member comprises one or more intracellular signaling domains, e.g., a primary intracellular signaling domain and one or more costimulatory signaling domains.
  • the antigen binding member may comprise one or more intracellular signaling domains, e.g., one or more costimulatory signaling domains.
  • the antigen binding member comprises a plurality, e.g., 2 or 3 costimulatory signaling domains described herein, e.g., selected from 41BB, CD28, CD27, ICOS, and OX40, and in embodiments, no primary intracellular signaling domain.
  • the antigen binding member comprises the following costimulatory signaling domains, from the extracellular to intracellular direction: 41BB-CD27; 41BB-CD27; CD27-41BB; 41BB-CD28; CD28-41BB; OX40-CD28; CD28-OX40; CD28-41BB; or 41BB-CD28.
  • the intracellular binding member comprises a CD3zeta domain.
  • the RCAR comprises (1) an antigen binding member comprising, an antigen binding domain, a transmembrane domain, and two costimulatory domains and a first switch domain; and (2) an intracellular signaling domain comprising a transmembrane domain or membrane tethering domain and at least one primary intracellular signaling domain, and a second switch domain.
  • An embodiment utilises RCARs wherein the antigen binding member is not tethered to the surface of the CAR cell. This allows a cell having an intracellular signaling member to be conveniently paired with one or more antigen binding domains, without transforming the cell with a sequence that encodes the antigen binding member.
  • the RCAR comprises: 1) an intracellular signaling member comprising: a first switch domain, a transmembrane domain, an intracellular signaling domain, e.g., a primary intracellular signaling domain, and a first switch domain; and 2) an antigen binding member comprising: an antigen binding domain, and a second switch domain, wherein the antigen binding member does not comprise a transmembrane domain or membrane tethering domain, and, optionally, does not comprise an intracellular signaling domain.
  • the RCAR may further comprise 3) a second antigen binding member comprising: a second antigen binding domain, e.g., a second antigen binding domain that binds a different antigen than is bound by the antigen binding domain; and a second switch domain.
  • the antigen binding member comprises bispecific activation and targeting capacity.
  • the antigen binding member can comprise a plurality, e.g., 2, 3, 4, or 5 antigen binding domains, e.g., scFvs, wherein each antigen binding domain binds to a target antigen, e.g. different antigens or the same antigen, e.g., the same or different epitopes on the same antigen.
  • the plurality of antigen binding domains are in tandem, and optionally, a linker or hinge region is disposed between each of the antigen binding domains. Suitable linkers and hinge regions are described herein.
  • an embodiment utilises RCARs having a configuration that allows switching of proliferation.
  • the RCAR comprises: 1) an intracellular signaling member comprising: optionally, a transmembrane domain or membrane tethering domain; one or more co-stimulatory signaling domain, e.g., selected from 41BB, CD28, CD27, ICOS, and OX40, and a switch domain; and 2) an antigen binding member comprising: an antigen binding domain, a transmembrane domain, and a primary intracellular signaling domain, e.g., a CD3zeta domain, wherein the antigen binding member does not comprise a switch domain, or does not comprise a switch domain that dimerizes with a switch domain on the intracellular signaling member.
  • an intracellular signaling member comprising: optionally, a transmembrane domain or membrane tethering domain; one or more co-stimulatory signaling domain, e.g., selected from 41BB, CD28, CD27, ICOS,
  • the antigen binding member does not comprise a co-stimulatory signaling domain.
  • the intracellular signaling member comprises a switch domain from a homodimerization switch.
  • the intracellular signaling member comprises a first switch domain of a heterodimerization switch and the RCAR comprises a second intracellular signaling member which comprises a second switch domain of the heterodimerization switch.
  • the second intracellular signaling member comprises the same intracellular signaling domains as the intracellular signaling member.
  • the dimerization switch is intracellular. In an embodiment, the dimerization switch is extracellular.
  • the first and second switch domains comprise a FKBP-FRB based switch as described herein.
  • RCARX cell Any cell that is engineered to express a RCAR can be used as a RCARX cell.
  • the RCARX cell is a T cell, and is referred to as a RCART cell.
  • the RCARX cell is an NK cell, and is referred to as a RCARN cell.
  • nucleic acids and vectors comprising RCAR encoding sequences.
  • Sequence encoding various elements of an RCAR can be disposed on the same nucleic acid molecule, e.g., the same plasmid or vector, e.g., viral vector, e.g., lentiviral vector.
  • sequence encoding an antigen binding member and sequence encoding an intracellular signaling member can be present on the same nucleic acid, e.g., vector.
  • a sequence encoding a cleavable peptide e.g., a P2A or F2A sequence
  • a sequence encoding an IRES e.g., an EMCV or EV71 IRES
  • a first promoter is operably linked to (i) and a second promoter is operably linked to (ii), such that (i) and (ii) are transcribed as separate mRNAs.
  • sequence encoding various elements of an RCAR can be disposed on the different nucleic acid molecules, e.g., different plasmids or vectors, e.g., viral vector, e.g., lentiviral vector.
  • the (i) sequence encoding an antigen binding member can be present on a first nucleic acid, e.g., a first vector
  • the (ii) sequence encoding an intracellular signaling member can be present on the second nucleic acid, e.g., the second vector.
  • Dimerization switches can be non-covalent or covalent.
  • the dimerization molecule promotes a non-covalent interaction between the switch domains.
  • the dimerization molecule promotes a covalent interaction between the switch domains.
  • the RCAR comprises a FKBP/FRAP, or FKBP/FRB,-based dimerization switch.
  • FKBP12 FKBP, or FK506 binding protein
  • FKBP FKBP
  • Rapamycin binds to FKBP and to the large PI3K homolog FRAP (RAFT, mTOR).
  • FRB is a 93 amino acid portion of FRAP, that is sufficient for binding the FKBP-rapamycin complex ( Chen, J., Zheng, X. F., Brown, E. J. & Schreiber, S. L.
  • an FKBP/FRAP e.g., an FKBP/FRB
  • a dimerization molecule e.g., rapamycin or a rapamycin analog.
  • amino acid sequence of FKBP is as follows:
  • an FKBP switch domain can comprise a fragment of FKBP having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, e.g., the underlined portion of SEQ ID NO: 37, which is:
  • amino acid sequence of FRB is as follows:
  • FKBP/FRAP e.g., an FKBP/FRB, based switch
  • a dimerization switch comprising: a first switch domain, which comprises an FKBP fragment or analog thereof having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, e.g., RAD001, and has at least 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identity with, or differs by no more than 30, 25, 20, 15, 10, 5, 4, 3, 2, or 1 amino acid residues from, the FKBP sequence of SEQ ID NO: 18 or 19; and a second switch domain, which comprises an FRB fragment or analog thereof having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, and has at least 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identity
  • the FKBP/FRB dimerization switch comprises a modified FRB switch domain that exhibits altered, e.g., enhanced, complex formation between an FRB-based switch domain, e.g., the modified FRB switch domain, a FKBP-based switch domain, and the dimerization molecule, e.g., rapamycin or a rapalogue, e.g., RAD001.
  • an FRB-based switch domain e.g., the modified FRB switch domain, a FKBP-based switch domain
  • the dimerization molecule e.g., rapamycin or a rapalogue, e.g., RAD001.
  • the modified FRB switch domain comprises one or more mutations, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, selected from mutations at amino acid position(s) L2031, E2032, S2035, R2036, F2039, G2040, T2098, W2101, D2102, Y2105, and F2108, where the wild-type amino acid is mutated to any other naturally-occurring amino acid.
  • mutations e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, selected from mutations at amino acid position(s) L2031, E2032, S2035, R2036, F2039, G2040, T2098, W2101, D2102, Y2105, and F2108, where the wild-type amino acid is mutated to any other naturally-occurring amino acid.
  • a mutant FRB comprises a mutation at E2032, where E2032 is mutated to phenylalanine (E2032F), methionine (E2032M), arginine (E2032R), valine (E2032V), tyrosine (E2032Y), isoleucine (E2032I), e.g., SEQ ID NO: 40, or leucine (E2032L), e.g., SEQ ID NO: 41.
  • a mutant FRB comprises a mutation at T2098, where T2098 is mutated to phenylalanine (T2098F) or leucine (T2098L), e.g., SEQ ID NO: 42.
  • a mutant FRB comprises a mutation at E2032 and at T2098, where E2032 is mutated to any amino acid, and where T2098 is mutated to any amino acid, e.g., SEQ ID NO: 43.
  • a mutant FRB comprises an E2032I and a T2098L mutation, e.g., SEQ ID NO: 44.
  • a mutant FRB comprises an E2032L and a T2098L mutation, e.g., SEQ ID NO: 45.
  • Table 1 Exemplary mutant FRB having increased affinity for a dimerization molecule.
  • FRB mutant Amino Acid Sequence SEQ ID NO: E2032I mutant 40 E2032L mutant 41 T2098L mutant 42 E2032, T2098 mutant 43 E2032I, T2098L mutant 44 E2032L, T2098L mutant 45
  • dimerization switches include a GyrB-GyrB based dimerization switch, a Gibberellin-based dimerization switch, a tag/binder dimerization switch, and a halo-tag/snap-tag dimerization switch. Following the guidance provided herein, such switches and relevant dimerization molecules will be apparent to one of ordinary skill.
  • association between the switch domains is promoted by the dimerization molecule.
  • association or association between switch domains allows for signal transduction between a polypeptide associated with, e.g., fused to, a first switch domain, and a polypeptide associated with, e.g., fused to, a second switch domain.
  • signal transduction is increased by 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 5, 10, 50, 100 fold, e.g., as measured in a system described herein.
  • Rapamycin and rapamycin analogs can be used as dimerization molecules in a FKBP/FRB-based dimerization switch described herein.
  • the dimerization molecule can be selected from rapamycin (sirolimus), RAD001 (everolimus), zotarolimus, temsirolimus, AP-23573 (ridaforolimus), biolimus, simapimo, XI,765, AP21967, and analogs or derivatives thereof.
  • the present invention also provides nucleic acids, e.g., DNA or RNA constructs, encoding ETPs for co-delivery with nucleic acids, e.g., DNA or RNA constructs, encoding CARs.
  • the ETPs of use in the invention enhance the CAR-expressing T cell's antigen presentation and T cell priming activities, leading to enhanced anti-disease effects.
  • ETP e.g., ETP DNAs or ETP RNAs
  • CAR e.g., CAR RNA or CAR ETP into a T cell
  • An ETP may be a costimulatory molecule.
  • Exemplary costimulatory molecules include, but are not limited to, CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, and functional fragments and variants thereof.
  • the invention utilises an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure which do not utilise such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention.
  • the ETP comprises an amino acid sequence of CD70 (e.g., GenBank Acc. No. NP_001243.1), or a nucleic acid sequence of CD70 (e.g., GenBank Acc. No. NM_001252.4).
  • an ETP comprises an amino acid sequence of CD83 (e.g., GenBank Acc. No. AAH30830.1), or a nucleic acid sequence of CD83 (e.g., GenBank Acc. No. BC030830.1).
  • an ETP comprises an amino acid sequence of CD80 (e.g., GenBank Acc. No. AAH42665.1), or a nucleic acid sequence of CD80 (e.g., GenBank Acc. No.
  • the ETP comprises an amino acid sequence of CD86 (e.g., GenBank Acc. No. AAB03814.1), or a nucleic acid sequence of CD86 (e.g., GenBank Acc. No. U04343.1).
  • an ETP comprises an amino acid sequence of CD40 (e.g., GenBank Acc. No. AAH64518.1, or AAH12419.1), or a nucleic acid sequence of CD40 (e.g., GenBank Acc. No. BC064518.1 or BC012419.1).
  • an ETP comprises an amino acid sequence of CD154 (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of CD137L (4-1BBL) (e.g., GenBank Acc. No. NP_003802.1), or a nucleic acid sequence of CD137L (4-1BBL) (e.g., GenBank Acc. No. NM_003811.3).
  • the ETP comprises an amino acid sequence of CD252 (OX40L) (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of CD275 (ICOSL) (e.g., GenBank Acc. No. AAH20674.1), or a nucleic acid sequence of CD275 (ICOSL) (e.g., GenBank Acc. No. BC020674.1).
  • an ETP comprises an amino acid sequence of CD54 (ICAM-1) (e.g., GenBank Acc. No. AAP35500.1 or CAA41977.1), or a nucleic acid sequence of CD54 (ICAM-1) (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of CD49a (e.g., GenBank Acc. No.AAI37123.1), or a nucleic acid sequence of CD49a (e.g., GenBank Acc. No. BC137122.1).
  • an ETP comprises an amino acid sequence of CD43 (e.g., GenBank Acc. No. NP_001025459.1 or AAB20910.1), or a nucleic acid sequence of CD43 (e.g., GenBank Acc. No. NM_001030288.2 or AAB20910.1).
  • an ETP comprises an amino acid sequence of CD48 (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of CD112 (PVRL2) (e.g., GenBank Acc. No. CAG33099.1), or a nucleic acid sequence of CD112 (PVRL2) (e.g., GenBank Acc. No. CR456818.1).
  • an ETP comprises an amino acid sequence of CD150 (SLAM) (e.g., GenBank Acc. No. NP_003028.1), or a nucleic acid sequence of CD150 (SLAM) (e.g., GenBank Acc. No. NM_003037.3).
  • an ETP comprises an amino acid sequence of CD155 (PVR) (e.g., GenBank Acc. No. NP_006496.4), or a nucleic acid sequence of CD155 (PVR) (e.g., GenBank Acc. No. NM_006505.4).
  • an ETP comprises an amino acid sequence of CD265 (RANK) (e.g., GenBank Acc. No. Q9Y6Q6.1), or a nucleic acid sequence of CD265 (RANK) (e.g., GenBank Acc. No. AF018253.1).
  • an ETP comprises an amino acid sequence of CD270 (HVEM) (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of TL1A (e.g., GenBank Acc. No. AAI04464.1), or a nucleic acid sequence of TL1A (e.g., GenBank Acc. No. BC104463.1).
  • an ETP comprises an amino acid sequence of CD127 (e.g., GenBank Acc. No. AAH69999.1), or a nucleic acid sequence of CD127 (e.g., GenBank Acc. No. BC069999.1).
  • an ETP comprises an amino acid sequence of GITR-L (e.g., GenBank Acc. No. AAQ89227.1), or a nucleic acid sequence of GITR-L (e.g., GenBank Acc. No. AY358868.1).
  • an ETP comprises an amino acid sequence of CD160 (e.g., GenBank Acc. No. CAG46665.1), or a nucleic acid sequence of CD160 (e.g., GenBank Acc. No. CR541867.1).
  • an ETP comprises an amino acid sequence of CD258 (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of TIM-4 (e.g., GenBank Acc. No. AFO66594.1), or a nucleic acid sequence of TIM-4 (e.g., GenBank Acc. No.JX049980.1).
  • an ETP comprises an amino acid sequence of CD153 (CD30L) (e.g., GenBank Acc. No. AAI11940.1), or a nucleic acid sequence ofCD153 (CD30L) (e.g., GenBank Acc. No.BC111939.1).
  • an ETP comprises an amino acid sequence of CD200R (OX2R) (e.g., GenBank Acc. No. AAI43394.1), or a nucleic acid sequence of CD200R (OX2R) (e.g., GenBank Acc. No. BC143393.1).
  • an ETP comprises an amino acid sequence of CD44 (e.g., GenBank Acc. No. ACI46596.1), or a nucleic acid sequence of CD44 (e.g., GenBank Acc. No. FJ21664.1).
  • An ETP may be a soluble cytokine.
  • exemplary soluble cytokines include, but are not limited to, IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, and IL-27, and functional fragments and variants thereof.
  • an ETP comprises an amino acid sequence of interleukin 2 (IL-2) (e.g., GenBank Acc. No. AAB46833.1), or a nucleic acid sequence of IL-2 (e.g., GenBank Acc. No. S82692.1).
  • an ETP comprises an amino acid sequence of interleukin 12 (IL-12) (e.g., GenBank Acc. No. AAD16432.1), or a nucleic acid sequence of IL-12 (e.g., GenBank Acc. No. AF101062.1).
  • an ETP comprises an amino acid sequence of interleukin 6 (IL-6) (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of interleukin 7 (IL-7) (e.g., GenBank Acc. No. AAH47698.1 or NP_000871.1), or a nucleic acid sequence of IL-7 (e.g., GenBank Acc. No. BC047698.1 or NM_000880.3).
  • an ETP comprises an amino acid sequence of interleukin 15 (IL-15) (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of interleukin 18 (IL-18) (e.g., GenBank Acc. No. AAK95950.1), or a nucleic acid sequence of IL-18 (e.g., GenBank Acc. No. AY044641.1).
  • an ETP comprises an amino acid sequence of interleukin 21 (IL-21) (e.g., GenBank Acc. No. AAG29348.1), or a nucleic acid sequence of IL-21 (e.g., GenBank Acc. No. AF254069.1).
  • an ETP comprises an amino acid sequence of GM-CSF (e.g., GenBank Acc. No. AAA52578.1), or a nucleic acid sequence of GM-CSF (e.g., GenBank Acc. No. M11220.1).
  • An ETP may be a polypeptide involved in antigen presentation.
  • Exemplary polypeptides involved in antigen presentation include, but are not limited to, CD64, MHC I, and MHC II, and functional fragments and variants thereof.
  • an ETP comprises an amino acid sequence of CD64 (e.g., GenBank Acc. No. AAI52384.1), or a nucleic acid sequence of CD64 (e.g., GenBank Acc. No. BC152383.1).
  • an ETP comprises an amino acid sequence of MHCI (e.g., GenBank Acc. No. AAH40479.1), or a nucleic acid sequence of MHCI (e.g., GenBank Acc. No. BC040479.1).
  • An ETP may be a polypeptide involved in trafficking and/or migration.
  • Exemplary polypeptides involved in trafficking and/or migration include, but are not limited to, CD183, CCR2, CCR6, CD50, CD197, CD58, and CD62L, and functional fragments and variants thereof.
  • an ETP comprises an amino acid sequence of CD183 (e.g., GenBank Acc. No. AAH34403.1), or a nucleic acid sequence of CD183 (e.g., GenBank Acc. No. BC034403.1).
  • an ETP comprises an amino acid sequence of CCR2 (e.g., GenBank Acc. No. AAH95540.1), or a nucleic acid sequence of CCR2 (e.g., GenBank Acc. No. BC095540.1).
  • an ETP comprises an amino acid sequence of CCR6 (e.g., GenBank Acc. No. NP_113597.2), or a nucleic acid sequence of CCR6 (e.g., GenBank Acc.
  • an ETP comprises an amino acid sequence of CD50 (e.g., GenBank Acc. No. AAH58903.1), or a nucleic acid sequence of CD50 (e.g., GenBank Acc. No. BC058903.1).
  • an ETP comprises an amino acid sequence of CD197 (e.g., GenBank Acc. No. NP_001829.1), or a nucleic acid sequence of CD197 (e.g., GenBank Acc. No. NM_001838.3).
  • an ETP comprises an amino acid sequence of CD58 (e.g., GenBank Acc. No.
  • an ETP comprises an amino acid sequence of CD62L (e.g., GenBank Acc. No. AAH20758.1), or a nucleic acid sequence of CD62L (e.g., GenBank Acc. No. BC020758.1).
  • An ETP may be a polypeptide involved in dendritic cell targeting.
  • Exemplary polypeptides involved in dendritic cell targeting include TLR ligands, anti-DEC-205 antibody, and anti-DC-SIGN antibody, and functional fragments and variants thereof.
  • more than 1, such as 2, 3, 4, 5, 6 or more ETPs are co-delivered with a nucleic acid sequence encoding a CAR, e.g., a CAR RNA, into a T cell.
  • the co-delivery of 1 or more ETPs does not affect, e.g., substantially decrease or substantitally inhibit, the expression or activity of the co-delivered or co-expressed CAR in the ETP-CAR T cell, e.g., RNA ETP-CAR T cell.
  • the co-delivery of a CAR does not affect, e.g., substantially decrease or substantially inhibit, the expression or activity of the co-delivered or co-expressed ETP or ETPs.
  • Candidate molecules i.e., candidate ETPs
  • T cell priming activity alone or in conjunction with a CAR using assays described in the Examples.
  • An ETP may comprise an amino acid sequence with at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to, or which differs by no more than 30, 25, 20, 15, 10 or 5 amino acid residues from, an ETP described herein, or a functional fragment thereof, or a naturally occurring ETP, e.g., a naturally occurring ETP described herein, e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to an ETP described herein, or a functional fragment thereof.
  • a naturally occurring ETP e.g., a naturally occurring ETP described herein,
  • Percent identity in the context of two or more nucleic acids or polypeptide sequences refers to two or more sequences that are the same. Two sequences are "substantially identical" if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 70%, 71%, 72%.
  • the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math. 2:482c , by the homology alignment algorithm of Needleman and Wunsch, (1970) J.
  • BLAST and BLAST 2.0 algorithms Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nuc. Acids Res. 25:3389-3402 ; and Altschul et al., (1990) J. Mol. Biol. 215:403-410 , respectively.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
  • the percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller, (1988) Comput. Appl. Biosci. 4:11-17 ) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (1970) J. Mol. Biol.
  • Functional variants of an ETP provided herein may comprise one or more mutations, such that the variant retains some level of T cell priming activity of the ETP described herein.
  • the functional variant may have at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%) of the T cell priming activity as the corresponding naturally occurring or parental ETP.
  • the functional variant may have at least 200%, at least 300%, at least 400%, at least 500%, at least 1000% or more of the T cell priming activity as the corresponding naturally occurring or parental ETP.
  • the mutations present in a functional variant include amino acid substitutions, additions, and deletions. Mutations can be introduced by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. The mutation may be a conservative amino acid substitution, in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • An ETP may comprise a functional fragment of a naturally occurring ETP, e.g., an ETP disclosed herein.
  • the functional fragment may comprise at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95% of the amino acid residues of the naturally occurring ETP.
  • the ETP comprises a domain or a functional fragment of a domain of an ETP disclosed herein, that comprises T cell priming activity.
  • the nucleic acid encoding the CAR or ETP to be introduced into a T cell is a DNA molecule (e.g., a cDNA molecule).
  • the nucleic acid encoding the CAR and/or ETP to be introduced into a T cell is an RNA molecule.
  • the RNA is generated by in vitro transcription.
  • the RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template.
  • PCR polymerase chain reaction
  • DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase.
  • the source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA.
  • RNA so produced can efficiently transfect different kinds of cells.
  • the template includes sequences for the CAR and/or the ETP.
  • the in vitro transcribed RNA CAR and/or RNA ETP can be introduced to a cell as a form of transient transfection.
  • the RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template.
  • DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase.
  • the source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA.
  • the desired template for in vitro transcription is a CAR or ETP described herein.
  • the template for the RNA CAR comprises an extracellular region comprising a single chain variable domain of an antibody to a tumor associated antigen described herein; a hinge region (e.g., a hinge region described herein), a transmembrane domain (e.g., a transmembrane domain described herein such as a transmembrane domain of CD8a); and a cytoplasmic region that includes an intracellular signaling domain, e.g., an intracellular signaling domain described herein, e.g., comprising the signaling domain of CD3-zeta and the signaling domain of 4-1BB.
  • an intracellular signaling domain e.g., an intracellular signaling domain described herein, e.g., comprising the signaling domain of CD3-zeta and the signaling domain of 4-1BB.
  • the template for in vitro transcription is the CAR of use in the present invention.
  • the template for the RNA CAR comprises an extracellular domain comprising a single chain variable domain of an antibody of interest (e.g., an anti-tumor antibody); a transmembrane domain (e.g., from the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154); and one or more intracellular signaling domains (e.g., 4-1BB, CD3-zeta).
  • an antibody of interest e.g., an anti-tumor antibody
  • a transmembrane domain e.g., from the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16
  • the template for in vitro transcription is a ETP.
  • a template for ETP may comprise the nucleic acid sequence encoding a costimulatory molecule (e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, or functional fragments or variants thereof), a soluble cytokine (e.g., IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-C
  • the T cells comprise a nucleic acid encoding an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • the DNA to be used for PCR contains an open reading frame.
  • the DNA can be from a naturally occurring DNA sequence from the genome of an organism.
  • the DNA is a full length gene of interest of a portion of a gene.
  • the gene can include some or all of the 5' and/or 3' untranslated regions (UTRs).
  • the gene can include exons and introns.
  • the DNA to be used for PCR is a human gene.
  • the DNA to be used for PCR is a human gene including the 5' and 3' UTRs.
  • the DNA can alternatively be an artificial DNA sequence that is not normally expressed in a naturally occurring organism.
  • An exemplary artificial DNA sequence is one that contains portions of genes that are ligated together to form an open reading frame that encodes a fusion protein. The portions of DNA that are ligated together can be from a single organism or from more than one organism.
  • Genes that can be used as sources of DNA for PCR include genes that encode polypeptides that provide a therapeutic or prophylactic effect to an organism or that can be used to diagnose a disease or disorder in an organism.
  • Preferred genes are genes which are useful for a short term treatment, or where there are safety concerns regarding dosage or the expressed gene.
  • the transgene(s) to be expressed may encode a polypeptide that functions as a ligand or receptor for cells of the immune system, or can function to stimulate or inhibit the immune system of an organism. It is not desirable to have prolonged ongoing stimulation of the immune system, nor necessary to produce changes which last after successful treatment, since this may then elicit a new problem.
  • PCR is used to generate a template for in vitro transcription of mRNA which is used for transfection.
  • Methods for performing PCR are well known in the art.
  • Primers for use in PCR are designed to have regions that are substantially complementary to regions of the DNA to be used as a template for the PCR.
  • Any DNA polymerase useful for PCR can be used in the methods disclosed herein.
  • the reagents and polymerase are commercially available from a number of sources.
  • the RNA preferably has 5' and 3' UTRs.
  • the 5' UTR is between zero and 3000 nucleotides in length.
  • the length of 5' and 3' UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5' and 3' UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.
  • the 5' and 3' UTRs can be the naturally occurring, endogenous 5' and 3' UTRs for the gene of interest.
  • UTR sequences that are not endogenous to the gene of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template.
  • the use of UTR sequences that are not endogenous to the gene of interest can be useful for modifying the stability and/or translation efficiency of the RNA. For example, it is known that AU-rich elements in 3' UTR sequences can decrease the stability of mRNA. Therefore, 3' UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
  • the 5' UTR can contain the Kozak sequence of the endogenous gene.
  • a consensus Kozak sequence can be redesigned by adding the 5' UTR sequence.
  • Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many mRNAs is known in the art.
  • the 5' UTR can be derived from an RNA virus whose RNA genome is stable in cells.
  • various nucleotide analogues can be used in the 3' or 5' UTR to impede exonuclease degradation of the mRNA.
  • a promoter of transcription should be attached to the DNA template upstream of the sequence to be transcribed.
  • the RNA polymerase promoter becomes incorporated into the PCR product upstream of the open reading frame that is to be transcribed.
  • the promoter is a T7 polymerase promoter, as described elsewhere herein.
  • Other useful promoters include, but are not limited to, T3 and SP6 RNA polymerase promoters. Consensus nucleotide sequences for T7, T3 and SP6 promoters are known in the art.
  • the mRNA has both a cap on the 5' end and a 3' poly(A) tail which determine ribosome binding, initiation of translation and stability mRNA in the cell.
  • RNA polymerase produces a long concatameric product which is not suitable for expression in eukaryotic cells.
  • the transcription of plasmid DNA linearized at the end of the 3' UTR results in normal sized mRNA which is not effective in eukaryotic transfection even if it is polyadenylated after transcription.
  • phage T7 RNA polymerase can extend the 3' end of the transcript beyond the last base of the template ( Schenbom and Mierendorf, Nuc Acids Res., 13 :6223-36 (1985 ); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65 (2003 ).
  • PolyA/T stretches can be integrated into a DNA template (e.g., a plasmid) by molecular cloning.
  • the polyA/T segment of the transcriptional DNA template can be produced during PCR by using a reverse primer containing a polyT tail, such as 100T tail (size can be 50-5000 T), or after PCR by any other method, including, but not limited to, DNA ligation or in vitro recombination.
  • Poly(A) tails also provide stability to RNAs and reduce their degradation. Generally, the length of a poly(A) tail positively correlates with the stability of the transcribed RNA. In one embodiment, the poly(A) tail is between 100 and 5000 adenosines.
  • Poly(A) tails of RNAs can be further extended following in vitro transcription with the use of a poly(A) polymerase, such as E. coli polyA polymerase (E-PAP).
  • E-PAP E. coli polyA polymerase
  • increasing the length of a poly(A) tail from 100 nucleotides to between 300 and 400 nucleotides results in about a two-fold increase in the translation efficiency of the RNA.
  • the attachment of different chemical groups to the 3' end can increase mRNA stability. Such attachment can contain modified/artificial nucleotides, aptamers and other compounds.
  • ATP analogs can be incorporated into the poly(A) tail using poly(A) polymerase. ATP analogs can further increase the stability of the RNA.
  • RNAs produced by the methods disclosed herein include a 5' cap.
  • the 5' cap is provided using techniques known in the art and described herein ( Cougot, et al, Trends in Biochem. Sci., 29:436-444 (2001 ); Stepinski, et al, RNA, 7: 1468-95 (2001 ); Elango, et al, Biochim. Biophys. Res. Commun., 330:958-966 (2005 )).
  • RNAs produced by the methods disclosed herein can also contain an internal ribosome entry site (IRES) sequence.
  • IRES sequence may be any viral, chromosomal or artificially designed sequence which initiates cap-independent ribosome binding to mRNA and facilitates the initiation of translation. Any solutes suitable for cell electroporation, which can contain factors facilitating cellular permeability and viability such as sugars, peptides, lipids, proteins, antioxidants, and surfactants can be included.
  • the present invention includes synthetic RNA and RNA-like analogs encoding the CARs and ETPs of use in the invention. That is, the present invention includes CAR-and ETP-encoding RNA and RNA-like constructs manufactured in any method known in the art, including, for example IVT RNA and synthesized RNA.
  • RNA is synthesized through known methods of oligonucleotide synthesis. Methods of oligonucleotide synthesis include, for example, H-phosphonate synthesis, phosphodiester synthesis, phosphotriester synthesis, phosphite triester synthesis, and the phosphoramidite method.
  • RNA of use in the invention comprises a nucleotide/nucleoside derivative or analog.
  • one type of analog is LNA, such as beta-D-oxy-LNA, alpha-L-oxy-LNA, beta-D-amino-LNA and beta-D-thio-LNA, and beta-D-oxy-LNA.
  • Patent Application Publication No.: 2010/0324278 U.S. Patent Application Publication No.: 2010/0137010 , and PCT International Publication No.: WO 2007/031081 .
  • the present invention includes CAR- and ETP-encoding RNA and RNA-like constructs manufactured via methods heretofore unknown, provided that the constructs comprise a sequence which encodes the components of the CAR or ETP described herein.
  • RNA or DNA can be introduced into target cells using any of a number of different methods, for instance, commercially available methods which include, but are not limited to, electroporation (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) or the Gene Pulser II (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg Germany), cationic liposome mediated transfection using lipofection, polymer encapsulation, peptide mediated transfection, or biolistic particle delivery systems such as "gene guns” (see, for example, Nishikawa, et al. Hum Gene Ther., 12(8):861-70 (2001 ).
  • the present invention may utilise vectors in which a DNA of use in the present invention is inserted.
  • Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
  • Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
  • the vector comprising the nucleic acid encoding the desired CAR of use in the invention is an adenoviral vector (A5/35).
  • the expression of nucleic acids encoding CARs can be accomplished using of transposons such as sleeping beauty, crisper, CAS9, and zinc finger nucleases. See below June et al. 2009Nature Reviews Immunology 9.10: 704-716 .
  • the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
  • the vectors can be suitable for replication and integration eukaryotes.
  • Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
  • the expression constructs of use in the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346 , 5,580,859 , 5,589,466 . In another embodiment, the invention may utilise a gene therapy vector.
  • the nucleic acid can be cloned into a number of types of vectors.
  • the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
  • Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • the expression vector may be provided to a cell in the form of a viral vector.
  • Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1 -4, Cold Spring Harbor Press, NY ), and in other virology and molecular biology manuals.
  • Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno- associated viruses, herpes viruses, and lentiviruses.
  • a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584 ; WO 01/29058 ; and U.S. Pat. No. 6,326,193 ).
  • retroviruses provide a convenient platform for gene delivery systems.
  • a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
  • the recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.
  • retroviral systems are known in the art.
  • retrovirus vectors are used.
  • adenovirus vectors are used.
  • a number of adenovirus vectors are known in the art.
  • lentivirus vectors are used.
  • promoter elements regulate the frequency of transcriptional initiation.
  • these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • tk thymidine kinase
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • individual elements can function either cooperatively or independently to activate transcription.
  • Exemplary promoters include the CMV IE gene, EF-1 ⁇ , ubiquitin C, or phosphoglycerokinase (PGK) promoters.
  • EDP-CAR T cells Engineered T Cells
  • T cells comprising one or more, e.g., one, two, or more, nucleic acid molecules comprising a nucleic acid sequence encoding a CAR described herein and a nucleic acid sequence encoding an ETP described herein.
  • the T cells comprise a nucleic acid encoding an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • the nucleic acid comprises both the nucleic acid sequence encoding a CAR described herein and the nucleic acid sequence encoding an ETP in accordance with the claims, e.g., the nucleic acid sequences comprising the CAR and the ETP are disposed on the same nucleic acid molecule.
  • the nucleic acid comprises two nucleic acid molecules, wherein the nucleic acid sequence encoding a CAR described herein is disposed on one nucleic acid molecule and the nucleic acid sequence encoding an ETP in accordance with the claims is disposed on the other nucleic acid molecule.
  • the nucleic acid molecule comprises RNA.
  • both nucleic acid molecules comprise RNA.
  • one nucleic acid molecule may comprise RNA and the other nucleic acid molecule may comprise DNA.
  • nucleic acid sequences encoding a CAR and the nucleic acid sequences encoding an ETP comprise RNA.
  • the nucleic acid sequence encoding the CAR can comprise RNA and the nucleic acid sequence encoding the ETP can comprise DNA.
  • the nucleic acid sequence encoding the CAR can comprise DNA and the nucleic acid sequence encoding the ETP can comprise RNA.
  • the nucleic acid sequence encoding a CAR comprises DNA, e.g., a vector, e.g., a viral vector
  • the CAR comprises an extracellular domain, e.g., an antigen binding domain described herein, a transmembrane domain, and two or more intracellular signaling domains, e.g., a primary signaling domain and a costimulatory signaling domain.
  • the CAR comprises a primary signaling domain, e.g., a CD3 zeta domain as described herein, and a costimulatory signaling domain, e.g., a 4-1BB domain as described herein.
  • the CAR comprises one or more additional intracellular signaling domains, e.g., 1, 2, 3, 4, or 5 additional costimulatory signaling domains as described herein.
  • the CAR may be a regulatable CAR, e.g., an RCAR described herein, in which the CAR activity can be controlled, e.g., by administering or withdrawing the dimerization molecule.
  • the CAR activity may be transient, while the antigen presenting or T cell priming activity is prolonged, and results in a more long lasting immune response against the disease.
  • the T cell comprises a nucleic acid sequence encoding a CAR described herein and two or more, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more nucleic acid sequences encoding an ETP, wherein the nucleic acid sequences encode different ETPs described herein.
  • the T cells comprise a nucleic acid encoding an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • each nucleic acid sequence encoding the ETPs can be present on the same nucleic acid molecule or on different nucleic acid molecules.
  • Two or more nucleic acid sequences encoding ETPs e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more, can be disposed on the same nucleic acid molecule.
  • the T cell comprises three nucleic acid sequences encoding ETPs
  • two of the nucleic acid sequences encoding ETPs can be disposed on one nucleic acid molecule
  • one nucleic acid sequence encoding an ETP can be disposed on another nucleic acid molecule.
  • the nucleic acid sequence encoding a CAR described herein can be disposed on a nucleic acid molecule further comprising one or more nucleic acid sequences encoding an ETP.
  • the nucleic acid sequence encoding a CAR described herein is disposed on a nucleic acid molecule that does not comprise a nucleic acid sequence encoding an ETP.
  • the RNA molecule(s) are transfected, e.g., electroporated, into the T cell using standard transfection methods and reagents known in the art.
  • the DNA molecule(s) can be introduced, e.g., by transfection, electroporation, viral transduction, into the T cell using standard methods and reagents known in the art.
  • the in vitro transcribed CAR mRNA and ETP mRNA, cDNAs, or vectors, e.g., retroviral or lentiviral vectors, encoding the CAR and ETP of interest can be delivered into different types of lymphocytes (e.g., T cells), as well as into tissues and whole organisms using transfected cells as carriers or cell-free local or systemic delivery of encapsulated, bound or naked nucleic acid molecules, e.g., in vitro transcribed RNA, mRNA, cDNA, or DNA vectors.
  • the method used can be for any purpose where transient expression is required or sufficient.
  • T cells that have been modified to express a nucleic acid sequence encoding CAR and a nucleic acid sequence encoding an ETP are referred to as "ETP-CAR T cells”.
  • T cells can be transduced, e.g., virally transduced, with CAR DNA, e.g., a vector encoding a CAR, and ETP DNA, e.g., a vector encoding an ETP.
  • T cells co-transfected with CAR RNA and ETP RNA are referred to as "RNA ETP-CAR T cells.”
  • the disclosed methods can be applied to modulation of cell activity in basic research and therapy, in the fields of cancer, stem cells, acute and chronic infections, and autoimmune diseases, including modulation of the developmental pathways.
  • the methods also provide the ability to control the level of expression over a wide range by changing the amount of input RNA, making it possible to individually regulate the expression level of each transfected gene.
  • the PCR-based technique of mRNA production greatly facilitates the design of the chimeric receptor mRNAs with different structures and combination of their domains. For example, varying of different intracellular effector/costimulator domains on multiple chimeric receptors in the same cell allows determination of the structure of the receptor combinations which assess the highest level of cytotoxicity against multi-antigenic targets, and at the same time lowest cytotoxicity toward normal cells.
  • RNA transfection is essentially transient and a vector-free. Moreover, RNA transfection of multiple distinct RNAs can be performed with high efficiency without substantially altering the expression of the distinct polypeptides encoded by co-delivered RNA molecules.
  • An RNA transgene can be delivered to a lymphocyte and expressed therein following a brief in vitro cell activation, as a minimal expressing cassette without the need for any additional viral sequences. Under these conditions, integration of the transgene into the host cell genome is unlikely. Cloning of cells is not necessary because of the high efficiency of transfection of the RNA and its ability to uniformly modify the entire lymphocyte population. Thus, cells containing an RNA construct introduced according to the disclosed method can be used therapeutically.
  • a lymphocyte cell population is withdrawn from a patient, transfected with different RNA constructs, and then reintroduced into the patient.
  • the transfected cell population then can target, e.g., cancer cells or cells containing other disease-associated antigens.
  • a benefit of the use of RNA transfected cells is that the RNA transgene has a limited half-life. The encoded protein will only be produced by the transfected cell for a limited period of time. This serves to reduce the risk of any unintended consequences when genetically modified cells are introduced into a patient.
  • the technology is used for personalized therapy.
  • the patient's blood or cells is collected by an appropriate method such as apheresis, biopsy or venapuncture.
  • the cells are cultured for at least 24 hours during which time the cells are modified with an appropriate nucleic acid, e.g., transfected with an appropriate RNA construct or transduced with an appropriate DNA, e.g., vector, construct, to treat the tumor.
  • the cells can be stored frozen before transfection or tranduction, if necessary. They are then returned back to the patient at the appropriate time and in the appropriate dose.
  • modified cells e.g., RNA-modified cells or DNA-modified cells, are administered to the patient multiple times.
  • Immune therapy with in vitro-transcribed RNA makes use of two different strategies both of which have been successively tested in various animal models.
  • Cells are transfected with in vitro-transcribed RNA by means of lipofection or electroporation and administered to the subject.
  • IVT vectors are known in the literature which are utilized in a standardized manner as template for in vitro transcription and which have been genetically modified in such a way that stabilized RNA transcripts are produced.
  • protocols used in the art are based on a plasmid vector with the following structure: a 5' RNA polymerase promoter enabling RNA transcription, followed by a gene of interest which is flanked either 3' and/or 5' by untranslated regions (UTR), and a 3' polyadenyl cassette containing a chain of A nucleotides.
  • UTR untranslated regions
  • the circular plasmid Prior to in vitro transcription, the circular plasmid is linearized downstream of the polyadenyl cassette by type II restriction enzymes (recognition sequence corresponds to cleavage site).
  • the polyadenyl cassette thus corresponds to the later poly(A) sequence in the transcript.
  • some nucleotides remain as part of the enzyme cleavage site after linearization and extend or mask the poly(A) sequence at the 3' end. It is not clear, whether this nonphysiological overhang affects the amount of protein produced intracellularly from such a construct.
  • RNA has several advantages over more traditional plasmid or viral approaches. Gene expression from an RNA source does not require transcription and the protein product is produced rapidly after the transfection. Further, the RNA needs only to gain access to the cytoplasm, rather than the nucleus, and therefore typical transfection methods result in an extremely high rate of transfection. In addition, plasmid based approaches require that the promoter driving the expression of the gene of interest be active in the cells under study.
  • the RNAs of use in the invention can be delivered into the cells by electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US 2004/0014645 , US 2005/0052630A1 , US 2005/0070841 A1 , US 2004/0059285A1 , US 2004/0092907A1 .
  • the various parameters including electric field strength required for electroporation of any known cell type are generally known in the relevant research literature as well as numerous patents and applications in the field. See e.g., U.S. Pat. No. 6,678,556 , U.S. Pat. No. 7,171,264 , and U.S. Pat.
  • Electroporation may also be utilized to deliver nucleic acids into cells in vitro. Accordingly, electroporation-mediated administration into cells of nucleic acids including expression constructs utilizing any of the many available devices and electroporation systems known to those of skill in the art presents an exciting new means for delivering an RNA of interest to a target cell.
  • the RNAs can be delivered into the cells by calcium phosphate precipitation, lipofection, particle bombardment, microinjection, and the like.
  • Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1 -4, Cold Spring Harbor Press, NY ).
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
  • Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles.
  • lipid formulations are contemplated for the introduction of the RNAs into a host cell (in vitro, ex vivo or in vivo).
  • the RNA may be associated with a lipid.
  • the RNA associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
  • Lipid/RNA associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape.
  • Lipids are fatty substances which may be naturally occurring or synthetic lipids.
  • lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
  • Lipids suitable for use can be obtained from commercial sources.
  • DMPC dimyristyl phosphatidylcholine
  • DCP dicetyl phosphate
  • Choi cholesterol
  • DMPG dimyristyl phosphatidylglycerol
  • Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about -200C. Chloroform is used as the only solvent since it is more readily evaporated than methanol.
  • Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers ( Ghosh et al., 1991 Glycobiology 5: 505-10 ).
  • compositions that have different structures in solution than the normal vesicular structure are also encompassed.
  • the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
  • lipofectamine-nucleic acid complexes are also contemplated.
  • a source of cells e.g., T cells
  • T cells can be obtained from a subject.
  • the term "subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, monkeys, chimpanzees, dogs, cats, mice, rats, and transgenic species thereof.
  • T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • immune effector cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll TM separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and, optionally, to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated "flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
  • a semi-automated "flow-through" centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL TM gradient or by counterflow centrifugal elutriation.
  • the methods described herein can include, e.g., selection of a specific subpopulation of immune effector cells, e.g., T cells, that are a T regulatory cell-depleted population, CD25+ depleted cells, using, e.g., a negative selection technique, e.g., described herein.
  • the population of T regulatory depleted cells contains less than 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells.
  • T regulatory cells e.g., CD25+ T cells
  • T regulatory cells are removed from the population using an anti-C25 antibody, or fragment thereof, or a CD25-binding ligand, IL-2.
  • the anti-CD25 antibody, or fragment thereof, or CD25-binding ligand is conjugated to a substrate, e.g., a bead, or is otherwise coated on a substrate, e.g., a bead.
  • the anti-CD25 antibody, or fragment thereof is conjugated to a substrate as described herein.
  • the T regulatory cells e.g., CD25+ T cells
  • the ratio of cells to CD25 depletion reagent is 1e7 cells to 20 uL, or 1e7 cells to15 uL, or 1e7 cells to 10 uL, or 1e7 cells to 5 uL, or 1e7 cells to 2.5 uL, or 1e7 cells to 1.25 uL.
  • the population of immune effector cells to be depleted includes about 6 ⁇ 10 9 CD25+ T cells. In other aspects, the population of immune effector cells to be depleted include about 1 ⁇ 10 9 to 1 ⁇ 10 10 CD25+ T cell, and any integer value in between. In one embodiment, the resulting population T regulatory depleted cells has 2 ⁇ 10 9 T regulatory cells, e.g., CD25+ cells, or less (e.g., 1 ⁇ 10 9 , 5 ⁇ 10 8 , 1 ⁇ 10 8 , 5 ⁇ 10 7 , 1 ⁇ 10 7 , or less CD25+ cells).
  • the T regulatory cells e.g., CD25+ cells
  • a depletion tubing set such as, e.g., tubing 162-01.
  • the CliniMAC system is run on a depletion setting such as, e.g., DEPLETION2.1.
  • the methods described herein can include more than one selection step, e.g., more than one depletion step.
  • Enrichment of a T cell population by negative selection can be accomplished, e.g., with a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail can include antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
  • the methods described herein can further include removing cells from the population which express a tumor antigen, e.g., a tumor antigen that does not comprise CD25, e.g., CD19, CD30, CD38, CD123, CD20, CD14 or CD11b, to thereby provide a population of T regulatory depleted, e.g., CD25+ depleted, and tumor antigen depleted cells that are suitable for expression of a CAR, e.g., a CAR described herein.
  • tumor antigen expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • an anti-C25 antibody, or fragment thereof, and an anti-tumor antigen antibody, or fragment thereof can be attached to the same substrate, e.g., bead, which can be used to remove the cells or an anti-CD25 antibody, or fragment thereof, or the anti-tumor antigen antibody, or fragment thereof, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the tumor antigen expressing cells is sequential, and can occur, e.g., in either order.
  • a check point inhibitor e.g., a check point inhibitor described herein, e.g., one or more of PD1+ cells, LAG3+ cells, and TIM3+ cells
  • check point inhibitors include B7-H1, B&-1, CD160, P1H, 2B4, PD1, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, TIGIT, CTLA-4, BTLA and LAIR1.
  • check point inhibitor expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • an anti-C25 antibody, or fragment thereof, and an anti-check point inhibitor antibody, or fragment thereof can be attached to the same bead which can be used to remove the cells, or an anti-CD25 antibody, or fragment thereof, and the anti-check point inhibitor antibody, or fragment there, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the check point inhibitor expressing cells is sequential, and can occur, e.g., in either order.
  • T cells can isolated by incubation with anti-CD3/anti-CD28 (e.g., 3x28)-conjugated beads, such as DYNABEADS ® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
  • the time period is about 30 minutes.
  • the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
  • the time period is at least 1, 2, 3, 4, 5, or 6 hours.
  • the time period is 10 to 24 hours, e.g., 24 hours.
  • TIL tumor infiltrating lymphocytes
  • use of longer incubation times can increase the efficiency of capture of CD8+ T cells.
  • T cells by simply shortening or lengthening the time T cells are allowed to bind to the CD3/CD28 beads and/or by increasing or decreasing the ratio of beads to T cells (as described further herein), subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process.
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • a T cell population can be selected that expresses one or more of IFN- ⁇ , TNF ⁇ , IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, or other appropriate molecules, e.g., other cytokines.
  • Methods for screening for cell expression can be determined, e.g., by the methods described in PCT Publication No.: WO 2013/126712 .
  • the concentration of cells and surface can be varied.
  • it may be desirable to significantly decrease the volume in which beads and cells are mixed together e.g., increase the concentration of cells, to ensure maximum contact of cells and beads.
  • a concentration of 10 billion cells/ml, 9 billion/ml, 8 billion/ml, 7 billion/ml, 6 billion/ml, or 5 billion/ml is used.
  • a concentration of 1 billion cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used.
  • concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (e.g., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • the concentration of cells used is 5 ⁇ 10 6 /ml. In other aspects, the concentration used can be from about 1 ⁇ 10 5 /ml to 1 ⁇ 10 6 /ml, and any integer value in between.
  • the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10°C or at room temperature.
  • T cells for stimulation can also be frozen after a washing step.
  • the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
  • the cells may be suspended in a freezing solution.
  • one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80°C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20° C or in liquid nitrogen.
  • cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
  • a blood sample or an apheresis product is taken from a generally healthy subject.
  • a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
  • the T cells may be expanded, frozen, and used at a later time.
  • samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
  • the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228 , and irradiation.
  • agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD
  • T cells are obtained from a patient directly following treatment that leaves the subject with functional T cells.
  • the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • mobilization for example, mobilization with GM-CSF
  • conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
  • Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • the immune effector cells expressing a CAR molecule are obtained from a subject that has received a low, immune enhancing dose of an mTOR inhibitor.
  • the population of immune effector cells, e.g., T cells, to be engineered to express a CAR are harvested after a sufficient time, or after sufficient dosing of the low, immune enhancing, dose of an mTOR inhibitor, such that the level of PD1 negative immune effector cells, e.g., T cells, or the ratio of PD1 negative immune effector cells, e.g., T cells/ PD1 positive immune effector cells, e.g., T cells, in the subject or harvested from the subject has been, at least transiently, increased.
  • population of immune effector cells e.g., T cells, which have, or will be engineered to express a CAR
  • population of immune effector cells can be treated ex vivo by contact with an amount of an mTOR inhibitor that increases the number of PD1 negative immune effector cells, e.g., T cells or increases the ratio of PD1 negative immune effector cells, e.g., T cells/ PD1 positive immune effector cells, e.g., T cells.
  • a T cell population is diaglycerol kinase (DGK)-deficient.
  • DGK-deficient cells include cells that do not express DGK RNA or protein, or have reduced or inhibited DGK activity.
  • DGK-deficient cells can be generated by genetic approaches, e.g., administering RNA-interfering agents, e.g., siRNA, shRNA, miRNA, to reduce or prevent DGK expression.
  • RNA-interfering agents e.g., siRNA, shRNA, miRNA
  • DGK-deficient cells can be generated by treatment with DGK inhibitors described herein.
  • a T cell population is Ikaros-deficient.
  • Ikaros-deficient cells include cells that do not express Ikaros RNA or protein, or have reduced or inhibited Ikaros activity, Ikaros-deficient cells can be generated by genetic approaches, e.g., administering RNA-interfering agents, e.g., siRNA, shRNA, miRNA, to reduce or prevent Ikaros expression.
  • RNA-interfering agents e.g., siRNA, shRNA, miRNA
  • Ikaros-deficient cells can be generated by treatment with Ikaros inhibitors, e.g., lenalidomide.
  • a T cell population is DGK-deficient and Ikaros-deficient, e.g., does not express DGK and Ikaros, or has reduced or inhibited DGK and Ikaros activity.
  • DGK and Ikaros-deficient cells can be generated by any of the methods described herein.
  • the NK cells are obtained from the subject.
  • the NK cells are an NK cell line, e.g., NK-92 cell line (Conkwest).
  • Immune effector cells such as T cells may be activated and expanded generally using methods as described, for example, in U.S. Patents 6,352,694 ; 6,534,055 ; 6,905,680 ; 6,692,964 ; 5,858,358 ; 6,887,466 ; 6,905,681 ; 7,144,575 ; 7,067,318 ; 7,172,869 ; 7,232,566 ; 7,175,843 ; 5,883,223 ; 6,905,874 ; 6,797,514 ; 6,867,041 ; and U.S. Patent Application Publication No. 20060121005 .
  • a population of immune effector cells may be expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells.
  • T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art ( Berg et al., Transplant Proc. 30(8):3975-3977, 1998 ; Haanen et al., J. Exp. Med. 190(9):13191328, 1999 ; Garland et al., J. Immunol Meth. 227(1-2):53-63, 1999 ).
  • the primary stimulatory signal and the costimulatory signal for the T cell may be provided by different protocols.
  • the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in "cis” formation) or to separate surfaces (i.e., in "trans” formation). Alternatively, one agent may be coupled to a surface and the other agent in solution.
  • the agent providing the costimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain aspects, both agents can be in solution.
  • the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • aAPCs artificial antigen presenting cells
  • the two agents are immobilized on beads, either on the same bead, i.e., "cis," or to separate beads, i.e., "trans.”
  • the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the costimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
  • a 1:1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used.
  • a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular aspect an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1.
  • the ratio of CD3 :CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain aspects, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
  • a 1:100 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:75 CD3:CD28 ratio of antibody bound to beads is used. In a further aspect, a 1:50 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:30 CD3:CD28 ratio of antibody bound to beads is used. In one preferred aspect, a 1:10 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:3 CD3:CD28 ratio of antibody bound to the beads is used. In yet one aspect, a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
  • Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells.
  • the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
  • the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further aspects the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
  • the ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, and 15:1 with one preferred ratio being at least 1:1 particles per T cell.
  • a ratio of particles to cells of 1:1 or less is used.
  • a preferred particle: cell ratio is 1:5.
  • the ratio of particles to cells can be varied depending on the day of stimulation.
  • the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition).
  • the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation.
  • the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation.
  • ratios will vary depending on particle size and on cell size and type.
  • the most typical ratios for use are in the neighborhood of 1:1, 2:1 and 3:1 on the first day.
  • the cells such as T cells
  • the cells are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured.
  • the agent-coated beads and cells prior to culture, are not separated but are cultured together.
  • the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
  • cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3x28 beads) to contact the T cells.
  • the cells for example, 10 4 to 10 9 T cells
  • beads for example, DYNABEADS ® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1:1
  • a buffer for example PBS (without divalent cations such as, calcium and magnesium).
  • the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest.
  • any cell number is within the context of the present invention.
  • it may be desirable to significantly decrease the volume in which particles and cells are mixed together i.e., increase the concentration of cells), to ensure maximum contact of cells and particles.
  • a concentration of about 2 billion cells/ml is used. In one aspect, greater than 100 million cells/ml is used. In a further aspect, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet one aspect, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further aspects, concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain aspects. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • cells transduced with a nucleic acid encoding a CAR are expanded, e.g., by a method described herein.
  • the cells are expanded in culture for a period of several hours (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 18, 21 hours) to about 14 days (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days).
  • the cells are expanded for a period of 4 to 9 days.
  • the cells are expanded for a period of 8 days or less, e.g., 7, 6 or 5 days.
  • the cells are expanded in culture for 5 days, and the resulting cells are more potent than the same cells expanded in culture for 9 days under the same culture conditions. Potency can be defined, e.g., by various T cell functions, e.g. proliferation, target cell killing, cytokine production, activation, migration, or combinations thereof.
  • the cells, e.g., a CD19 CAR cell described herein, expanded for 5 days show at least a one, two, three or four fold increase in cells doublings upon antigen stimulation as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • the cells e.g., the cells expressing a CD19 CAR described herein, are expanded in culture for 5 days, and the resulting cells exhibit higher proinflammatory cytokine production, e.g., IFN- ⁇ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • proinflammatory cytokine production e.g., IFN- ⁇ and/or GM-CSF levels
  • the cells e.g., a CD19 CAR cell described herein, expanded for 5 days show at least a one, two, three, four, five, ten fold or more increase in pg/ml of proinflammatory cytokine production, e.g., IFN- ⁇ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • proinflammatory cytokine production e.g., IFN- ⁇ and/or GM-CSF levels
  • T cell culture includes an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGF ⁇ , and TNF- ⁇ or any other additives for the growth of cells known to the skilled artisan.
  • serum e.g., fetal bovine or human serum
  • IL-2 interleukin-2
  • insulin IFN- ⁇
  • IL-4 interleukin-7
  • GM-CSF interleukin-10
  • IL-12 interleukin-12
  • TGF ⁇ TGF ⁇
  • TNF- ⁇ any other additives for the growth of cells known to the skilled artisan.
  • additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
  • Media can include RPMI 1640, AIM-V, DMEM, MEM, ⁇ -MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% CO 2 ).
  • the cells are expanded in an appropriate media (e.g., media described herein) that includes one or more interleukin that result in at least a 200-fold (e.g., 200-fold, 250-fold, 300-fold, 350-fold) increase in cells over a 14 day expansion period, e.g., as measured by a method described herein such as flow cytometry.
  • the cells are expanded in the presence IL-15 and/or IL-7 (e.g., IL-15 and IL-7).
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics.
  • typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (TH, CD4+) that is greater than the cytotoxic or suppressor T cell population (TC, CD8+).
  • TH, CD4+ helper T cell population
  • TC cytotoxic or suppressor T cell population
  • Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of TH cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells.
  • infusing a subject with a T cell population comprising predominately of TH cells may be advantageous.
  • an antigen-specific subset of TC cells has been isolated it may be beneficial to expand this subset to a greater degree.
  • CD4 and CD8 markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
  • various assays can be used to evaluate the activity of the molecule, such as but not limited to, the ability to expand T cells following antigen stimulation, sustain T cell expansion in the absence of re-stimulation, and anti-cancer activities in appropriate animal models. Assays to evaluate the effects of a CAR are described in further detail below.
  • T cells (1:1 mixture of CD4 + and CD8 + T cells) expressing the CARs are expanded in vitro for more than 10 days followed by lysis and SDS-PAGE under reducing conditions.
  • CARs containing the full length TCR- ⁇ cytoplasmic domain and the endogenous TCR- ⁇ chain are detected by western blotting using an antibody to the TCR- ⁇ chain.
  • the same T cell subsets are used for SDS-PAGE analysis under non-reducing conditions to permit evaluation of covalent dimer formation.
  • CAR + T cells following antigen stimulation can be measured by flow cytometry.
  • a mixture of CD4 + and CD8 + T cells are stimulated with ⁇ CD3/ ⁇ CD28 aAPCs followed by transduction with lentiviral vectors expressing GFP under the control of the promoters to be analyzed.
  • promoters include the CMV IE gene, EF-1 ⁇ , ubiquitin C, or phosphoglycerokinase (PGK) promoters.
  • GFP fluorescence is evaluated on day 6 of culture in the CD4 + and/or CD8 + T cell subsets by flow cytometry. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009 ).
  • Sustained CAR + T cell expansion in the absence of re-stimulation can also be measured. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009 ). Briefly, mean T cell volume (fl) is measured on day 8 of culture using a Coulter Multisizer III particle counter following stimulation with ⁇ CD3/ ⁇ CD28 coated magnetic beads on day 0, and transduction with the indicated CAR on day 1.
  • Cytotoxicity can be assessed by a standard 51Cr-release assay. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009 ), or by standard degranulation assays, as described in Example 5.
  • RNA CAR T cells co-expressing a CAR and one or more costimulatory molecules are incubated with target cells expressing the antigen targeted by the CAR.
  • a mesothelin-targeting CAR expressing T cells which also express one or more co-stimulatory molecules are incubated with mesothelin-expressing target cells (K-meso, SKOV3) and mesothelin-negative cells (K562) and evaluated for CD107a exposure in a degranulation assay.
  • mesothelin-expressing target cells K-meso, SKOV3
  • mesothelin-negative cells K562
  • Candidate ETPs can be tested for the ability to enhance T cell priming using the modified in vitro priming system described in Examples 2 and 3. Briefly, each candidate ETP is co-delivered with a CAR into T cells and exposed to one round of antigen stimulation with, e.g., a tumor antigen such as MART-1.
  • a tumor antigen such as MART-1.
  • the present invention provides T cells for use in a variety of therapeutic methods, the T cells being genetically modified to express a chimeric antigen receptor (CAR) and one or more ETPs in accordance with the claims, e.g., ETP-CAR T cells.
  • the T cells are genetically modified to transiently express an RNA encoding CAR and an RNA encoding ETP, e.g., RNA ETP-CAR T cells. This is achieved by infusing the ETP-CAR T cells, e.g., RNA ETP-CAR T cells, in to a recipient in need thereof.
  • the infused cell is able to kill cells which express the antigen to which the antigen-binding portion of the CAR binds.
  • the antigen is a tumor antigen
  • the T cell is administered to a recipient with cancer.
  • the anti-tumor response elicited by the ETP-CAR T cell involves both CAR-mediated cell killing, as well as ETP-enhanced cytotoxic T lymphocyte priming with tumor-specific antigenic peptides derived from, e.g., the tumor cells killed by CAR activity.
  • Expression of RNA CAR and RNA ETP results in a transient therapy (due to transient expression of the CAR and ETPs) with permanent anti-tumor effects (due to persistence of RNA ETP-CAR T cell priming of tumor-reactive T cells).
  • the CAR and ETP RNAs in the RNA ETP-CAR T cells administered to the patient, or their progeny persist in the patient for 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 days after transduction after administration of the RNA ETP-CAR T cell to the patient.
  • the invention provides RNA ETP-CAR T cells of the invention for use in a method for inhibiting the proliferation or reducing a cell population expressing a disease-associated antigen by contacting a population of cells expressing the disease-associated antigen with an RNA ETP-CAR T cell of the invention that binds to the disease-associated antigen.
  • the cells are cancer cells.
  • the ETP-CAR T cell reduces the quantity, number, amount or percentage of cells and/or cancer cells by at least 25%, at least 30%, at least 40%, at least 50%, at least 65%, at least 75%, at least 85%, at least 95%, or at least 99% in a subject with cancer or an animal model of cancer relative to a negative control.
  • the subject is a human.
  • ETP-CAR T cells e.g., RNA ETP-CAR T cells
  • efficacy of the ETP-CAR T cells can be tested using art-recognized animal models for the particular indication of interest.
  • established cancer mouse models are widely available for the particular cancer of interest.
  • the invention provides ETP-CAR T cells of the invention for use in methods for preventing, treating and/or managing a disorder associated with cells expressing a disease-associated antigen by administering to a subject in need an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention that binds to the disease-associated antigen-expressing cell.
  • an ETP-CAR T cell e.g., RNA ETP-CAR T cell
  • the subject is a human.
  • the invention provides ETP-CAR T cells of the invention for use in methods for preventing relapse of cancer associated with cells expressing a particular tumor antigen by administering to a subject in need thereof an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention that binds to the tumor antigen-expressing cell.
  • the methods comprise administering to the subject in need thereof an effective amount of an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention that binds to the disease-associated antigen-expressing cell in combination with an effective amount of another therapy.
  • the invention provides ETP-CAR T cells of the invention for use in a method of inhibiting growth of a cell expressing a tumor antigen by contacting the tumor cell with an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention such that the ETP-CAR T cell is activated in response to the antigen and targets the cancer cell, wherein the growth of the tumor is inhibited.
  • the activated ETP-CAR T cell e.g., RNA ETP-CAR T cell, targets and kills the cancer cell and/or enhances epitope spreading.
  • the invention provides ETP-CAR T cells of the invention for use in a method of treating a proliferative disease (e.g., cancer) by administering to a subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention, such that the cancer is treated in the subject.
  • a proliferative disease e.g., cancer
  • Non-limiting examples of a cancer that can be treated by the present invention include brain cancer, bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  • the invention provides ETP-CAR T cells of the invention for use in a method of treating a precancerous condition by administering to a subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention, such that the precancerous condition is treated in the subject.
  • an ETP-CAR T cell e.g., RNA ETP-CAR T cell
  • the invention provides ETP-CAR T cells of the invention for use in a method of treating a non-cancer indication by administering to a subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention such that the non-cancer indication is treated in the subject.
  • ETP-CAR T cell e.g., RNA ETP-CAR T cell
  • Non-limiting examples of non-cancer indications include inflammatory disorders, autoimmune disorders, parasitic, viral, bacterial, fungal or other infections.
  • the fully-human ETP-CAR T cells of the invention are for use as a vaccine for ex vivo immunization and/or in vivo therapy in a mammal (e.g., a human).
  • a mammal e.g., a human
  • at least one of the following preferably occurs in vitro prior to administering the cell into a mammal: i) expansion of the cells, ii) introducing a nucleic acid encoding a CAR and an ETP, as described herein, to the cells or iii) cryopreservation of the cells.
  • the invention provides ETP-CAR T cells of the invention for use in a method for vaccinating a subject comprising administering to the subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention.
  • an ETP-CAR T cell e.g., RNA ETP-CAR T cell
  • the subject is vaccinated for a cancer, a viral infection, or a bacterial infection.
  • the method further comprises administering to the subject an antigen, e.g., a tumor antigen, a viral antigen, or a bacterial antigen.
  • Vaccination of a subject can be determined by detecting the capability of the subject to mount an immune response to the particular disease, e.g., by measuring antibody titer against a disease-associated antigen, e.g., a tumor antigen, a viral antigen, or a bacterial antigen.
  • a disease-associated antigen e.g., a tumor antigen, a viral antigen, or a bacterial antigen.
  • cells are isolated from a mammal (e.g., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAR disclosed herein.
  • the CAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
  • the mammalian recipient may be a human and the CAR-modified cell can be autologous with respect to the recipient.
  • the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
  • ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo.
  • other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
  • the present invention also provides compositions for in vivo immunization to elicit an immune response directed against an antigen in a patient.
  • the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised.
  • the cells of the invention are used in the treatment of patients at risk for developing diseases, disorders and conditions associated with the expression of a disease-associated antigen.
  • the present invention provides ETP-CAR T cells of the invention for use in methods for the treatment or prevention of diseases, disorders and conditions associated with expression of a disease-associated antigen comprising administering to a subject in need thereof, a therapeutically effective amount of the ETP-CAR T cells of the invention, e.g., RNA ETP-CAR T cell, which bind cells expressing the disease-associated antigen.
  • ETP-CAR T cells of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations.
  • compositions of the present invention comprise an ETP-CAR T cell, e.g., RNA ETP-CAR T cell of the present invention, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • Compositions of the present invention are in one aspect formulated for intravenous administration.
  • compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented).
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • an immunologically effective amount When “an immunologically effective amount,” “an anti-tumor effective amount,” “a tumor-inhibiting effective amount,” or “therapeutic amount” is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, in some instances 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages.
  • the cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988 ).
  • the optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
  • T cells can be activated from blood draws of from 10cc to 400cc.
  • T cells are activated from blood draws of 20cc, 30cc, 40cc, 50cc, 60cc, 70cc, 80cc, 90cc, or 100cc. Not to be bound by theory, using this multiple blood draw/multiple reinfusion protocol, may select out certain populations of T cells.
  • compositions may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
  • the compositions may be administered to a patient trans arterially, subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally.
  • the compositions are administered to a patient by intradermal or subcutaneous injection.
  • the compositions are administered by i.v. injection.
  • the compositions are injected directly into a tumor, lymph node, or site of infection.
  • cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients.
  • agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients.
  • the T cells of the invention may be used in a treatment regimen in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228 , cytokines, and irradiation.
  • immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies
  • immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228 , cytokines, and irradiation.
  • Drugs that inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling can also be used.
  • the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH.
  • the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation.
  • subjects receive an infusion of the expanded immune cells of the present invention.
  • expanded cells are administered before or following surgery.
  • subjects undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells.
  • T cell isolates may be expanded by methods known in the art and treated such that one or more CAR and ETP constructs of use in the invention may be introduced, thereby creating an ETP-CAR T cell of the invention, e.g., RNA ETP-CAR T cell.
  • Subjects in need thereof may subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation.
  • subjects receive an infusion of the expanded ETP-CAR T cells of the present invention, e.g., RNA ETP-CAR T cell.
  • expanded cells are administered before or following surgery.
  • the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
  • the scaling of dosages for human administration can be performed according to art-accepted practices.
  • the dose for CAMPATH for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days.
  • the preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Patent No. 6,120,766 ).
  • K562 and SKOV3 cells were from ATCC (Manassas, VA) and K-meso cells were from the Laboratory of C. June (Philadelphia, PA).
  • K562 cells were derived from a chronic myeloid leukemia (NY-ESO-1-CD19-), SKOV3 from an adenocarcinoma, and K-meso cells were K562 cells transduced to express mesothelin. All cells were quantified and sized using a Multisizer 3 COULTER COUNTER (MS3; Beckman Coulter, Brea, CA).
  • DCs were cultured from PBMCs which were washed twice with Dulbecco's Phosphate Buffered Saline (PBS; Gibco ® Life Technologies (LTI), Grand Island, NY), resuspended in AIM-V ® Medium (AIM-V; LTI), and then incubated in a plastic tissue-culture treated flask (Corning, Tewksbury, MA) for 2 h at 37°C in a 5% CO2 incubator.
  • PBS Dulbecco's Phosphate Buffered Saline
  • LTI AIM-V ® Medium
  • Non-adherent (PBLs) cells were separated from adherent (monocytes) cells by first swirling the medium in the flask until the non-adherent cells collected together, transferring the supernatant containing the non-adherent cells to a separate container, and then washing the adherent cells twice with PBS to remove remaining non-adherent cells. Non-adherent PBLs were then frozen for later use as effectors in the modified in vitro priming assay.
  • Immature DCs were cultured from adherent monocytes in AIM-V containing recombinant human IL-4 (500 U/ml) and GM-CSF (800 U/ml) for 7 days (R&D, Minneapolis, MN), including feedings on days 1, 3, and 5. On day 7, adherent immature DCs were washed with PBS and then harvested using incubation with Versene (EDTA) (Versene; BioWhittaker ® Lonza, Walkersville, MD) for 15 min in a 37°C incubator.
  • EDTA Versene
  • Mature DCs were cultured AIM-V containing IL-4 (500 U/ml) and GM-CSF (800 U/ml) for 5 days, including feedings on days 1 and 3, followed by the addition of stimulation reagents on day 5 that included TNF ⁇ (10 ng/ml; R&D), IL-1 ⁇ (2 ng/ml; R&D), IL-6 (1,000 U/ml; R&D), and Prostaglandin E2 (PGE2) (1,000 ng/ml; Sigma-Aldrich). On day 7, non-adherent mature DCs were harvested from the supernatant.
  • CD3/CD28 beads Dynabeads ® Human T-Expander CD3/CD28 (Invitrogen Dynal, Osol, Norway); immunomagnetic beads to which CD3-specific and CD28-specific monoclonal antibodies had been conjugated) as described (Carpenito, Milone et al. 2009).
  • CD4+ and CD8+ cells were washed twice in PBS, mixed together at a 1:1 ratio, and then resuspended at a final concentration of 0.6 - 0.8 ⁇ 10 6 cells/ml in fresh T cell culture medium (RPMI Medium 1640 (RPMI; LTI), containing 10% Human Serum AB (HABS; GemCell TM Gemini Bio-products, West Sacramento, CA), HEPES, GlutaMAX TM (L-glut), Pen Strep, Sodium Pyruvate, MEM non-essential Amino Acids (NEAA), and 2-Mercaptothanol (BME) LTI).
  • RPMI Medium 1640 RPMI; LTI
  • HBS Human Serum AB
  • GlutaMAX TM L-glut
  • Pen Strep Sodium Pyruvate
  • MEM non-essential Amino Acids NEAA
  • 2-Mercaptothanol BME
  • T cells were gently mixed extensively, washed three times in PBS, and then combined with T cells at a ratio of 3:1, beads to T cells.
  • the bead-T cell solution was transferred to a tissue culture-treated flask and incubated at 37°C in a 5% CO2 incubator for 3 days, undisturbed.
  • fresh T cell culture medium was added to the culture at a volume of 1 ⁇ 2 the initial culture volume and then incubated for an additional 2 days.
  • the magnetic beads were removed from the culture using a DynaMag TM magnet (Invitrogen Dynal) and the cells were then resuspended with T cell culture medium to a concentration of ⁇ 0.7 - 0.8 ⁇ 10 6 cells/ml.
  • the culture was fed with fresh T cell culture medium down to a concentration of ⁇ 0.7 - 0.8 ⁇ 10 6 cells/ml every other day.
  • T cells were frozen as described above when the culture average cell diameter decreased to ⁇ 250 ⁇ m 3 .
  • CD19 and mesothelin (meso)-targeted CARs with 4-1BB and CD3 signaling domains (19-BBz and ss1-BBz, respectively) have been described previously (Carpenito, Milone et al. 2009, Milone, Fish et al. 2009).
  • the PCR products were subcloned into a pGEM.64A-based vector by replacing GFP from pGEM-GFP.64A (Zhao, Zheng et al. 2006) with restriction-enzyme-digested PCR products with HindIII and NotI (New England Biolabs Inc.
  • Human T cells were stimulated by CD3/CD28 beads as described above.
  • the stimulated T cells were washed three times with Opti-MEM ® I Reduced Serum Medium (OPTI-MEM; LTI) and resuspended in OPTI-MEM at the final concentration of 25x106/ ml before electroporation.
  • the stimulated T cells were mixed with 8-10 ⁇ g/0.1 ml T cells of IVT RNA and electroporated for a single pulse at 500 V for 0.7 ms in a 2mm cuvette (Harvard Apparatus BTX, Holliston, MA) using an ECM830 Electro Square Wave Porator (Harvard Apparatus BTX).
  • T cells were then cultured overnight in standard T cell culture medium and then stained for respective costimulatory molecule expression by flow cytometry. T cells were co-electroporated with 8 ⁇ g of Meso-CAR and 8 ⁇ g of RNA encoding each of the costimulatory molecules.
  • FACS flow cytometry
  • Tetramer staining was performed using APC-labeled MART-1 (iTAg Tetramer/APC - HLA-A ⁇ 0201 Mart-1 (ELAGIGILTV)) or Flu-M1 tetramers (iTAg Tetramer/APC - HLA-A ⁇ 0201 Influenza-M1 (GILGFVFTL)) at a 1:40 dilution (MBL International Co., Woburn, MA).
  • Flow cytometry acquisition was performed with a BD LSR II (BD Biosciences), and analysis was performed with FlowJo (Treestar, Ashland, OR).
  • a modified in vitro T cell priming assay was used to assess the capacity of RNA electroporated T cells to prime naive MART-1 peptide-specific T cells. This assay has been described, in part, previously, and is modified herein (Li, Bleakley et al. 2005, Li and Yee 2008, Kaka, Shaffer et al. 2009, Wolfl, Merker et al. 2011, Ramos, Narala et al. 2013). All donor-derived cells were from normal healthy HLA-A2+ donors.
  • Peptides were either MART-126-35 (ELAGIGILTV (SEQ ID NO: 47)), Flu-M158-66 (GILGFVFTL (SEQ ID NO: 48); positive control) or h-CLIP103-117 (PVSKMRMATPLLMQA (SEQ ID NO: 49); negative control), and were purchased from GenScript USA Inc. (Piscataway, NJ).
  • the CD107a mobilization assay was performed as described (Betts, Brenchley et al. 2003). One hundred microliters of effector and target cells was plated in 96-well round-bottom plates at a ratio of 1:1, 2:1, or 4:1 (1, 2, or 4x105 effectors + 105 targets). Ten microliters of PE-Cy5-labeled anti-CD107a antibody (eBioscience) was added to each cell mixture and incubated at 37°C for 1 hr before adding GolgiStop (BD). After an additional 2.5 hr of incubation, these cells were stained with anti-CD8-APC-Cy7 (BD) and levels of surface CD107 were determined by flow cytometry, as described above.
  • Example 2 Screening of candidate molecules involved in cytotoxic T lymphocyte (CTL) priming for co-delivery with CARs or TCRs into T cells
  • CTL cytotoxic T lymphocyte
  • RNA CAR T cells e.g., surface-bound molecules that deliver primary and secondary costimulation, are associated with antigen presentation, determine trafficking and migration patterns, are ligands for DC, as well as cytokines that facilitate priming or suppress regulatory T cell (Treg) responses
  • the present example focused on evaluating genes regulated in dendritic cells (one of the most potent of the professional APCs) (Chen and Flies 2013).
  • IDCs Immature DCs
  • mDCs mature DCs
  • CD252, CD70, CD83, CD80, CD49a, CD40, HLA-ABC, CD86, HLA-DR, CD275, CD154, CD137L, and CD43 costimulatory molecule expression
  • CD252, CD70, CD83, and CD80 showed substantially higher expression in mDCs compared to iDCs. Accordingly, CD252 and CD70 were chosen for further analysis as candidate costimulatory molecules for co-delivery with CARs into T cells.
  • CD86 and CD137l also were included as candidate costimulatory molecules because they have been reported to provide important secondary costimulation signals for T cell priming.
  • Figure 2 is merely an example demonstrating that costimulatory molecules can be dramatically regulated during classical APC-T cell priming.
  • CD70, CD83, CD80 (B7-1), CD86 (B7-2), CD275 (ICOS-L), CD43, CD137L (4-1BBL), CD252 (OX40L), CD58 (LFA-3), CD48, TL1A, CD270 (HVEM), CD40, CD154 (CD40L), CD150 (SLAM), and CD64 were cloned and used as templates for in vitro transcription to produce high quality mRNA. All candidates were highly expressed when their mRNAs were electroporated into T cells ( Figure 3 ), indicating that these candidates could be used to express in T cells for enhancing T cell priming capability.
  • Example 3 Establishment of an in vitro priming system for the identification of candidate costimulatory molecules that promote priming of tumor-specific T cells
  • RNA CAR T cells To test the ability of each candidate costimulatory molecule co-delivered into RNA CAR T cells to enhance priming, a modified in vitro priming system was established. This system was based on published studies describing autologous co-culture assays using DCs and T cells that have been used for in vitro T cell induction (Li, Bleakley et al. 2005, Han and Chang 2009, Ramos, Narala et al. 2013), but modified to include only one round of antigen stimulation, as opposed to up to 3 or 4 as described in previous studies, since detectable CTL responses were observed in multiple donors with one round of stimulation ( Figure 4A ).
  • Example 4 Enhanced costimulatory molecule-mediated priming of T cells
  • each of the four candidate costimulatory molecules were tested for the ability to enhance the capacity of T cells to directly prime MART-1+ CTLs.
  • each costimulatory molecule was capable of enhancing MART-1+ CTL priming, as reflected in the increased number of CD8+MART-1+ T cells relative to controls (no electroporation, h-Clip peptide irrelevant antigen control (h-CLIP 103-117 (PVSKMRMATPLLMQA (SEQ ID NO: 50))), and PBL stimulators alone; Figure 5 ).
  • CD70 provided the strongest enhancement of T:T-mediated MART-1+ CTL induction, increasing priming by over 10-fold when compared to control cells which were electroporated without RNA.
  • T cells expressing CD86, CD137L, and CD252 were able to enhance priming by 8.5-fold, 3.2-fold, and 3.2-fold, respectively, relative to control cells.
  • Co-expression of Meso-CAR along with costimulatory molecules did not result in an adverse effect on either the CAR or the costimulatory molecule, e.g., did not result in decreased expression of the CAR or ETP, or inhibition of CAR or ETP expression.
  • CARs may be effectively co-expressed with additional molecules, e.g., ETPs, with minimal interference on the surface expression of the CAR.
  • CAR-mediated tumor cell killing has important downstream effects such as the potential to disrupt the local tumor immunosuppressive environment by destroying tumor cells, releasing tumor antigens, recruiting pro-immune and antigen-presenting cells (APCs), secreting pro-inflammatory cytokines, and promoting inflammation in general.
  • APCs pro-immune and antigen-presenting cells
  • immunomodulatory events may all work together to facilitate in vivo priming at the tumor site and/or local lymph nodes of non-engineered tumor-specific CD8 + T cells that may recognize tumor antigens not only targeted by the CAR itself, but also others within the same tumor (i.e., epitope spreading).
  • the CAR-mediated cell killing ability of T cells co-expressing Meso-CAR and ETP costimulatory molecules was assessed to determine whether co-expression of a CAR with costimulatory molecules would negatively affect CAR-mediated cell killing.
  • Meso-CAR expressing T cells that also express costimulatory molecules were incubated with two different mesothelin-expressing tumor lines (K-meso and SKOV3) and one mesothelin-negative line (K562) and evaluated for CD107a exposure in a degranulation assay.
  • the CD107a mobilization assay is widely used to measure the capacity of T cells to kill target cells, which has been directly correlated to their level of degranulation as quantified by the exposure of LAMP 1 protein (CD107a) that normally resides in cytotoxic T cell lytic granules (Betts, Brenchley et al. 2003). Co-expression of CAR and costimulatory molecules did not markedly affect CAR function ( Figure 6 ). Data points for the Meso-CAR alone from another experiment for K-meso and K562 cells were added to the graph, from Zhao, Moon et al., 2010..
  • Example 8 Efficacy of RNA CAR T cells co-expressing molecules involved in CTL priming on eradicating tumor cells
  • RNA CART cell co-expressing ETPs are tested in other in vitro priming systems.
  • human CAR T cells are cocultured with tumor cells (likely irradiated), in the presence of a pool of non-engineered T cells and possibly DCs.
  • the readout of this assay includes the induction of tumor-specific T cell responses in the pool of non-engineered T cells, which may be the result of cross-priming of released tumor Ags by the CAR T cells engineered to be dual functional Ag presenters.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • Plant Pathology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Endocrinology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)

Description

    CROSS-REFERENCE TO RELATED APPLICATIONS
  • This application claims priority to U.S. Serial No.: 61/929,813, filed January 21, 2014 .
  • BACKGROUND
  • Chimeric antigen receptors (CARs) are molecules that combine antibody-based specificity for disease-associated surface antigens with T cell receptor-activating intracellular domains with disease-directed cellular immune activity. This configuration allows T cells engineered to express a CAR to achieve MHC-independent primary activation through single chain Fv (scFv) antigen-specific extracellular regions fused to intracellular domains that provide T cell activation and co-stimulatory signals. Second and third generation CARs also provide appropriate co-stimulatory signals via CD28 and/or CD 137 (4- IBB) intracellular activation motifs, which augment cytokine secretion and anti-tumor activity in a variety of solid tumor and leukemia models (Pinthus, et al,, 2004, J Clin Invest 114(12): 1774-1781 ; Milone, et al, 2009, Mol Ther 17(8): 1453- 1464; Sadelain, et al, 2009, Curr Opin Immunol 21(2):215-223). The benefit of bypassing the need for antigen presentation by MHC molecules to achieve cytotoxicity makes CAR-engineered T cells an attractive therapeutic modality.
  • Adoptive transfer of cytotoxic T lymphocytes (CTLs) has shown great promise in both viral and cancer indications. After many years of less than optimum results with CAR-based T-cell therapy, improved culture systems and cell engineering technologies have made possible CAR T cells with more potent antitumor effects (Sadelain et al, 2009, Curr Opin Immunol 21 :215-23). The technology has also been successfully applied in the clinical context, with improved clinical results being reported for CARs introduced with retroviral vectors (Till et al, 2008, Blood 112:2261-71; Pule et al, 2008, Nat Med 14: 1264-70). These CAR T cells also exhibit enhanced toxicity (Brentjens et al, 2010, Mol Ther 18:666-8; Morgan et al, 2010, Mol Ther 18:843-51).
  • As an emerging technology, there is an urgent need in the art for improving on existing CAR-based therapies that would allow for more effective, safe, and efficient adoptive transfer of CTLs. Chmielewski et al., Cancer Research (2011);71:5697-5706, Chinnasamy et al., Clinical Cancer Research (2012);18(6):1672-1683, Chmielewski et al., Immunological Reviews (2014);257(1):83-90 and Hoyos et al., Leukemia (2010);24(6):1160-1170 relate to CAR T cells engineered to express cytokines. US 2013/071414 A1 relates to engineered CD19-specific T lymphocytes that coexpress IL-15 and an inducible Caspase-9 based suicide gene for the treatment of B-cell malignancies. WO 2013/126712 A1 relates to compositions and methods for generating a persisting population of T cells useful for the treatment of cancer. WO 2008/121420 A1 relates to constitutive expression of costimulatory ligands on adoptively transferred T-lymphocytes.
  • SUMMARY
  • The present invention provides a T cell comprising exogenous nucleic acid, wherein: (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
    the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence, and the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  • The present invention also provides a composition comprising such a T cell and optionally further comprising a second therapeutic agent.
  • The present invention also provides such a T cell for use in a method of:
    1. i) providing anti-tumor immunity in a subject;
    2. ii) treating a subject having a disease associated with the expression of a disease-associated antigen;
    3. iii) enhancing epitope spreading in a subject with cancer; or
    4. iv) vaccinating a subject,
    wherein the method comprises administering an effective amount of the T cell to the subject, optionally wherein the subject is a human.
  • The present invention also provides a method of generating a T cell having enhanced anti-tumor activity, the method comprising introducing a nucleic acid, wherein: (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
    the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  • The present invention also provides a T cell engineered to express a chimeric antigen receptor (CAR), for use in the treatment of cancer by CAR-mediated cancer cell killing and enhanced priming of T cells with tumor antigen, wherein the CAR-engineered T cell comprises exogenous nucleic acid comprising: (a) a first nucleic acid sequence encoding the CAR, wherein said CAR comprises an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
    • the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence, and
    • the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  • These and further embodiments are set out in the attached claims.
  • DETAILED DESCRIPTION
  • The technical information set out below may in some respects go beyond the scope of the invention, which is defined by the attached claims. The additional technical information is provided to place the actual invention in a broader technical context and to illustrate possible related technical developments. Incidental references to methods for treatment of the human or animal body by surgery or therapy and diagnostic methods practised on the human or animal body are not to be construed as claiming protection for such methods themselves, but are instead to be construed as referring to products, in particular substances or compositions, for use in any of these methods.
  • The present invention provides T cells engineered to exhibit increased anti-tumor activity by co-expressing a chimeric antigen receptor (CAR) and one or more enhancers of T cell priming (hereafter "ETPs"). In the present invention the ETP is selected from the group of CD70, CD86 and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. The addition of an ETP component to the CAR T cell confers enhanced "professional" antigen-presenting cell (APC) function, which confers permanent anti-tumor immunity. In an embodiment, the CAR and one or more ETPs are transiently co-expressed in a T cell. Thus, the engineered T cells are safe (given the transient nature of the CAR / ETP expression), and induce prolonged (even permanent) immunity via APC function. As such, the T cells can be used to treat a wide variety of diseases associated with cell surface (target) antigens.
  • Accordingly, disclosed herein is a T cell comprising exogenous nucleic acid, wherein
    • (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and
    • (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof,
    provided that the first and/or second nucleic acid sequence comprises an RNA. In the T cell of the invention, the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence; the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, and the first and/or second nucleic acid sequence is an RNA, wherein said first and/or second RNA is transiently expressed.
  • The CAR may further comprise a second intracellular signaling domain, e.g., a costimulatory signaling domain. In an embodiment, the first and second nucleic acid sequences are disposed on a single nucleic acid molecule. In the invention, the nucleic acid molecule comprises RNA.
  • In an embodiment, the first and second nucleic acid sequences are disposed on two or more distinct nucleic acid molecules. In the invention, one or both nucleic acid molecules comprise RNA molecules.
  • In an embodiment, one nucleic acid molecule comprises an RNA molecule and the other nucleic acid comprises a DNA molecule.
  • In an embodiment, the second intracellular signaling domain comprises a costimulatory signaling domain.
  • In an embodiment, the CAR comprises one or more costimulatory signaling domains.
  • In an embodiment, the intracellular signaling domain comprises a CD3zeta domain and the second intracellular signaling domain comprises a 4-1BB domain.
  • In an embodiment, the first nucleic acid sequence comprises an RNA. In an embodiment, the second nucleic acid sequence comprises an RNA. In an embodiment, the first and the second nucleic acid sequence each comprise RNA.
  • In an embodiment, the T cell is transfected to transiently express the first and/or second RNAs.
  • In an embodiment, the T cell does not comprise an exogenous DNA encoding the first or second RNA.
  • In an embodiment, the first and/or second RNAs are generated by in vitro transcription.
  • In an embodiment, the first and/or second RNAs are synthetic RNAs.
  • In an embodiment, the first and/or second RNAs are introduced into the T cell by electroporation.
  • In an embodiment, the CAR further comprises one or more costimulatory signaling domains, and wherein the first or second nucleic acid sequence comprises DNA or cDNA.
  • In an embodiment, the first or second nucleic acid sequence comprises a vector. In an embodiment, the vector is a viral vector. In an embodiment, the viral vector is a retroviral vector or a lentiviral vector. In an embodiment, the T cell is virally transduced to express the first or second nucleic acid sequence.
  • In an embodiment, the extracellular domain of the CAR comprises an antigen-binding domain. In an embodiment, the antigen-binding domain is a scFv domain.
  • In an embodiment, the transmembrane domain comprises the transmembrane portion of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154.
  • In an embodiment, the intracellular signaling domain comprises a functional signaling domain of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
  • In an embodiment, the extracellular domain is connected to the transmembrane domain by a hinge region.
  • In an embodiment, the CAR further comprises one or more costimulatory signaling domains. In an embodiment, the costimulatory signaling domain is a functional signaling domain from a protein selected from the group consisting of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD11a/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
  • Polypeptides which enhance T cell priming (ETP) can be selected from the group consisting of a costimulatory molecule, a soluble cytokine, a polypeptide involved in antigen presentation, a polypeptide involved in trafficking and/or migration, or a polypeptide involved in dendritic cell targeting, or a functional fragment or variant thereof. A costimulatory molecule ETP may be selected from the group consisting of CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD 112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, and functional fragments and variants thereof. A soluble cytokine may be selected from the group consisting of: IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, IL-27, and functional fragments and variants thereof. A polypeptide involved in antigen presentation may be selected from the group consisting of CD64, MHC I, MHC II, and functional fragments and variants thereof. A polypeptide involved in trafficking and/or migration may be selected from the group consisting of CD183, CCR2, CCR6, CD50, CD197, CD58, CD62L, and functional fragments and variants thereof. A polypeptide involved in DC targeting may be selected from the group consisting of TLR ligands, anti-DEC-205 antibody, an anti-DC-SIGN antibody, and functional fragments and variants thereof. The present invention utilises an ETP that is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure which do not utilise such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention
  • In an embodiment, the antigen-binding domain binds to an antigen associated with a disease state. In an embodiment, the disease state is selected from the group consisting of a proliferative disease, a precancerous condition, a non-cancer indication, a viral infection, and a bacterial infection. In an embodiment, the antigen-binding domain binds to a tumor antigen, a viral antigen, or a bacterial antigen. In an embodiment, the tumor antigen is an antigen associated with a cancer selected from the group consisting of brain cancer, bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  • In an embodiment, the T cell has enhanced antigen presentation ability relative to a T cell which lacks the second nucleic acid sequence.
  • In the invention, the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence.
  • In an embodiment, the T cell is transfected to transiently express a nucleic acid comprising a third nucleic acid sequence encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof, which differs from the polypeptide encoded by the second nucleic acid sequence. In an embodiment, the T cell has increased T cell priming ability relative to a T cell comprising the first nucleic acid sequence and second nucleic acid sequence, but not the third nucleic acid sequence. In an embodiment, the third nucleic acid sequence comprises an RNA. In an embodiment, the T cell is transfected to transiently express the third RNA. In an embodiment, the cell does not comprise an exogenous DNA encoding the third RNA. In an embodiment, the CAR comprises one or more costimulatory signaling domains, and wherein the third nucleic acid sequence comprises DNA. In an embodiment, the T cell further comprises one or more additional distinct nucleic acid sequences encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof, which differ from the polypeptides encoded by the second and third nucleic acid sequences. In an embodiment, the one or more additional nucleic acid sequences comprises RNA. In an embodiment, the CAR comprises one or more costimulatory signaling domains, and wherein the one or more additional nucleic acids comprise DNA. In an embodiment, the first, second, and/or additional nucleic acid sequences are transcribed from one or more in vitro transcription vectors.
  • In an embodiment, expression of the polypeptide encoded by the second and/or additional nucleic acid sequences does not substantially affect, e.g., decrease, reduce, or inhibit, the cell-killing function of the CAR encoded by the first nucleic acid sequence.
  • In an embodiment, the T cell has increased efficacy in killing tumor cells or reducing tumor size in a subject with a tumor relative to a T cell comprising only the CAR encoded by the first nucleic acid sequence.
  • In an embodiment, the T cell enhances the priming of T cells with a tumor antigen, a viral antigen, a bacterial antigen.
  • The T cells described herein may be made by introducing a nucleic acid wherein (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, or a functional fragment or variant thereof; provided that the first and/or second nucleic acid sequence comprises an RNA.
  • Accordingly, in another aspect, the invention provides a method of generating a T cell having enhanced anti-cancer activity, e.g., anti-tumor activity, the method comprising introducing a nucleic acid, wherein:
    1. (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) described herein comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and
    2. (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming (ETP) wherein the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming;
    wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed. In one embodiment the CAR further comprises a second intracellular signaling domain.
  • In an embodiment, the first and second nucleic acid sequences are disposed on a single nucleic acid molecule. In the invention, the nucleic acid molecule comprises RNA.
  • In an embodiment, the first and second nucleic acid sequences are disposed on two or more distinct nucleic acid molecules. In the invention, one or both nucleic acid molecules comprise RNA molecules.
  • In an embodiment, one nucleic acid molecule comprises an RNA molecule and the other nucleic acid comprises a DNA molecule.
  • In an embodiment, the second intracellular signaling domain comprises a costimulatory signaling domain. In an embodiment, the CAR comprises one or more costimulatory signaling domains. In an embodiment, the intracellular signaling domain comprises a CD3zeta domain and the second intracellular signaling domain comprises a 4-1BB domain.
  • In an embodiment, the first nucleic acid sequence comprises an RNA. In an embodiment, the second nucleic acid sequence comprises an RNA. In an embodiment, the first and the second nucleic acid sequence each comprise RNA.
  • In an embodiment, the T cell is transfected to transiently express the first and/or second RNAs.
  • In an embodiment, the Tcell does not comprise an exogenous DNA encoding the first or second RNA.
  • In an embodiment, the first and/or second RNAs are generated by in vitro transcription.
  • In an embodiment, the first and/or second RNAs are synthetic RNAs.
  • In an embodiment, the first and/or second RNAs are introduced into the T cell by electroporation.
  • In an embodiment, the CAR further comprises one or more costimulatory signaling domains, and wherein the first or second nucleic acid sequence comprises DNA or cDNA.
  • In an embodiment, the first or second nucleic acid sequence comprises a vector. In an embodiment, the vector is a viral vector. In an embodiment, the viral vector is a retroviral vector or a lentiviral vector. In an embodiment, the T cell is virally transduced to express the first or second nucleic acid sequence.
  • The T cell may be used in a method of vaccinating a subject comprising administering to the subject the T cell. The method may further comprise administering to the subject an antigen. The antigen may be a tumor antigen, a viral antigen, or a bacterial antigen.
  • Also disclosed herein is a T cell, transfected to transiently express two or more distinct exogenous RNAs, wherein (a) the first RNA comprises a nucleic acid sequence encoding a CAR comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and (b) the second RNA comprises a nucleic acid sequence encoding a polypeptide which enhances T cell priming (i.e., an ETP). In the T cell of the invention, the ETP is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming, and the T cell has enhanced T cell priming ability relative to a T cell which lacks the second RNA. In some embodiments, the T cells of the invention are transfected to transiently express a third distinct RNA comprising a nucleic acid sequence encoding an ETP, or a functional fragment or variant thereof, which differs from that encoded by the second RNA.
  • Exemplary extracellular domains of the CAR include, for example, an antigen-binding moiety, e.g., an scFv domain, which binds a disease-associated antigen (i.e., an antigen that is either unique, or expressed more highly in diseased cells compared to normal cells). Such antigens can be associated witha proliferative disease, a precancerous condition, and a non-cancer indication. In some embodiments, the antigen-binding moiety binds a tumor antigen, for example, an antigen associated with brain cancer (e.g., a glioma), bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  • In one embodiment, the transmembrane domain of the CAR is a transmembrane domain described herein. Exemplary transmembrane domains of the CAR include a transmembrane domain of, for example, the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154. The extracellular domain can be connected to the transmembrane domain by a hinge region.
  • In one embodiment, the intracellular domain of the CAR is an intracellular domain described herein. Exemplary intracellular domains of the CAR include, for example, the functional signaling domain of TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, 4-1BB, and/or CD3-zeta. In an embodiment, the intracellular signaling domain comprises a functional signaling domain of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12.
  • The CAR may also comprise one or more costimulatory signaling domains, e.g., a costimulatory signaling domain described herein. For example, the costimulatory signaling domain can be a costimulatory signaling domain of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD11a/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
  • The ETP encoded by the second RNA is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure in which the second RNA does not encode such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention. Other ETPs include, for example, a costimulatory molecule (e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, for functional fragments or variants thereof), a soluble cytokine (e.g., IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, and IL-27, or functional fragments or variants thereof), a polypeptide involved in antigen presentation (e.g., CD64, MHC I, and MHC II, or functional fragments or variants thereof), a polypeptide involved in trafficking and/or migration (e.g., CD183, CCR2, CCR6, CD50, CD197, CD58, and CD62L, or functional fragments or variants thereof), or a polypeptide involved in dendritic cell targeting (e.g., TLR ligands, anti-DEC-205 antibody, and an anti-DC-SIGN antibody, or functional fragments or variants thereof).
  • The RNA ETP-CAR T cells of the invention have enhanced T cell priming ability relative to a T cell which lacks the RNA encoding the ETP and optionally antigen presentation ability relative to a T cell which lacks the RNA encoding the ETP. When two or more ETPs are transiently transfected into a T cell, the additional ETPs enhance the antigen presentation and/or T cell priming ability of a T cell lacking the additional ETPs. In some embodiments, the T cell is transfected to transiently express a third distinct RNA comprising a nucleic acid sequence encoding an ETP which differs from the ETP encoded by the second RNA. In this case, the T cell has increased antigen presentation and/or T cell priming ability relative to a T cell comprising the first RNA and second RNA, but not the third RNA.
  • In some embodiments, the expression of the CAR or CARs does not substantially affect the level of expression of the ETP or ETPs in the RNA ETP-CAR T cell, wherein the CAR comprises an antigen binding domain that binds the antigen, and the expression of the ETP or ETPs does not substantially affect the level of expression or cell-killing function of the CAR or CARs in the RNA ETP-CAR T cell.
  • The RNA ETP-CAR T cells of the invention have, for example, increased efficacy in killing tumor cells and/or reducing tumor size and/or priming of T cells with a tumor antigen in a subject with a tumor relative to a RNA CAR T cell, i.e., a T cell transiently expressing the CAR alone.
  • The RNAs encoding the CAR or CARs and ETP or ETPs are transcribed from, e.g., an in vitro transcription vector, and introduced into T cells by, e.g., electroporation.
  • In another aspect, the invention provides compositions, for example, a pharmaceutical composition comprising a pharmaceutically acceptable carrier, comprising an RNA ETP-CAR T cell as defined in the claims.
  • In another aspect, the invention relates to method of generating a T cell having enhanced anti-tumor activity, the method comprising transiently transfecting a T cell with two or more distinct exogenous RNAs, wherein: (a) the first RNA comprises a nucleic acid sequence encoding a CAR comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and b) the second RNA comprises a nucleic acid sequence encoding an ETP, or a functional fragment or variant thereof, as defined in the claims.
  • In another aspect, the invention relates to a RNA ETP-CAR T cell of the invention for use in a method of providing anti-tumor immunity in a subject comprising administering to the subject, for example, a human subject, an effective amount of the RNA ETP-CAR T cell.
  • In another aspect, the invention relates to a RNA ETP-CAR T cell of the invention for use in a method of treating a subject, for example, a human subject, having a disease associated with a disease-associated antigen comprising administering to the subject an effective amount of the RNA ETP-CAR T cell. In some embodiments, the disease is a proliferative disease, a precancerous condition, or a non-cancer-related indication. In one embodiment, the cancer is a cancer described herein. In an embodiment, the non-cancer-related indication is a viral infection or a bacterial infection.
  • In another aspect, the invention relates to an RNA ETP-CAR T cell of the invention for use in a method of enhancing epitope spreading in a subject, for example, a human subject, with cancer comprising administering to the subject the RNA ETP-CAR T cell.
  • In another aspect, disclosed herein are the RNA ETP-CAR T cells and RNA ETP-CAR T cell compositions of the invention and their use for preparing medicaments or use for treating, diseases associated with disease-associated antigens, such as cancer, autoimmune diseases, inflammatory diseases, and infectious diseases.
  • BRIEF DESCRIPTION OF THE FIGURES
    • Figure 1 shows candidate molecules associated with various aspects of CTL priming for RNA engineering and use in conjunction with CARs. The exemplary molecules listed are highly upregulated in dendritic cells, which are potent professional antigen-presenting cells (APCs).
    • Figure 2 is a bar graph showing the upregulation of costimulatory molecule expression in mature dendritic cells. Immature DCs were cultured from adherent monocytes in the presence of IL-4 and GM-CSF for 7 days. Mature DCs were first cultured in the presence of IL-4 and GM-CSF for 5 days, followed by the addition of TNFα, IL-1β, IL-6, and PGE2 for an additional 2 days. Immature and mature DCs were stained with antibodies (Abs) specific for the indicated markers and analyzed by flow cytometry. The fold-increase of each marker was calculated as a ratio of marker expression in mature DCs over immature DCs.
    • Figure 3 shows the expression of CD70, CD83, CD80 (B7-1), CD86 (B7-2), CD275 (ICOS-L), CD43, CD137L (4-1BBL), CD252 (OX40L), CD58 (LFA-3), CD48, TL1A, CD270 (HVEM), CD40, CD154 (CD40L), CD 150 (SLAM), and CD64 after electroporation of their RNAs into T cells. High quality mRNA encoding costimulatory molecules was produced following gene cloning into a plasmid DNA template. 8-10 µg of RNA was electroporated into 2.5×106 T cells using a BTX ECM 830 electroporator for a single pulse at 500 V for 0.7 ms. Electroporated T cells were then cultured overnight in standard T cell culture medium and then stained for respective molecule expression by flow cytometry. Filled lines display costimulatory molecule expression in T cells that were not stained, blue lines show T cells that were electroporated but without RNA and stained, and red lines designate T cells that were electroporated with the indicated RNAs and stained.
    • Figure 4A describes the experimental flow for the modified in vitro priming system using DCs to prime MART-1+ CTL. DCs were cultured (as described in Figure 1) and then co-cultured in six-well plates with autologous PBMCs at a ratio of (1:10) in the presence of MART-1 peptide (0.25 µg/mL), IL-2, IL-7, IL-15, and IL21 for 13 days. After a single round of peptide stimulation for 13 days, CTL induction was measured by flow cytometry and MART-1+ T cells were detected using an APC-conjugated MART-1 tetramer. Figure 4B depicts FACS plots showing the frequency of MART-1+ T cells per well when immature or mature DCs were used as effector cells.
    • Figure 5 shows FACs plots demonstrating that T cells which express costimulatory molecules via RNA electroporation are capable of enhancing T:T priming of MART-1+CTL. Similar to the co-culture assay described for Figure 3, T cells electroporated with the indicated RNAs were co-cultured with autologous PBLs in six-well plates at a ratio of (1:10) in the presence of MART-1 or h-Clip (control) peptide (0.25 µg/mL), IL-2, IL-7, IL-15, and IL21 for a period of 13 days. After a single round of peptide stimulation for 13 days, CTL induction was measured by flow cytometry and MART-1+ T cells were detected using an APC-conjugated MART-1 tetramer. Numbers in FACS plots indicate percentage of MART-1+ T cells per well.
    • Figure 6 shows the expression of meso-CAR, CD70, CD86 (B7-2), CD137L (4-1BBL), and CD252 (OX40L) after co-electroporation of RNAs for meso-CAR and the indicated costimulatory molecules into T cells. Co-expression of Meso-CAR along with costimulatory molecules had no remarkable effect on either the CAR or the costimulatory molecule. Electroporation was carried out as described for Figure 3 . T cells were co-electroporated with 8 µg of Meso-CAR and 8 µg of RNA encoding each of the costimulatory molecules. Dashed lines represent T cells that were not stained and thin gray lines are T cells that were electroporated but did not receive RNA. Thick gray lines on top row indicate CAR expression in the absence of costimulatory molecule RNA transfection while the black line designates CAR expression when the two are combined. In the bottom row, black lines indicate expression levels of costimulatory molecules transfected in the absence of CAR, while thick gray line display costimulatory marker expression in the presence of CAR.
    • Figure 7 is a bar graph showing that co-expression of CAR and costimulatory molecules did not affect CAR-mediated cell killing. Meso-CAR expressing T cells also expressing costimulatory molecules were incubated with two different meso-expressing tumor lines (K-meso and SKOV3) and one meso-negative line (K562) and evaluated for CD107a/LAMP-1 exposure on T cell surfaces in a 4 h degranulation assay. Co-expression of CAR and costimulatory molecules did not markedly decrease CAR-mediated cell killing.
    • Figure 8A describes the experimental flow for the modified in vitro priming system using RNA electroporated bead-stimulated T cells to prime MART-1+ CTL. Bead-stimulated T cells were cultured, electroporated with the indicated RNAs, and then co-cultured in 24-well plates with autologous purified CD8+ T cells at a ratio of (1:10) in the presence of MART-1 peptide (0.25 - 1 µg/mL) and IL-21 for 3 days, followed by subsequent feedings with fresh medium containing IL-2, IL-7 and IL-15 for an additional 10 days. After a single round of peptide stimulation for 13 days, CTL induction was measured by flow cytometry and MART-1+ T cells were detected using an APC-conjugated MART-1 tetramer. Figure 8B shows the summarized results of the experiment demonstrating that bead-stimulated T cells which express costimulatory molecules via RNA electroporation are capable of enhancing T:T priming of MART-1+ CTL.
    • Figure 9A demonstrates that T:T priming of MART-1+ CTL, as described in Figure 8, can be further enhanced by the application of low-dose irradiation of RNA-engineered bead-stimulated T cells. Bead-stimulated T cells were cultured, electroporated with the indicated dose of CD70 RNA, subjected to low-dose irradiation at the indicated doses, and then co-cultured in 24-well plates with autologous purified CD8+ T cells at a ratio of (1:10) in the presence of MART-1 peptide (0.25 - 1 µg/mL) and IL-21 for 3 days, followed by subsequent feedings with fresh medium containing IL-2, IL-7 and IL-15 for an additional 10 days. After a single round of peptide stimulation for 13 days, CTL induction was measured by flow cytometry and MART-1+ T cells were detected using an APC-conjugated MART-1 tetramer. Data are summarized in the scatterplot and linear trend lines for each dosage of irradiation is displayed; blue shapes and lines represent data from bead-stimulated T cells that were not irradiated, green from those receiveing 1 Gy, orange from those receiving 3 Gy, and red from those receiving 5 Gy. Figure 9B shows the total number of MART+ CD8+ T cells per well as a function of increasing irradiation. These data demonstrate that low-dose irradiation treatment of RNA-engineered bead-stimulated T cells may enhance their capacity for T:T priming of MART+ CTL.
    FURTHER DETAILED DESCRIPTION Definitions
  • Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
  • The term "a" and "an" refers to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an element" means one element or more than one element.
  • The term "about" when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20% or in some instances ±10%, or in some instances ±5%, or in some instances ±1%, or in some instances ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.
  • As used herein, a 5' cap (also termed an RNA cap, an RNA 7- methylguanosine cap or an RNA m7G cap) is a modified guanine nucleotide that has been added to the "front" or 5' end of a eukaryotic messenger RNA shortly after the start of transcription. The 5' cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co- transcriptionally, such that each influences the other. Shortly after the start of transcription, the 5' end of the mRNA being synthesized is bound by a capsynthesizing complex associated with RNA polymerase. This enzymatic complex catalyzes the chemical reactions that are required for mRNA capping. Synthesis proceeds as a multi-step biochemical reaction. The capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation.
  • As used herein, "polyadenylation" refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNAmolecule. In eukaryotic organisms, most messenger RNA(mRNA) molecules are polyadenylated at the 3' end. The 3' poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase. In higher eukaryotes, the poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal. The poly(A) tail and the protein bound to it aid in protecting mRNA from degradation by exonucleases. Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm. After transcription has been terminated, the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase. The cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site. After the mRNA has been cleaved, adenosine residues are added to the free 3' end at the cleavage site.
  • The term "in vitro transcribed RNA" refers to RNA, preferably mRNA, that has been synthesized in vitro. Generally, the in vitro transcribed RNA is generated from an in vitro transcription vector. The in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
  • The term "Chimeric Antigen Receptor" or alternatively a "CAR" refers to a recombinant polypeptide construct comprising at least an extracellular antigen binding domain, a transmembrane domain and a cytoplasmic signaling domain (also referred to as an intracellular signaling domain") comprising a functional signaling domain derived from a stimulatory molecule as defined below (also referred to herein as a "primary signaling domain"). In some embodiments, the stimulatory molecule is TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, 4-1BB or CD3-zeta. In a particular embodiment, the stimulatory molecule is the zeta chain associated with the T cell receptor complex. In one embodiment, the stimulatory molecule is 4-1BB. In one embodiment, the cytoplasmic signaling domain further comprises one or more functional signaling domains derived from at least one costimulatory molecule as defined below (also referred to as a "costimulatory signaling domain"). In one embodiment, the costimulatory molecule is chosen from a costimulatory molecule described herein, e.g., OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 1a/CD18), ICOS and 4-1BB (CD137), or any combination thereof. In one embodiment, the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule (a primary signaling domain). In one embodiment, the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a co-stimulatory molecule (a costimulatory signaling domain) and a functional signaling domain derived from a stimulatory molecule (a primary signaling domain). In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule. In one embodiment, the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising at least two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule. In one embodiment the CAR comprises an optional leader sequence at the amino-terminus (N-ter) of the CAR fusion protein. In one embodiment, the CAR further comprises a leader sequence at the N-terminus of the extracellular antigen binding domain, wherein the leader sequence is optionally cleaved from the scFv domain during cellular processing and localization of the CAR to the cellular membrane. In one embodiment, the leader sequence comprises (e.g., consists of) the amino acid sequence of SEQ ID NO: 2. In one embodiment, the CAR is a regulatable chimeric antigen receptor (RCAR).
  • The term "regulatable chimeric antigen receptor (RCAR),"as that term is used herein, refers to a set of polypeptides, typically two in the simplest embodiments, which when expressed in a cell, e.g., an RCARX cell, provides the cell with specificity for a target cell, typically a cancer cell, and with regulatable intracellular signal generation or proliferation, which can optimize an immune effector property of the RCAR-expressing cell. An RCAR-expressing cell relies at least in part, on an antigen binding domain to provide specificity to a target cell that comprises the antigen bound by the antigen binding domain. In an embodiment, an RCAR includes a dimerization switch that, upon the presence of a dimerization molecule, can couple a polypeptide comprising an intracellular signaling domain to a polypeptide comprising an antigen binding domain.
  • The term "dimerization molecule," as that term is used herein, e.g., when referring to an RCAR, refers to a molecule that promotes the association of a first switch domain with a second switch domain. In embodiments, the dimerization molecule does not naturally occur in the subject, or does not occur in concentrations that would result in significant dimerization. In embodiments, the dimerization molecule is a small molecule, e.g., rapamycin or a rapalogue, e.g, RAD001.
  • The term "signaling domain" refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
  • The term "antibody," as used herein, refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen. Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact immunoglobulins, and may be derived from natural sources or from recombinant sources. Antibodies are typically tetramers of immunoglobulin molecules.
  • The term "antibody fragment" refers to at least one portion of an antibody, that retains the ability to specifically interact with (e.g., by binding, steric hinderance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CH1 domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide brudge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody. An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005). Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3)(see U.S. Patent No.: 6,703,199 , which describes fibronectin polypeptide minibodies).The term "scFv" refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked, e.g., via a synthetic linker, e.g., a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived. Unless specified, as used herein an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
  • The portion of the CAR of use in the invention comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv),a humanized antibody or bispecific antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426). In one aspect, the antigen binding domain of a CAR composition of use in the invention comprises an antibody fragment. In a further aspect, the CAR comprises an antibody fragment that comprises a scFv.
  • The term "antibody heavy chain," refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
  • The term "antibody light chain," refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa (κ) and lambda (λ) light chains refer to the two major antibody light chain isotypes.
  • The term "recombinant antibody" refers to an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system. The term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
  • The term "anti-cancer effect" refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of cancer cells, a decrease in the number of metastases, an increase in life expectancy, decrease in cancer cell proliferation, decrease in cancer cell survival, or amelioration of various physiological symptoms associated with the cancerous condition. An "anti-cancer effect" can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies in prevention of the occurrence of cancer in the first place. The term "anti-tumor effect" refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, or a decrease in tumor cell survival.
  • The term "autologous" refer to any material derived from the same individual to whom it is later to be re-introduced into the individual.
  • The term "allogeneic" refers to any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.
  • The term "xenogeneic" refers to a graft derived from an animal of a different species.
  • The term "proliferative disease" refers to any disease or disorder including cancers, malignancies, benign growths and other conditions that result from hyperactivity or hyperplasia of somatic cells.
  • The term "cancer" refers to a disease characterized by the uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
  • The term "T cell priming" refers to the process by which a naive T cell undergoes clonal expansion and differentiation into an effector cytotoxic T cell (CTL) after being stimulated by contact with an antigen.
  • The term "Enhancer of T cell priming" or "ETP" refers to a molecule that, when introduced into a cell, enhances the cell's antigen presentation and T cell priming activities. Exemplary ETPs include, but are not limited to, costimulatory molecules (e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD 112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, and ligands thereof), soluble cytokines (e.g., IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, IL-27), polypeptides involved in antigen presentation (e.g., CD64, MHC I, MHC II), polypeptides involved in trafficking and/or migration (e.g., CD183, CCR2, CCR6, CD50, CD197, CD58, CD62L), and polypeptides involved in dendritic cell targeting (e.g., TLR ligands, anti-DEC-205 antibody, anti-DC-SIGN antibody). The present invention utilises an ETP that is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure which do not utilise such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention. Candidate ETPs can be tested for T cell priming activity using assays described in the Examples. T cells comprising a nucleic acid sequence encoding a CAR and a nucleic acid encoding an ETP are referred to herein as "ETP-CAR T cells". T cells transiently transfected with an RNA encoding a CAR and an RNA encoding an ETP are referred to herein as "RNA ETP-CAR T cells."
  • The term "epitope spreading" or "antigen spreading" refers to the ability of the immune system to attack new targets beyond that to which a vaccine is designed to attack, by recognizing antigenic fragments of killed cells as new targets.
  • The term "conservative sequence modifications" refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or antibody fragment of use in the invention by standard techniques known in the art, such as sitedirected mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • The term "stimulation," refers to a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex. Stimulation can mediate the altered expression of certain molecules, such as downregulation of TGF-β, and/or reorganization of cytoskeletal structures, and the like.
  • The term "stimulatory molecule," refers to a molecule expressed by an immune cell, e.g., a T cell, a NK cell, or a B cell, that provide the cytoplasmic signaling sequence(s) that regulate activation of the immune cellin a stimulatory way for at least some aspect of the immune cell signaling pathway. In one aspect, the signal is a primary signal that is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with a peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like. Primary cytoplasmic signaling sequences (primary signaling domain) that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Examples of ITAM containing cytoplasmic signaling sequences that are of particular use in the invention include those derived from CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12. In one embodiment, the cytoplasmic signaling molecule in any one or more CARs of use in the invention comprises a cytoplasmic signaling sequence derived from CD3-zeta. In one embodiment, the cytoplasmic signaling sequence derived from CD3-zeta is the sequence provided as SEQ ID NO: 18 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • The term "antigen presenting cell," refers to an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays foreign antigens complexed with major histocompatibility complexes (MHC's) on their surfaces. T-cells may recognize these complexes using their T-cell receptors (TCRs). APCs process antigens and present them to T-cells.
  • The term "zeta" or alternatively "zeta chain", "CD3-zeta" or "TCR-zeta" is defined as the protein provided as GenBank Acc No. BAG36664.1, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like, and a "zeta stimulatory domain" or alternatively a "CD3-zeta stimulatory domain" or a "TCR-zeta stimulatory domain" is defined as the amino acid residues from the cytoplasmic domain of the zeta chain, or functional derivatives thereof, that are sufficient to functionally transmit an initial signal necessary for T cell activation. In one aspect the cytoplasmic domain of zeta comprises residues 52 through 164 of GenBank Acc No. BAG36664.1 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like, that are functional orthologs thereof. In one aspect, the "zeta stimulatory domain" or a "CD3-zeta stimulatory domain" is the sequence provided as SEQ ID NO:18.
  • The term a "costimulatory molecule" refers to a cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation. Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response. Costimulatory molecules, e.g., that may confer T cell priming activity when expressed in an ETP-CAR T cell as described herein, include, but are not limited to an MHC class I molecule, BTLA and a Toll ligand receptor, as well as CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD43, CD48, CD 112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), and CD44.
  • A costimulatory intracellular signaling domain of a CAR described herein can be the intracellular portion of a costimulatory molecule. A costimulatory molecule can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors. Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, ICAM-1, lymphocyte function-associated antigen-1 (LFA-1), CD2, CDS, CD7, CD287, LIGHT, NKG2C, NKG2D, SLAMF7, NKp80, NKp30, NKp44, NKp46, CD160, B7-H3, and a ligand that specifically binds with CD83, and the like.
  • The intracellular signaling domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment or derivative thereof.
  • The term "4-1BB" refers to member of the TNFR superfamily with an amino acid sequence provided as GenBank accno. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like; and a "4-1BB costimulatory domain" are defined amino acid residues 214-255 of GenBank accno. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like. In one aspect, the "4-1BB costimulatory domain" is the sequence provided as SEQ ID NO: 14 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • The term "encoding" refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA, and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene, cDNA, or RNA, encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • Unless otherwise specified, a "nucleic acid sequence encoding an amino acid sequence" includes all nucleic acid sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleic acid sequence that encodes a protein or a RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • The term "effective amount" or "therapeutically effective amount" are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result. Such results may include, but are not limited to, the inhibition of virus infection as determined by any means suitable in the art.
  • The term "endogenous" refers to any material from or produced inside an organism, cell, tissue or system.
  • The term "exogenous" refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • The term "expression" refers to the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
  • The term "expression vector" refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
  • The term "homologous" refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position. The homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
  • "Humanized" forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies/antibody fragments can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody or antibody fragment performance. In general, the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature, 321: 522-525, 1986; Reichmann et al., Nature, 332: 323-329, 1988; Presta, Curr. Op. Struct. Biol., 2: 593-596, 1992.
  • The term "variant," as used with respect to an ETP, refers to an RNA or polypeptide that differs from a wild-type ETP encoding RNA or polypeptide respectively, but retains essential properties of the wild-type ETP (e.g., ability to enhance antigen presentation and/or T cell priming).
  • The term "fully human" refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
  • The term "functional fragment," in connection with an ETP, is intended to mean a portion of the ETP that maintains the ability to enhance T cell priming.
  • The term "isolated" means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not "isolated," but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is "isolated." An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • In the context of the present invention, the following abbreviations for the commonly occurring nucleic acid bases are used. "A" refers to adenosine, "C" refers to cytosine, "G" refers to guanosine, "T" refers to thymidine, and "U" refers to uridine.
  • The term "lentivirus" refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
  • The term "lentiviral vector" refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009). Other examples of lentivirus vectors that may be used in the clinic, include but are not limited to, e.g., the LENTIVECTOR® gene delivery technology from Oxford BioMedica, the LENTIMAX™ vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
  • "Membrane anchor" or "membrane tethering domain", as that term is used herein, refers to a polypeptide or moiety, e.g., a myristoyl group, sufficient to anchor an extracellular or intracellular domain to the plasma membrane.
  • "Substantially complementary", as used herein, refers to sequences of nucleotides where a majority or all of the bases in the primer sequence are complementary, or one or more bases are non-complementary, or mismatched. Substantially complementary sequences are able to anneal or hybridize with the intended DNA target under annealing conditions used for PCR. The primers can be designed to be substantially complementary to any portion of the DNA template. For example, the primers can be designed to amplify the portion of a gene that is normally transcribed in cells (the open reading frame), including 5' and 3' UTRs. The primers can also be designed to amplify a portion of a gene that encodes a particular domain of interest. In one embodiment, the primers are designed to amplify the coding region of a human cDNA, including all or portions of the 5' and 3' UTRs. Primers useful for PCR are generated by synthetic methods that are well known in the art.
  • The term "substantially" refers to degree of variations of +/- by about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, or more. In one embodiment, an ETP co-expressed with a CAR in a T cell does not inhibit the cell killing function of a CAR by more than about 40%.
  • "Forward primers" are primers that contain a region of nucleotides that are substantially complementary to nucleotides on the DNA template that are upstream of the DNA sequence that is to be amplified.
  • "Upstream" is used herein to refer to a location 5, to the DNA sequence to be amplified relative to the coding strand.
  • "Reverse primers" are primers that contain a region of nucleotides that are substantially complementary to a double-stranded DNA template that are downstream of the DNA sequence that is to be amplified.
  • "Downstream" is used herein to refer to a location 3' to the DNA sequence to be amplified relative to the coding strand.
  • The term "operably linked" or "transcriptional control" refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter. For example, a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Operably linked DNA sequences can be contiguous with each other and, where necessary to join two protein coding regions, are in the same reading frame.
  • The term "parenteral" administration of an immunogenic composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
  • The term "nucleic acid" or "polynucleotide" refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
  • The terms "peptide," "polypeptide," and "protein" are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. "Polypeptides" include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, recombinant peptides, or a combination thereof.
  • The term "promoter" refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • The term "promoter/regulatory sequence" refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product. The promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • The term "flexible polypeptide linker" as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and serine residues used alone or in combination, to link variable heavy and variable light chain regions together. In one embodiment, the flexible polypeptide linker is a Gly/Ser linker and comprises the amino acid sequence (Gly-Gly-Gly-Ser)n, where n is a positive integer equal to or greater than 1. For example, n=1, n=2, n=3. n=4, n=5 and n=6, n=7, n=8, n=9 and n=10. In one embodiment, the flexible polypeptide linkers include, but are not limited to, (Gly4 Ser)4 or (Gly4 Ser)3 In another embodiment, the linkers include multiple repeats of (Gly2Ser), (GlySer) or (Gly3Ser). Also included within the scope of the invention are linkers described in WO2012/138475 .
  • The term "signal transduction pathway" refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell. The phrase "cell surface receptor" includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
  • The term "subject" refers to any living organisms in which an immune response can be elicited (e.g., mammals, human).
  • The term "switch domain," as that term is used herein, e.g., when referring to an RCAR, refers to an entity, typically a polypeptide-based entity, that, in the presence of a dimerization molecule, associates with another switch domain. The association results in a functional coupling of a first entity linked to, e.g., fused to, a first switch domain, and a second entity linked to, e.g., fused to, a second switch domain. A first and second switch domain are collectively referred to as a dimerization switch. In embodiments, the first and second switch domains are the same as one another, e.g., they are polypeptides having the same primary amino acid sequence, and are referred to collectively as a homodimerization switch. In embodiments, the first and second switch domains are different from one another, e.g., they are polypeptides having different primary amino acid sequences, and are referred to collectively as a heterodimerization switch. In embodiments, the switch is intracellular. In embodiments, the switch is extracellular. In embodiments, the switch domain is a polypeptide-based entity, e.g., FKBP or FRB-based, and the dimerization molecule is small molecule, e.g., a rapalogue. In embodiments, the switch domain is a polypeptide-based entity, e.g., an scFv that binds a myc peptide, and the dimerization molecule is a polypeptide, a fragment thereof, or a multimer of a polypeptide, e.g., a myc ligand or multimers of a myc ligand that bind to one or more myc scFvs. In embodiments, the switch domain is a polypeptide-based entity, e.g., myc receptor, and the dimerization molecule is an antibody or fragments thereof, e.g., myc antibody.
  • The term "substantially purified" cell refers to a cell that is essentially free of other cell types. A substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state. In some instances, a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state. In some aspects, the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
  • The term "therapeutic" as used herein means a treatment. A therapeutic effect is obtained by reduction, suppression, remission, or eradication of a disease state.
  • The term "prophylaxis" as used herein means the prevention of or protective treatment for a disease or disease state.
  • In the context of the present invention, "tumor antigen" or "hyperproliferative disorder antigen" or "antigen associated with a hyperproliferative disorder" refers to antigens that are common to specific hyperproliferative disorders. In certain aspects, the hyperproliferative disorder antigens of use with the present invention are derived from, cancers including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, non-Hodgkin's lymphoma, non-Hodgkins lymphoma, leukemias, uterine cancer, cervical cancer, bladder cancer, kidney cancer and adenocarcinomas such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, and the like.
  • The term "transfected" refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A "transfected" cell is one which has been transfected with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
  • As used herein, "transient" refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
  • As used herein, the terms "treat", "treatment" and "treating" refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of use in the invention). In specific embodiments, the terms "treat", "treatment" and "treating" refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient. In other embodiments the terms "treat", "treatment" and "treating" - refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both. In other embodiments the terms "treat", "treatment" and "treating" refer to the reduction or stabilization of tumor size or cancerous cell count.
  • The term "specifically binds," refers to an antibody, or a ligand, which recognizes and binds with a binding partner (e.g., a tumor antigen) protein present in a sample, but which antibody or ligand does not substantially recognize or bind other molecules in the sample.
  • Ranges: throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
  • Overview
  • The present invention is based on the discovery that the anti-tumor activities of T cells that express nucleic acid sequences encoding CARs can be further enhanced by the co-expression of nucleic acid sequences encoding molecules that enhance T cell priming (i.e., hereafter, "ETPs"), e.g., molecules involved in cellular co-stimulation and/or antigen presentation. Such T cells are referred to herein as "ETP-CAR T cells". In this way, the ETP-CAR T cells are armed not only with CAR T cell-directed cell killing ability, they also exhibit enhanced antigen presenting function, allowing for ETP-CAR T cell-mediated priming of non-engineered tumor-reactive T cells, both naive and antigen experienced. That is, the ETP-CAR T cells are dual functional T cells with both killer and "professional" APC function, creating a transient therapy with permanent anti-tumor effects. In the present invention, the T cells transiently express RNAs encoding CARs and/or RNAs encoding ETPs. T cells can also exhibit prolonged expression of CAR or ETPs, e.g., by virus-mediated transduction of nucleic acids encoding CARs and/or ETPs. In the T cells of the present invention the ETP is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • It was further discovered that ETP-CAR T cells, e.g., RNA ETP-CAR T cells, provide the added benefit of enhancing epitope spreading, which is classically defined by an immune response to a single antigen leading to the development of immunity against other antigens on the same tumor (Lehmann, Forsthuber et al. 1992, Kaufman, Clare-Salzler et al. 1993, Tisch, Yang et al. 1993, McRae, Vanderlugt et al. 1995, Vanderlugt and Miller 2002). Without being bound by theory, it is believed that, in the context of tumor rejection, ETP-CAR T cells, e.g., RNA ETP-CAR T cells, reacting specifically to a given tumor antigen via the CAR induces an inflammatory cascade at the site of antigen encounter. This then results in tissue destruction and the release of tumor antigens that may be processed and cross-presented by ETP-CAR T cells (which have been endowed with enhanced antigen-presenting and T cell priming abilities via the ETP component) , e.g., RNA ETP-CAR T cells, and other antigen-presenting cells, thus amplifying the response due to the recruitment of a diversified repertoire of T and B cells reacting to subdominant and/or cryptic tumor-derived epitopes.
  • The T cells disclosed herein can be genetically modified, e.g., by transfection or transduction, to express a nucleic acid sequence encoding a CAR described herein and a nucleic acid sequence encoding an ETP described herein. Depending on the clinical context, e.g., patient's condition or condition to be treated, prolonged or permanent expression of the CAR and/or the ETP may be desired, e.g., for robust and long-lasting CAR activity, e.g., anti-tumor activity, and ETP-based T cell priming activity. The T cells can be genetically modified, e.g., transduced, e.g., virally transduced, using vectors comprising nucleic acid sequences encoding a CAR and/or ETP described herein to confer prolonged expression of the CAR and/or the ETP.
  • Alternatively, transient expression of the CAR and/or the ETP may be desired. The transient presence of RNA ETP-CAR T cells (i.e., the reversibility of CAR and ETP expression) in a host presents a flexible platform for the fine tuning of and patient-tailored adoptive T cell therapy, which distinct from the strategy of permanently genetically modifying T cells with, e.g., virus-mediated CAR delivery. For example, RNA ETP-CAR T cells can be administered to subjects as needed (e.g., with single or multiple infusions), and the expression of the components (ETP and CAR) can be controlled by altering the amount of RNA encoding each for fine tuning of CAR-based cell killing or ETP-based T cell priming activity, depending on the patient's condition. This strategy may be particularly attractive in certain clinical contexts, for example, when there is a desire to limit the duration of on-target off-tumor toxicity, particularly in cases where disease-associated antigens are also expressed on normal tissues.
  • The present invention utilises nucleic acid sequences encoding chimeric antigen receptors (CAR) for expression in T cells with nucleic acid sequences encoding polypeptides that enhance T cell priming (ETP). Components of the CARs are further described herein.
  • In the present invention, a CAR described herein is used to generate a T cell with enhanced T cell priming activity.
  • Chimeric Antigen Receptor (CAR)
  • The present invention utilises a nucleic acid sequence, e.g., a DNA or an RNA construct, encoding a CAR, wherein the CAR further comprises an antibody fragment that binds to a disease-associated antigen. In one embodiment, the sequence encoding the antibody fragment is contiguous with, and in the same reading frame as a nucleic acid sequence encoding an intracellular domain. The intracellular domain comprises, a costimulatory signaling region and/or a zeta chain. The costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • In one embodiment, the CAR construct comprises an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, and an intracellular stimulatory domain. In one aspect, the CAR construct comprises an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, an intracellular costimulatory domain and an intracellular stimulatory domain.
  • An exemplary leader sequence is provided as SEQ ID NO: 2. An exemplary hinge/spacer sequence is provided as SEQ ID NO: 4, SEQ ID NO: 6, or SEQ ID NO: 8. An exemplary transmembrane domain sequence is provided as SEQ ID NO: 12. An exemplary sequence of the intracellular stimulatory domain, e.g., intracellular costimulatory domain, of the 4-1BB protein is provided as SEQ ID NO: 14. Another exemplary sequence of an intracellular stimulatory domain, e.g., costimulatory signaling domain, of the CD27 protein is provided as SEQ ID NO: 16. An exemplary CD3zeta domain sequence is provided as SEQ ID NO: 18 or 20.
  • Exemplary transmembrane domains that can be used in the CAR include, but are not limited to, a transmembrane domain from alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, and the like.
  • Exemplary intracellular domains that can be used in the CAR include, but are not limited to, one or more intracellular signaling domains including, but not limited to, e.g., CD3-zeta, CD28, 4-1BB, and the like. In some instances, the CAR can comprise any combination of CD3-zeta, CD28, 4-1BB, and the like.
  • Exemplary costimulatory signaling domains that can be used in the CAR include, but are not limited to, any combination of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1 1a/CD18), ICOS, 4-1BB (CD137), and the like.
  • The nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the gene of interest can be produced synthetically, rather than cloned.
  • The present invention includes an RNA construct that can be directly transfected or electroporated into a cell. A method for generating mRNA for use in transfection involves in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3' and 5' untranslated sequence ("UTR"), a 5' cap and/or Internal Ribosome Entry Site (IRES), the gene to be expressed, and a polyA tail, typically 50-2000 bases in length. RNA so produced can efficiently transfect different kinds of cells. In one embodiment, the template includes sequences for the CAR.
  • Antigen binding domain
  • In one embodiment, the CAR of use in the invention comprises a target-specific binding element otherwise referred to as an antigen binding domain. The choice of moiety depends upon the type and number of ligands that define the surface of a target cell. For example, the antigen binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state. Thus, examples of cell surface markers that may act as ligands for the antigen moiety domain in the CAR of use in the invention include those associated with viral, bacterial and parasitic infections, autoimmune disease, and cancer cells.
  • In another embodiment, the CAR-mediated T-cell response can be directed to an antigen of interest by way of engineering an antigen binding domain that specifically binds a desired antigen into the CAR.
  • The present invention utilises CAR comprising an antigen binding domain on the CAR that is specific for a tumor antigen. There are two classes oftumor antigens that can be targeted by the CARs of use in the instant invention: (1) tumor antigens that are expressed on the surface of cancer cells; and (2) tumor antigens that itself is intracellar, however, a fragment of such antigen (peptide) is presented on the surface of the cancer cells by MHC (major histocompatibility complex).
  • Accordingly, the present invention utilises CARs that target the following cancer associated antigens (tumor antigens): CD19, CD123, CD22, CD30, CD171, CS-1, CLL-1 (CLECL1), CD33, EGFRvIII, GD2, GD3, BCMA, Tn Ag, PSMA, ROR1, FLT3, FAP, TAG72, CD38, CD44v6, CEA, EPCAM, B7H3, KIT, IL-13Ra2, Mesothelin, IL-11Ra, PSCA, VEGFR2, LewisY, CD24, PDGFR-beta, PRSS21, SSEA-4, CD20, Folate receptor alpha, ERBB2 (Her2/neu), MUC1, EGFR, NCAM, Prostase, PAP, ELF2M, Ephrin B2, IGF-I receptor, CAIX, LMP2, gp100, bcr-abl, tyrosinase, EphA2, Fucosyl GM1, sLe, GM3, TGS5, HMWMAA, o-acetyl-GD2, Folate receptor beta, TEM1/CD248, TEM7R, CLDN6, TSHR, GPRC5D, CXORF61, CD97, CD179a, ALK, Plysialic acid, PLAC1, GloboH, NY-BR-1, UPK2, HAVCR1, ADRB3, PANX3, GPR20, LY6K, OR51E2, TARP, WT1, NY-ESO-1, LAGE-1a, legumain, HPV E6,E7, MAGE-A1, MAGE A1, ETV6-AML, sperm protein 17, XAGE1, Tie 2, MAD-CT-1, MAD-CT-2, Fos-related antigen 1, p53, p53 mutant, prostein, survivin and telomerase, PCTA-1/Galectin 8, MelanA/MART1, Ras mutant, hTERT, sarcoma translocation breakpoints, ML-IAP, ERG (TMPRSS2 ETS fusion gene), NA17, PAX3, Androgen receptor, Cyclin B1, MYCN, RhoC, TRP-2, CYP1B1, BORIS, SART3, PAX5, OY-TES1, LCK, AKAP-4, SSX2, RAGE-1, human telomerase reverse transcriptase, RU1, RU2, intestinal carboxyl esterase, mut hsp70-2, CD79a, CD79b, CD72, LAIR1, FCAR, LILRA2, CD300LF, CLEC12A, BST2, EMR2, LY75, GPC3, FCRL5, and IGLL1.
  • The present invention also utilises a CAR comprising an antigen binding domain that is specific for a viral antigen or a bacterial antigen.
  • The antigen binding domain can be any domain that binds to the antigen including but not limited to antigen binding domains derived from any one or more of monoclonal antibodies, polyclonal antibodies, recombinant antibodies, human antibodies, humanized antibodies, and fragments thereof, including but not limited to single-domain antibodies such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to alternative scaffolds known in the art that function as antigen binding domains, such as recombinant fibronectin domains, and the like. In some instances, it is beneficial for the antigen binding domain to be derived from the same species in which the CAR will ultimately be used in. For example, for use in humans, it may be beneficial for the antigen binding domain of the CAR to comprise human or humanized residues for the antigen binding domain of an antibody or antibody fragment. Thus, in one aspect, the antigen binding domain comprises a humanized antibody or an antibody fragment.
  • In other embodiments, a non-human antibody is humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human or fragment thereof. In one aspect, the antigen binding domain is humanized.
  • A humanized antibody can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (see, e.g., European Patent No. EP 239,400 ; International Publication No. WO 91/09967 ; and U.S. Pat. Nos. 5,225,539 , 5,530,101 , and 5,585,089 ), veneering or resurfacing (see, e.g., European Patent Nos. EP 592,106 and EP 519,596 ; Padlan, 1991, Molecular Immunology, 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering, 7(6):805-814; and Roguska et al., 1994, PNAS, 91:969-973), chain shuffling (see, e.g., U.S. Pat. No. 5,565,332 ), and techniques disclosed in, e.g., U.S. Patent Application Publication No. US2005/0042664 , U.S. Patent Application Publication No. US2005/0048617 , U.S. Pat. No. 6,407,213 , U.S. Pat. No. 5,766,886 , International Publication No. WO 9317105 , Tan et al., 2002, J. Immunol., 169:1119-25; Caldas et al., 2000, Protein Eng., 13(5):353-60; Morea et al., 2000, Methods, 20:267-79; Baca et al., 1997, J. Biol. Chem., 272:10678-84; Roguska et al., 1996, Protein Eng., 9(10):895-904; Couto et al., 1995, Cancer Res., 55 :5973s-5977; Couto et al., 1995, Cancer Res., 55(8):1717-22; Sandhu 1994 Gene, 150(2):409-10; and Pedersen et al., 1994, J. Mol. Biol., 235(3):959-73. Often, framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, for example improve, antigen binding. These framework substitutions are identified by methods well-known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089 ; and Riechmann et al., 1988, Nature, 332:323.)
  • A humanized antibody or antibody fragment has one or more amino acid residues remaining in it from a source which is nonhuman. These nonhuman amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain. As provided herein, humanized antibodies or antibody fragments comprise one or more CDRs from nonhuman immunoglobulin molecules and framework regions wherein the amino acid residues comprising the framework are derived completely or mostly from human germline. Multiple techniques for humanization of antibodies or antibody fragments are well-known in the art and can essentially be performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody, i.e., CDR-grafting ( EP 239,400 ; PCT Publication No. WO 91/09967 ; and U.S. Pat. Nos. 4,816,567 ; 6,331,415 ; 5,225,539 ; 5,530,101 ; 5,585,089 ; 6,548,640 ). In such humanized chimeric antibodies and antibody fragments, substantially less than an intact human variable domain has been substituted by the corresponding sequence from a nonhuman species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some framework (FR) residues are substituted by residues from analogous sites in rodent antibodies. Humanization of antibodies and antibody fragments can also be achieved by veneering or resurfacing ( EP 592,106 ; EP 519,596 ; Padlan, 1991, Molecular Immunology, 28(4/5):489-498; Studnicka et al., Protein Engineering, 7(6):805-814 (1994); and Roguska et al., PNAS, 91:969-973 (1994)) or chain shuffling ( U.S. Pat. No. 5,565,332 ).
  • The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is to reduce antigenicity. According to the so-called "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151:2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987)). Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (see, e.g., Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al., J. Immunol., 151:2623 (1993)).
  • In certain embodiments, the portion of the CAR composition of use in the invention that comprises an antibody fragment is humanized with retention of high affinity for the target antigen and other favorable biological properties. According to one aspect of the invention, humanized antibodies and antibody fragments are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind the target antigen. In this way, FR residues can be selected and combined from the recipient and import sequences so that the desired antibody or antibody fragment characteristic, such as increased affinity for the target antigen, is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding.
  • In another embodiments, the antibodies of use in the invention may exist in a variety of other forms including, for example, Fv, Fab, and (Fab')2, as well as bi-functional (i.e. bispecific) hybrid antibodies (e.g., Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)). In one aspect, the antibody fragment provided herein is a scFv. In some instances, a human scFv may also be derived from a yeast display library.
  • In some instances, scFvs can be prepared according to method known in the art (see, for example, Bird et al., (1988) Science 242:423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). ScFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers. The scFv molecules comprise flexible polypeptide linker (e.g., a Ser-Gly linker) with an optimized length and/or amino acid composition. The flexible polypeptide linker length can greatly affect how the variable regions of an scFv fold and interact. In fact, if a short polypeptide linker is employed (e.g., between 5-10 amino acids, intrachain folding is prevented. Interchain folding is also required to bring the two variable regions together to form a functional epitope binding site. For examples of linker orientation and size see, e.g., Hollinger et al. 1993 Proc Natl Acad. Sci. U.S.A. 90:6444-6448, U.S. Patent Application Publication Nos. 2005/0100543 , 2005/0175606 , 2007/0014794 , and PCT publication Nos. WO2006/020258 and WO2007/024715 .
  • The scFv can comprise a polypeptide linker sequence of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, or more amino acid residues between its VL and VH regions. The flexible polypeptide linker sequence may comprise any naturally occurring amino acid. In some embodiments, the flexible polypeptide linker sequence comprises amino acids glycine and serine. In another embodiment, the flexible polypeptide linker sequence comprises sets of glycine and serine repeats such as (Gly4Ser)n, where n is a positive integer equal to or greater than 1. In one embodiment, the flexible polypeptide linkers include, but are not limited to, (Gly4Ser)4 or (Gly4Ser)3. Variation in the flexible polypeptide linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
  • In one aspect, the present invention contemplates modifications of the starting antibody or fragment (e.g., svFv) amino acid sequence that generate functionally equivalent molecules. For example, the VH or VL of an scFv comprised in the CAR can be modified to retain at least about 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity of the starting VH or VL framework region of the scFv. The present invention also contemplates modifications of the entire CAR construct, e.g., modifications in one or more amino acid sequences of the various domains of the CAR construct in order to generate functionally equivalent molecules. The CAR construct can be modified to retain at least about 70%, 71%. 72%. 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity of the starting CAR construct.
  • Transmembrane domain
  • With respect to the transmembrane domain, in various embodiments, the CAR is designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR. In one embodiment, the transmembrane domain is one that naturally is associated with one of the domains in the CAR. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex. In another embodiment, the transmembrane domain is capable of homodimerization with another CAR on the CAR T cell surface. In another embodiment, the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CAR T cell.
  • A transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the intracellular region). In one aspect, the transmembrane domain is one that is associated with one of the other domains of the CAR e.g., in one embodiment, the transmembrane domain may be from the same protein that the signaling domain, costimulatory domain or the hinge domain is derived from. In another aspect, the transmembrane domain is not derived from the same protein that any other domain of the CAR is derived from. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex. In one aspect, the transmembrane domain is capable of homodimerization with another CAR on the cell surface of a CAR-expressing cell. In a different aspect, the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CAR-expressing cell.
  • The transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one embodiment, the transmembrane region is capable of signaling to the intracellular domain(s) whenever the CAR has bound to a target. Transmembrane regions of particular use in this invention may be derived from (i.e., comprise at least the transmembrane region(s) of), but not limited to, e.g., regions selected from any one or more of e.g., the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154. In some embodiments, a transmembrane domain may include at least the transmembrane region(s) of, e.g., KIRDS2, OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, IL2R beta, IL2R gamma, IL7R α, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, PAG/Cbp, NKG2D, or NKG2C.
  • In some instances, a variety of hinges (aka "spacers") can be employed as well, e.g., including but not limited to the human Ig (immunoglobulin) hinge (e.g., an IgG4 hinge, an IgD hinge), a GS linker (e.g., a GS linker described herein), a KIR2DS2 hinge or a CD8α hinge. In one aspect, the hinge or spacer is the amino acid sequence provided as SEQ ID NO:4. In one aspect, the transmembrane domain is a transmembrane domain from the sequence provided as SEQ ID NO: 12.
  • In one aspect, the transmembrane domain may be recombinant, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In one aspect, a triplet of phenylalanine, tryptophan and valine will be found at each end of a recombinant transmembrane domain. Optionally, a short oligo- or polypeptide linker, between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker, e.g., GGGGSGGGGS (SEQ ID NO: 35). In some embodiments, the linker is encoded by a nucleotide sequence of GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 36). Other suitable linkers can be found in Table 2.
  • In one aspect, the hinge or spacer comprises a KIR2DS2 hinge.
  • Cytoplasmic domain
  • The cytoplasmic domain or intracellular signaling domain of the CAR of use in the invention is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed in. The term "effector function" refers to a specialized function of a cell. The effector function of a T cell, for example, may be cytolytic activity or helper activity, including the secretion of cytokines. Thus the term "intracellular signaling domain" refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • Examples of intracellular signaling domains for use in the CAR of use in the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
  • It is known that signals generated through the TCR alone are insufficient for full activation of the T cell and that a secondary and/or costimulatory signal is also required. Thus, T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic signaling sequences).
  • Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • Examples of ITAM containing primary intracellular signaling domains that are of particular use in the invention include those of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta , CD3 epsilon, CD79a, CD79b, DAP10, and DAP12. In one embodiment, a CAR of use in the invention comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3-zeta.
  • In one aspect, the cytoplasmic domain of the CAR is designed to comprise the CD3-zeta signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of use in the invention. For example, the cytoplasmic domain of the CAR can comprise a CD3 zeta chain portion and a costimulatory signaling region. The costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen. Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like. Further examples of such costimulatory molecules include CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, and a ligand that specifically binds with CD83.
  • The cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR of use in the invention may be linked to each other in a random or specified order. Optionally, a short oligo- or polypeptide linker, for example, between 2 and 10 amino acids in length may form the linkage. A glycine-serine doublet provides a particularly suitable linker. Exemplary glycine-serine linkers are listed in Table 2, e.g., SEQ ID NOs: 22, 24, 25, 26, or 27.
  • In one aspect, the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28. In one aspect, the cytoplasmic domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of 4-1BB. In one aspect, the signaling domain of 4-1BB is a signaling domain set forth in SEQ ID NO: 14. In one aspect, the signaling domain of CD3-zeta is a signaling domain set forth in SEQ ID NO: 18 or SEQ ID NO: 20.
  • Regulatable Chimeric Antigen Receptors
  • In some embodiments, a regulatable CAR (RCAR) where the CAR activity can be controlled is desirable to optimize the safety and efficacy of a CAR therapy. An RCAR can be used substituted for a CAR in any of the embodiments described herein.
  • There are many ways CAR activities can be regulated. For example, inducible apoptosis using, e.g., a caspase fused to a dimerization domain (see, e.g., Di et al., N Egnl. J. Med. 2011 Nov. 3; 365(18):1673-1683), can be used as a safety switch in the CAR therapy of the instant invention. In an aspect, a RCAR comprises a set of polypeptides, typically two in the simplest embodiments, in which the components of a standard CAR described herein, e.g., an antigen binding domain and an intracellular signaling domain, are partitioned on separate polypeptides or members. In some embodiments, the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
  • In an aspect, an RCAR comprises two polypeptides or members: 1) an intracellular signaling member comprising an intracellular signaling domain, e.g., a primary intracellular signaling domain described herein, and a first switch domain; 2) an antigen binding member comprising an antigen binding domain, e.g., that targets a tumor antigen, as described herein and a second switch domain. Optionally, the RCAR comprises a transmembrane domain described herein. In an embodiment, a transmembrane domain can be disposed on the intracellular signaling member, on the antigen binding member, or on both. (Unless otherwise indicated, when members or elements of an RCAR are described herein, the order can be as provided, but other orders are included as well. In other words, in an embodiment, the order is as set out in the text, but in other embodiments, the order can be different. E.g., the order of elements on one side of a transmembrane region can be different from the example, e.g., the placement of a switch domain relative to a intracellular signaling domain can be different, e.g., reversed).
  • In an embodiment, the first and second switch domains can form an intracellular or an extracellular dimerization switch. In an embodiment, the dimerization switch can be a homodimerization switch, e.g., where the first and second switch domain are the same, or a heterodimerization switch, e.g., where the first and second switch domain are different from one another.
  • In embodiments, an RCAR can comprise a "multi switch." A multi switch can comprise heterodimerization switch domains or homodimerization switch domains. A multi switch comprises a plurality of, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10, switch domains, independently, on a first member, e.g., an antigen binding member, and a second member, e.g., an intracellular signaling member. In an embodiment, the first member can comprise a plurality of first switch domains, e.g., FKBP-based switch domains, and the second member can comprise a plurality of second switch domains, e.g., FRB-based switch domains. In an embodiment, the first member can comprise a first and a second switch domain, e.g., a FKBP-based switch domain and a FRB-based switch domain, and the second member can comprise a first and a second switch domain, e.g., a FKBP-based switch domain and a FRB-based switch domain.
  • In an embodiment, the intracellular signaling member comprises one or more intracellular signaling domains, e.g., a primary intracellular signaling domain and one or more costimulatory signaling domains.
  • In an embodiment, the antigen binding member may comprise one or more intracellular signaling domains, e.g., one or more costimulatory signaling domains. In an embodiment, the antigen binding member comprises a plurality, e.g., 2 or 3 costimulatory signaling domains described herein, e.g., selected from 41BB, CD28, CD27, ICOS, and OX40, and in embodiments, no primary intracellular signaling domain. In an embodiment, the antigen binding member comprises the following costimulatory signaling domains, from the extracellular to intracellular direction: 41BB-CD27; 41BB-CD27; CD27-41BB; 41BB-CD28; CD28-41BB; OX40-CD28; CD28-OX40; CD28-41BB; or 41BB-CD28. In such embodiments, the intracellular binding member comprises a CD3zeta domain. In one such embodiment the RCAR comprises (1) an antigen binding member comprising, an antigen binding domain, a transmembrane domain, and two costimulatory domains and a first switch domain; and (2) an intracellular signaling domain comprising a transmembrane domain or membrane tethering domain and at least one primary intracellular signaling domain, and a second switch domain.
  • An embodiment utilises RCARs wherein the antigen binding member is not tethered to the surface of the CAR cell. This allows a cell having an intracellular signaling member to be conveniently paired with one or more antigen binding domains, without transforming the cell with a sequence that encodes the antigen binding member. In such embodiments, the RCAR comprises: 1) an intracellular signaling member comprising: a first switch domain, a transmembrane domain, an intracellular signaling domain, e.g., a primary intracellular signaling
    domain, and a first switch domain; and 2) an antigen binding member comprising: an antigen binding domain, and a second switch domain, wherein the antigen binding member does not comprise a transmembrane domain or membrane tethering domain, and, optionally, does not comprise an intracellular signaling domain. In some embodiments, the RCAR may further comprise 3) a second antigen binding member comprising: a second antigen binding domain, e.g., a second antigen binding domain that binds a different antigen than is bound by the antigen binding domain; and a second switch domain.
  • Also provided herein are RCARs wherein the antigen binding member comprises bispecific activation and targeting capacity. In this embodiment, the antigen binding member can comprise a plurality, e.g., 2, 3, 4, or 5 antigen binding domains, e.g., scFvs, wherein each antigen binding domain binds to a target antigen, e.g. different antigens or the same antigen, e.g., the same or different epitopes on the same antigen. In an embodiment, the plurality of antigen binding domains are in tandem, and optionally, a linker or hinge region is disposed between each of the antigen binding domains. Suitable linkers and hinge regions are described herein.
  • An embodiment utilises RCARs having a configuration that allows switching of proliferation. In this embodiment, the RCAR comprises: 1) an intracellular signaling member comprising: optionally, a transmembrane domain or membrane tethering domain; one or more co-stimulatory signaling domain, e.g., selected from 41BB, CD28, CD27, ICOS, and OX40, and a switch domain; and 2) an antigen binding member comprising: an antigen binding domain, a transmembrane domain, and a primary intracellular signaling domain, e.g., a CD3zeta domain, wherein the antigen binding member does not comprise a switch domain, or does not comprise a switch domain that dimerizes with a switch domain on the intracellular signaling member. In an embodiment, the antigen binding member does not comprise a co-stimulatory signaling domain. In an embodiment, the intracellular signaling member comprises a switch domain from a homodimerization switch. In an embodiment, the intracellular signaling member comprises a first switch domain of a heterodimerization switch and the RCAR comprises a second intracellular signaling member which comprises a second switch domain of the heterodimerization switch. In such embodiments, the second intracellular signaling member comprises the same intracellular signaling domains as the intracellular signaling member. In an embodiment, the dimerization switch is intracellular. In an embodiment, the dimerization switch is extracellular.
  • In any of the RCAR configurations described here, the first and second switch domains comprise a FKBP-FRB based switch as described herein.
  • Also provided herein are cells comprising an RCAR described herein. Any cell that is engineered to express a RCAR can be used as a RCARX cell. In an embodiment the RCARX cell is a T cell, and is referred to as a RCART cell. In an embodiment the RCARX cell is an NK cell, and is referred to as a RCARN cell.
  • Also provided herein are nucleic acids and vectors comprising RCAR encoding sequences. Sequence encoding various elements of an RCAR can be disposed on the same nucleic acid molecule, e.g., the same plasmid or vector, e.g., viral vector, e.g., lentiviral vector. In an embodiment, (i) sequence encoding an antigen binding member and (ii) sequence encoding an intracellular signaling member, can be present on the same nucleic acid, e.g., vector. Production of the corresponding proteins can be achieved, e.g., by the use of separate promoters, or by the use of a bicistronic transcription product (which can result in the production of two proteins by cleavage of a single translation product or by the translation of two separate protein products). In an embodiment, a sequence encoding a cleavable peptide, e.g., a P2A or F2A sequence, is disposed between (i) and (ii). In an embodiment, a sequence encoding an IRES, e.g., an EMCV or EV71 IRES, is disposed between (i) and (ii). In these embodiments, (i) and (ii) are transcribed as a single RNA. In an embodiment, a first promoter is operably linked to (i) and a second promoter is operably linked to (ii), such that (i) and (ii) are transcribed as separate mRNAs.
  • Alternatively, the sequence encoding various elements of an RCAR can be disposed on the different nucleic acid molecules, e.g., different plasmids or vectors, e.g., viral vector, e.g., lentiviral vector. E.g., the (i) sequence encoding an antigen binding member can be present on a first nucleic acid, e.g., a first vector, and the (ii) sequence encoding an intracellular signaling member can be present on the second nucleic acid, e.g., the second vector.
  • Dimerization switches
  • Dimerization switches can be non-covalent or covalent. In a non-covalent dimerization switch, the dimerization molecule promotes a non-covalent interaction between the switch domains. In a covalent dimerization switch, the dimerization molecule promotes a covalent interaction between the switch domains.
  • In an embodiment, the RCAR comprises a FKBP/FRAP, or FKBP/FRB,-based dimerization switch. FKBP12 (FKBP, or FK506 binding protein) is an abundant cytoplasmic protein that serves as the initial intracellular target for the natural product immunosuppressive drug, rapamycin. Rapamycin binds to FKBP and to the large PI3K homolog FRAP (RAFT, mTOR). FRB is a 93 amino acid portion of FRAP, that is sufficient for binding the FKBP-rapamycin complex (Chen, J., Zheng, X. F., Brown, E. J. & Schreiber, S. L. (1995) Identification of an 11-kDa FKBP12-rapamycin-binding domain within the 289-kDa FKBP12-rapamycin-associated protein and characterization of a critical serine residue. Proc Natl Acad Sci USA 92: 4947-51.)
  • In embodiments, an FKBP/FRAP, e.g., an FKBP/FRB, based switch can use a dimerization molecule, e.g., rapamycin or a rapamycin analog.
  • The amino acid sequence of FKBP is as follows:
    Figure imgb0001
  • In embodiments, an FKBP switch domain can comprise a fragment of FKBP having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, e.g., the underlined portion of SEQ ID NO: 37, which is:
    Figure imgb0002
  • The amino acid sequence of FRB is as follows:
    Figure imgb0003
  • "FKBP/FRAP, e.g., an FKBP/FRB, based switch" as that term is used herein, refers to a dimerization switch comprising: a first switch domain, which comprises an FKBP fragment or analog thereof having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, e.g., RAD001, and has at least 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identity with, or differs by no more than 30, 25, 20, 15, 10, 5, 4, 3, 2, or 1 amino acid residues from, the FKBP sequence of SEQ ID NO: 18 or 19; and a second switch domain, which comprises an FRB fragment or analog thereof having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, and has at least 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identity with, or differs by no more than 30, 25, 20, 15, 10, 5, 4, 3, 2, or 1 amino acid residues from, the FRB sequence of SEQ ID NO: 20. In an embodiment, a RCAR described herein comprises one switch domain comprises amino acid residues disclosed in SEQ ID NO: 37 (or SEQ ID NO: 38), and one switch domain comprises amino acid residues disclosed in SEQ ID NO: 39.
  • In embodiments, the FKBP/FRB dimerization switch comprises a modified FRB switch domain that exhibits altered, e.g., enhanced, complex formation between an FRB-based switch domain, e.g., the modified FRB switch domain, a FKBP-based switch domain, and the dimerization molecule, e.g., rapamycin or a rapalogue, e.g., RAD001. In an embodiment, the modified FRB switch domain comprises one or more mutations, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, selected from mutations at amino acid position(s) L2031, E2032, S2035, R2036, F2039, G2040, T2098, W2101, D2102, Y2105, and F2108, where the wild-type amino acid is mutated to any other naturally-occurring amino acid. In an embodiment, a mutant FRB comprises a mutation at E2032, where E2032 is mutated to phenylalanine (E2032F), methionine (E2032M), arginine (E2032R), valine (E2032V), tyrosine (E2032Y), isoleucine (E2032I), e.g., SEQ ID NO: 40, or leucine (E2032L), e.g., SEQ ID NO: 41. In an embodiment, a mutant FRB comprises a mutation at T2098, where T2098 is mutated to phenylalanine (T2098F) or leucine (T2098L), e.g., SEQ ID NO: 42. In an embodiment, a mutant FRB comprises a mutation at E2032 and at T2098, where E2032 is mutated to any amino acid, and where T2098 is mutated to any amino acid, e.g., SEQ ID NO: 43. In an embodiment, a mutant FRB comprises an E2032I and a T2098L mutation, e.g., SEQ ID NO: 44. In an embodiment, a mutant FRB comprises an E2032L and a T2098L mutation, e.g., SEQ ID NO: 45. Table 1. Exemplary mutant FRB having increased affinity for a dimerization molecule.
    FRB mutant Amino Acid Sequence SEQ ID NO:
    E2032I mutant
    Figure imgb0004
    40
    E2032L mutant
    Figure imgb0005
    41
    T2098L mutant
    Figure imgb0006
    42
    E2032, T2098 mutant
    Figure imgb0007
    43
    E2032I, T2098L mutant
    Figure imgb0008
    44
    E2032L, T2098L mutant
    Figure imgb0009
    45
  • Other suitable dimerization switches include a GyrB-GyrB based dimerization switch, a Gibberellin-based dimerization switch, a tag/binder dimerization switch, and a halo-tag/snap-tag dimerization switch. Following the guidance provided herein, such switches and relevant dimerization molecules will be apparent to one of ordinary skill.
  • Dimerization molecule
  • Association between the switch domains is promoted by the dimerization molecule. In the presence of dimerization molecule interaction or association between switch domains allows for signal transduction between a polypeptide associated with, e.g., fused to, a first switch domain, and a polypeptide associated with, e.g., fused to, a second switch domain. In the presence of non-limiting levels of dimerization molecule signal transduction is increased by 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 5, 10, 50, 100 fold, e.g., as measured in a system described herein.
  • Rapamycin and rapamycin analogs (sometimes referred to as rapalogues), e.g., RAD001, can be used as dimerization molecules in a FKBP/FRB-based dimerization switch described herein. In an embodiment the dimerization molecule can be selected from rapamycin (sirolimus), RAD001 (everolimus), zotarolimus, temsirolimus, AP-23573 (ridaforolimus), biolimus, simapimo, XI,765, AP21967, and analogs or derivatives thereof.
  • Enhancers of T cell priming (ETPs)
  • The present invention also provides nucleic acids, e.g., DNA or RNA constructs, encoding ETPs for co-delivery with nucleic acids, e.g., DNA or RNA constructs, encoding CARs. The ETPs of use in the invention enhance the CAR-expressing T cell's antigen presentation and T cell priming activities, leading to enhanced anti-disease effects. In the context of cancer, without being bound by theory, it is believed that co-delivery of ETP, e.g., ETP DNAs or ETP RNAs, with CAR, e.g., CAR RNA or CAR ETP into a T cell enhances anti-tumor activity by increasing the ability of the T cell to function as antigen presenting cells and prime T cells, in addition to the CAR-mediated cell killing ability. This allows for T cell-mediated priming of non-engineered tumor-reactive T cells, which can persist as tumor suppressors once CAR expression by adoptive ETP-CAR T cells, e.g., RNA ETP-CAR T cells, has subsided, creating a transient therapy with permanent anti-cancer effects, e.g., anti-tumor effects.
  • An ETP may be a costimulatory molecule. Exemplary costimulatory molecules include, but are not limited to, CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, and functional fragments and variants thereof. The invention utilises an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. Instances of the disclosure which do not utilise such an ETP are not encompassed by the wording of the claims, although they are considered useful for understanding the invention.
  • In an embodiment, the ETP comprises an amino acid sequence of CD70 (e.g., GenBank Acc. No. NP_001243.1), or a nucleic acid sequence of CD70 (e.g., GenBank Acc. No. NM_001252.4). In an instance of the disclosure, an ETP comprises an amino acid sequence of CD83 (e.g., GenBank Acc. No. AAH30830.1), or a nucleic acid sequence of CD83 (e.g., GenBank Acc. No. BC030830.1). In an instance, an ETP comprises an amino acid sequence of CD80 (e.g., GenBank Acc. No. AAH42665.1), or a nucleic acid sequence of CD80 (e.g., GenBank Acc. No. BC042655.1). In an embodiment, the ETP comprises an amino acid sequence of CD86 (e.g., GenBank Acc. No. AAB03814.1), or a nucleic acid sequence of CD86 (e.g., GenBank Acc. No. U04343.1). In an instance, an ETP comprises an amino acid sequence of CD40 (e.g., GenBank Acc. No. AAH64518.1, or AAH12419.1), or a nucleic acid sequence of CD40 (e.g., GenBank Acc. No. BC064518.1 or BC012419.1). In an instance, an ETP comprises an amino acid sequence of CD154 (e.g., GenBank Acc. No. NP_000065.1 or AAH74950.1), or a nucleic acid sequence of CD154 (e.g., GenBank Acc. No. NM_000074.2 or BC074950.2). In an instance, an ETP comprises an amino acid sequence of CD137L (4-1BBL) (e.g., GenBank Acc. No. NP_003802.1), or a nucleic acid sequence of CD137L (4-1BBL) (e.g., GenBank Acc. No. NM_003811.3). In an embodiment, the ETP comprises an amino acid sequence of CD252 (OX40L) (e.g., GenBank Acc. No. AAH41663.1), or a nucleic acid sequence of CD252 (OX40L) (e.g., GenBank Acc. No. BC041663.1). In an instance, an ETP comprises an amino acid sequence of CD275 (ICOSL) (e.g., GenBank Acc. No. AAH20674.1), or a nucleic acid sequence of CD275 (ICOSL) (e.g., GenBank Acc. No. BC020674.1). In an instance, an ETP comprises an amino acid sequence of CD54 (ICAM-1) (e.g., GenBank Acc. No. AAP35500.1 or CAA41977.1), or a nucleic acid sequence of CD54 (ICAM-1) (e.g., GenBank Acc. No. BT006854.1 or X59286.1). In an instance, an ETP comprises an amino acid sequence of CD49a (e.g., GenBank Acc. No.AAI37123.1), or a nucleic acid sequence of CD49a (e.g., GenBank Acc. No. BC137122.1). In an instance, an ETP comprises an amino acid sequence of CD43 (e.g., GenBank Acc. No. NP_001025459.1 or AAB20910.1), or a nucleic acid sequence of CD43 (e.g., GenBank Acc. No. NM_001030288.2 or AAB20910.1). In an instance, an ETP comprises an amino acid sequence of CD48 (e.g., GenBank Acc. No. CAG33293.1), or a nucleic acid sequence of CD48 (e.g., GenBank Acc. No. CR457012.1). In an instance, an ETP comprises an amino acid sequence of CD112 (PVRL2) (e.g., GenBank Acc. No. CAG33099.1), or a nucleic acid sequence of CD112 (PVRL2) (e.g., GenBank Acc. No. CR456818.1). In an instance, an ETP comprises an amino acid sequence of CD150 (SLAM) (e.g., GenBank Acc. No. NP_003028.1), or a nucleic acid sequence of CD150 (SLAM) (e.g., GenBank Acc. No. NM_003037.3). In an instance, an ETP comprises an amino acid sequence of CD155 (PVR) (e.g., GenBank Acc. No. NP_006496.4), or a nucleic acid sequence of CD155 (PVR) (e.g., GenBank Acc. No. NM_006505.4). In an instance, an ETP comprises an amino acid sequence of CD265 (RANK) (e.g., GenBank Acc. No. Q9Y6Q6.1), or a nucleic acid sequence of CD265 (RANK) (e.g., GenBank Acc. No. AF018253.1). In an instance, an ETP comprises an amino acid sequence of CD270 (HVEM) (e.g., GenBank Acc. No. CAG33190.1 or AAH29848.1), or a nucleic acid sequence of CD270 (HVEM) (e.g., GenBank Acc. No. CR456909.1 or BC029848.1). In an instance, an ETP comprises an
    amino acid sequence of TL1A (e.g., GenBank Acc. No. AAI04464.1), or a nucleic acid sequence of TL1A (e.g., GenBank Acc. No. BC104463.1). In an instance, an ETP comprises an amino acid sequence of CD127 (e.g., GenBank Acc. No. AAH69999.1), or a nucleic acid sequence of CD127 (e.g., GenBank Acc. No. BC069999.1). In an instance, an ETP comprises an amino acid sequence of GITR-L (e.g., GenBank Acc. No. AAQ89227.1), or a nucleic acid sequence of GITR-L (e.g., GenBank Acc. No. AY358868.1). In an instance, an ETP comprises an amino acid sequence of CD160 (e.g., GenBank Acc. No. CAG46665.1), or a nucleic acid sequence of CD160 (e.g., GenBank Acc. No. CR541867.1). In an instance, an ETP comprises an amino acid sequence of CD258 (e.g., GenBank Acc. No. NP_742011.2), or a nucleic acid sequence of CD258 (e.g., GenBank Acc. No. NM_172014.2). In an instance, an ETP comprises an amino acid sequence of TIM-4 (e.g., GenBank Acc. No. AFO66594.1), or a nucleic acid sequence of TIM-4 (e.g., GenBank Acc. No.JX049980.1). In an instance, an ETP comprises an amino acid sequence of CD153 (CD30L) (e.g., GenBank Acc. No. AAI11940.1), or a nucleic acid sequence ofCD153 (CD30L) (e.g., GenBank Acc. No.BC111939.1). In an instance, an ETP comprises an amino acid sequence of CD200R (OX2R) (e.g., GenBank Acc. No. AAI43394.1), or a nucleic acid sequence of CD200R (OX2R) (e.g., GenBank Acc. No. BC143393.1). In an instance, an ETP comprises an amino acid sequence of CD44 (e.g., GenBank Acc. No. ACI46596.1), or a nucleic acid sequence of CD44 (e.g., GenBank Acc. No. FJ21664.1).
  • An ETP may be a soluble cytokine. Exemplary soluble cytokines include, but are not limited to, IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, and IL-27, and functional fragments and variants thereof.
  • In an instance of the disclosure, an ETP comprises an amino acid sequence of interleukin 2 (IL-2) (e.g., GenBank Acc. No. AAB46833.1), or a nucleic acid sequence of IL-2 (e.g., GenBank Acc. No. S82692.1). In an instance, an ETP comprises an amino acid sequence of interleukin 12 (IL-12) (e.g., GenBank Acc. No. AAD16432.1), or a nucleic acid sequence of IL-12 (e.g., GenBank Acc. No. AF101062.1). In an instance, an ETP comprises an amino acid sequence of interleukin 6 (IL-6) (e.g., GenBank Acc. No. AAD13886.1 or NP_000591.1), or a nucleic acid sequence of IL-6 (e.g., GenBank Acc. No. S56892.1 or NM_000600.3). In an instance, an ETP comprises an amino acid sequence of interleukin 7 (IL-7) (e.g., GenBank Acc. No. AAH47698.1 or NP_000871.1), or a nucleic acid sequence of IL-7 (e.g., GenBank Acc. No. BC047698.1 or NM_000880.3). In an instance, an ETP comprises an amino acid sequence of interleukin 15 (IL-15) (e.g., GenBank Acc. No. AAU21241.1), or a nucleic acid sequence of IL-15 (e.g., GenBank Acc. No. AY720442.1). In an instance, an ETP comprises an amino acid sequence of interleukin 18 (IL-18) (e.g., GenBank Acc. No. AAK95950.1), or a nucleic acid sequence of IL-18 (e.g., GenBank Acc. No. AY044641.1). In an instance, an ETP comprises an amino acid sequence of interleukin 21 (IL-21) (e.g., GenBank Acc. No. AAG29348.1), or a nucleic acid sequence of IL-21 (e.g., GenBank Acc. No. AF254069.1). In an instance, an ETP comprises an amino acid sequence of GM-CSF (e.g., GenBank Acc. No. AAA52578.1), or a nucleic acid sequence of GM-CSF (e.g., GenBank Acc. No. M11220.1).
  • An ETP may be a polypeptide involved in antigen presentation. Exemplary polypeptides involved in antigen presentation include, but are not limited to, CD64, MHC I, and MHC II, and functional fragments and variants thereof.
  • In an instance of the disclosure, an ETP comprises an amino acid sequence of CD64 (e.g., GenBank Acc. No. AAI52384.1), or a nucleic acid sequence of CD64 (e.g., GenBank Acc. No. BC152383.1). In an instance, an ETP comprises an amino acid sequence of MHCI (e.g., GenBank Acc. No. AAH40479.1), or a nucleic acid sequence of MHCI (e.g., GenBank Acc. No. BC040479.1).
  • An ETP may be a polypeptide involved in trafficking and/or migration. Exemplary polypeptides involved in trafficking and/or migration include, but are not limited to, CD183, CCR2, CCR6, CD50, CD197, CD58, and CD62L, and functional fragments and variants thereof.
  • In an instance of the disclosure, an ETP comprises an amino acid sequence of CD183 (e.g., GenBank Acc. No. AAH34403.1), or a nucleic acid sequence of CD183 (e.g., GenBank Acc. No. BC034403.1). In an instance, an ETP comprises an amino acid sequence of CCR2 (e.g., GenBank Acc. No. AAH95540.1), or a nucleic acid sequence of CCR2 (e.g., GenBank Acc. No. BC095540.1). In an instance, an ETP comprises an amino acid sequence of CCR6 (e.g., GenBank Acc. No. NP_113597.2), or a nucleic acid sequence of CCR6 (e.g., GenBank Acc. No. NM_031409.3). In an instance, an ETP comprises an amino acid sequence of CD50 (e.g., GenBank Acc. No. AAH58903.1), or a nucleic acid sequence of CD50 (e.g., GenBank Acc. No. BC058903.1). In an instance, an ETP comprises an amino acid sequence of CD197 (e.g., GenBank Acc. No. NP_001829.1), or a nucleic acid sequence of CD197 (e.g., GenBank Acc. No. NM_001838.3). In an instance, an ETP comprises an amino acid sequence of CD58 (e.g., GenBank Acc. No. CAG33220.1), or a nucleic acid sequence of CD58 (e.g., GenBank Acc. No. CR456939.1). In an instance, an ETP comprises an amino acid sequence of CD62L (e.g., GenBank Acc. No. AAH20758.1), or a nucleic acid sequence of CD62L (e.g., GenBank Acc. No. BC020758.1).
  • An ETP may be a polypeptide involved in dendritic cell targeting. Exemplary polypeptides involved in dendritic cell targeting include TLR ligands, anti-DEC-205 antibody, and anti-DC-SIGN antibody, and functional fragments and variants thereof.
  • In another embodiment, more than 1, such as 2, 3, 4, 5, 6 or more ETPs are co-delivered with a nucleic acid sequence encoding a CAR, e.g., a CAR RNA, into a T cell. In one aspect, the co-delivery of 1 or more ETPs does not affect, e.g., substantially decrease or substantitally inhibit, the expression or activity of the co-delivered or co-expressed CAR in the ETP-CAR T cell, e.g., RNA ETP-CAR T cell. In another aspect, the co-delivery of a CAR does not affect, e.g., substantially decrease or substantially inhibit, the expression or activity of the co-delivered or co-expressed ETP or ETPs.
  • Candidate molecules (i.e., candidate ETPs) can be tested for T cell priming activity alone or in conjunction with a CAR using assays described in the Examples.
  • An ETP may comprise an amino acid sequence with at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to, or which differs by no more than 30, 25, 20, 15, 10 or 5 amino acid residues from, an ETP described herein, or a functional fragment thereof, or a naturally occurring ETP, e.g., a naturally occurring ETP described herein, e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to an ETP described herein, or a functional fragment thereof.
  • Percent identity in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences that are the same. Two sequences are "substantially identical" if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 70%, 71%, 72%. 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
  • For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch, (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman, (1988) Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Brent et al., (2003) Current Protocols in Molecular Biology).
  • Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
  • The percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller, (1988) Comput. Appl. Biosci. 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • Functional variants of an ETP provided herein may comprise one or more mutations, such that the variant retains some level of T cell priming activity of the ETP described herein. The functional variant may have at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% (e.g., at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%) of the T cell priming activity as the corresponding naturally occurring or parental ETP. The functional variant may have at least 200%, at least 300%, at least 400%, at least 500%, at least 1000% or more of the T cell priming activity as the corresponding naturally occurring or parental ETP. The mutations present in a functional variant include amino acid substitutions, additions, and deletions. Mutations can be introduced by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. The mutation may be a conservative amino acid substitution, in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • An ETP may comprise a functional fragment of a naturally occurring ETP, e.g., an ETP disclosed herein. The functional fragment may comprise at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95% of the amino acid residues of the naturally occurring ETP. For example, the ETP comprises a domain or a functional fragment of a domain of an ETP disclosed herein, that comprises T cell priming activity.
  • Nucleic Acids
  • Disclosed herein are methods for producing the CARs and ETPs of use in the invention. In one embodiment, the nucleic acid encoding the CAR or ETP to be introduced into a T cell is a DNA molecule (e.g., a cDNA molecule). In the present invention, the nucleic acid encoding the CAR and/or ETP to be introduced into a T cell is an RNA molecule. In another embodiment, the RNA is generated by in vitro transcription. In one embodiment, the RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template. DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase. The source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA.
  • RNA Constructs
  • Disclosed herein are methods for expressing an RNA encoding a CAR and/or an RNA encoding an ETP. The present invention also utilises a CAR encoding RNA construct and/or an ETP encoding RNA construct that can be directly transfected into a cell. A method for generating mRNA for use in transfection can involve in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3' and 5' untranslated sequence ("UTR"), a 5' cap and/or Internal Ribosome Entry Site (IRES), the nucleic acid to be expressed, and a polyA tail, typically 50-2000 bases in length (SEQ ID NO:46). RNA so produced can efficiently transfect different kinds of cells. In one aspect, the template includes sequences for the CAR and/or the ETP.
  • In one embodiment, the in vitro transcribed RNA CAR and/or RNA ETP can be introduced to a cell as a form of transient transfection. The RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template. DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase. The source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA. The desired template for in vitro transcription is a CAR or ETP described herein. For example, the template for the RNA CAR comprises an extracellular region comprising a single chain variable domain of an antibody to a tumor associated antigen described herein; a hinge region (e.g., a hinge region described herein), a transmembrane domain (e.g., a transmembrane domain described herein such as a transmembrane domain of CD8a); and a cytoplasmic region that includes an intracellular signaling domain, e.g., an intracellular signaling domain described herein, e.g., comprising the signaling domain of CD3-zeta and the signaling domain of 4-1BB.
  • In one embodiment, the template for in vitro transcription is the CAR of use in the present invention. For example, the template for the RNA CAR comprises an extracellular domain comprising a single chain variable domain of an antibody of interest (e.g., an anti-tumor antibody); a transmembrane domain (e.g., from the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154); and one or more intracellular signaling domains (e.g., 4-1BB, CD3-zeta).
  • In one embodiment, the template for in vitro transcription is a ETP. For example, a template for ETP may comprise the nucleic acid sequence encoding a costimulatory molecule (e.g., CD70, CD83, CD80, CD86, CD40, CD154, CD137L (4-1BBL), CD252 (OX40L), CD275 (ICOS-L), CD54 (ICAM-1), CD49a, CD43, CD48, CD112 (PVRL2), CD150 (SLAM), CD155 (PVR), CD265 (RANK), CD270 (HVEM), TL1A, CD127, IL-4R, GITR-L, CD160, CD258, TIM-4, CD153 (CD30L), CD200R (OX2R), CD44, ligands thereof, or functional fragments or variants thereof), a soluble cytokine (e.g., IL-2, IL-12, IL-6, IL-7, IL-15, IL-18, IL-21, GM-CSF, IL-18, IL-21, IL-27), a polypeptide involved in antigen presentation (e.g., CD64, MHC I, MHC II), a polypeptide involved in trafficking and/or migration (e.g., CD183, CCR2, CCR6, CD50, CD197, CD58, CD62L), or a polypeptide involved in dendritic cell targeting (e.g., TLR ligands, anti-DEC-205 antibody, anti-DC-SIGN antibody). In the invention, the T cells comprise a nucleic acid encoding an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming.
  • In one embodiment, the DNA to be used for PCR contains an open reading frame. The DNA can be from a naturally occurring DNA sequence from the genome of an organism. In one embodiment, the DNA is a full length gene of interest of a portion of a gene. The gene can include some or all of the 5' and/or 3' untranslated regions (UTRs). The gene can include exons and introns. In one embodiment, the DNA to be used for PCR is a human gene. In another embodiment, the DNA to be used for PCR is a human gene including the 5' and 3' UTRs. The DNA can alternatively be an artificial DNA sequence that is not normally expressed in a naturally occurring organism. An exemplary artificial DNA sequence is one that contains portions of genes that are ligated together to form an open reading frame that encodes a fusion protein. The portions of DNA that are ligated together can be from a single organism or from more than one organism.
  • Genes that can be used as sources of DNA for PCR include genes that encode polypeptides that provide a therapeutic or prophylactic effect to an organism or that can be used to diagnose a disease or disorder in an organism. Preferred genes are genes which are useful for a short term treatment, or where there are safety concerns regarding dosage or the expressed gene. For example, for treatment of cancer, autoimmune disorders, parasitic, viral, bacterial, fungal or other infections, the transgene(s) to be expressed may encode a polypeptide that functions as a ligand or receptor for cells of the immune system, or can function to stimulate or inhibit the immune system of an organism. It is not desirable to have prolonged ongoing stimulation of the immune system, nor necessary to produce changes which last after successful treatment, since this may then elicit a new problem. For treatment of an autoimmune disorder, it may be desirable to inhibit or suppress the immune system during a flare-up, but not long term, which could result in the patient becoming overly sensitive to an infection.
  • PCR is used to generate a template for in vitro transcription of mRNA which is used for transfection. Methods for performing PCR are well known in the art. Primers for use in PCR are designed to have regions that are substantially complementary to regions of the DNA to be used as a template for the PCR. Any DNA polymerase useful for PCR can be used in the methods disclosed herein. The reagents and polymerase are commercially available from a number of sources.
  • Chemical structures with the ability to promote stability and/or translation efficiency may also be used. The RNA preferably has 5' and 3' UTRs. In one embodiment, the 5' UTR is between zero and 3000 nucleotides in length. The length of 5' and 3' UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5' and 3' UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.
  • The 5' and 3' UTRs can be the naturally occurring, endogenous 5' and 3' UTRs for the gene of interest. Alternatively, UTR sequences that are not endogenous to the gene of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template. The use of UTR sequences that are not endogenous to the gene of interest can be useful for modifying the stability and/or translation efficiency of the RNA. For example, it is known that AU-rich elements in 3' UTR sequences can decrease the stability of mRNA. Therefore, 3' UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
  • In one embodiment, the 5' UTR can contain the Kozak sequence of the endogenous gene. Alternatively, when a 5' UTR that is not endogenous to the gene of interest is being added by PCR as described above, a consensus Kozak sequence can be redesigned by adding the 5' UTR sequence. Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many mRNAs is known in the art. In other embodiments the 5' UTR can be derived from an RNA virus whose RNA genome is stable in cells. In other embodiments various nucleotide analogues can be used in the 3' or 5' UTR to impede exonuclease degradation of the mRNA.
  • To enable synthesis of RNA from a DNA template without the need for gene cloning, a promoter of transcription should be attached to the DNA template upstream of the sequence to be transcribed. When a sequence that functions as a promoter for an RNA polymerase is added to the 5' end of the forward primer, the RNA polymerase promoter becomes incorporated into the PCR product upstream of the open reading frame that is to be transcribed. In one preferred embodiment, the promoter is a T7 polymerase promoter, as described elsewhere herein. Other useful promoters include, but are not limited to, T3 and SP6 RNA polymerase promoters. Consensus nucleotide sequences for T7, T3 and SP6 promoters are known in the art.
  • In one embodiment, the mRNA has both a cap on the 5' end and a 3' poly(A) tail which determine ribosome binding, initiation of translation and stability mRNA in the cell. On a circular DNA template, for instance, plasmid DNA, RNA polymerase produces a long concatameric product which is not suitable for expression in eukaryotic cells. The transcription of plasmid DNA linearized at the end of the 3' UTR results in normal sized mRNA which is not effective in eukaryotic transfection even if it is polyadenylated after transcription.
  • On a linear DNA template, phage T7 RNA polymerase can extend the 3' end of the transcript beyond the last base of the template (Schenbom and Mierendorf, Nuc Acids Res., 13 :6223-36 (1985); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65 (2003).
  • PolyA/T stretches can be integrated into a DNA template (e.g., a plasmid) by molecular cloning. Alternatively, the polyA/T segment of the transcriptional DNA template can be produced during PCR by using a reverse primer containing a polyT tail, such as 100T tail (size can be 50-5000 T), or after PCR by any other method, including, but not limited to, DNA ligation or in vitro recombination. Poly(A) tails also provide stability to RNAs and reduce their degradation. Generally, the length of a poly(A) tail positively correlates with the stability of the transcribed RNA. In one embodiment, the poly(A) tail is between 100 and 5000 adenosines.
  • Poly(A) tails of RNAs can be further extended following in vitro transcription with the use of a poly(A) polymerase, such as E. coli polyA polymerase (E-PAP). In one embodiment, increasing the length of a poly(A) tail from 100 nucleotides to between 300 and 400 nucleotides results in about a two-fold increase in the translation efficiency of the RNA. Additionally, the attachment of different chemical groups to the 3' end can increase mRNA stability. Such attachment can contain modified/artificial nucleotides, aptamers and other compounds. For example, ATP analogs can be incorporated into the poly(A) tail using poly(A) polymerase. ATP analogs can further increase the stability of the RNA.
  • 5' caps on also provide stability to RNA molecules. In a preferred embodiment, RNAs produced by the methods disclosed herein include a 5' cap. The 5' cap is provided using techniques known in the art and described herein (Cougot, et al, Trends in Biochem. Sci., 29:436-444 (2001); Stepinski, et al, RNA, 7: 1468-95 (2001); Elango, et al, Biochim. Biophys. Res. Commun., 330:958-966 (2005)).
  • The RNAs produced by the methods disclosed herein can also contain an internal ribosome entry site (IRES) sequence. The IRES sequence may be any viral, chromosomal or artificially designed sequence which initiates cap-independent ribosome binding to mRNA and facilitates the initiation of translation. Any solutes suitable for cell electroporation, which can contain factors facilitating cellular permeability and viability such as sugars, peptides, lipids, proteins, antioxidants, and surfactants can be included.
  • In one embodiment, the present invention includes synthetic RNA and RNA-like analogs encoding the CARs and ETPs of use in the invention. That is, the present invention includes CAR-and ETP-encoding RNA and RNA-like constructs manufactured in any method known in the art, including, for example IVT RNA and synthesized RNA. In one embodiment, RNA is synthesized through known methods of oligonucleotide synthesis. Methods of oligonucleotide synthesis include, for example, H-phosphonate synthesis, phosphodiester synthesis, phosphotriester synthesis, phosphite triester synthesis, and the phosphoramidite method. In some instances, synthesis of the RNA construct includes the incorporation of nucleotide /nucleoside derivatives or analogs. As such, in one embodiment, the RNA of use in the invention comprises a nucleotide/nucleoside derivative or analog. For example, one type of analog is LNA, such as beta-D-oxy-LNA, alpha-L-oxy-LNA, beta-D-amino-LNA and beta-D-thio-LNA, and beta-D-oxy-LNA. Methods of producing synthesized RNA are well known in the art, described, for example, in U.S. Patent No: 8,242,248 , U.S. Patent No.: 6, 11 1,095 , U.S. Patent Application Publication No.: 2010/0324278 , U.S. Patent Application Publication No.: 2010/0137010 , and PCT International Publication No.: WO 2007/031081 . Further, the present invention includes CAR- and ETP-encoding RNA and RNA-like constructs manufactured via methods heretofore unknown, provided that the constructs comprise a sequence which encodes the components of the CAR or ETP described herein.
  • RNA or DNA can be introduced into target cells using any of a number of different methods, for instance, commercially available methods which include, but are not limited to, electroporation (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) or the Gene Pulser II (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg Germany), cationic liposome mediated transfection using lipofection, polymer encapsulation, peptide mediated transfection, or biolistic particle delivery systems such as "gene guns" (see, for example, Nishikawa, et al. Hum Gene Ther., 12(8):861-70 (2001).
  • DNA Constructs
  • Disclosed herein are methods for expressing a DNA or a cDNA encoding a CAR and/or a DNA or a cDNA encoding an ETP. The present invention may utilise vectors in which a DNA of use in the present invention is inserted. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
  • In another embodiment, the vector comprising the nucleic acid encoding the desired CAR of use in the invention is an adenoviral vector (A5/35). In another embodiment, the expression of nucleic acids encoding CARs can be accomplished using of transposons such as sleeping beauty, crisper, CAS9, and zinc finger nucleases. See below June et al. 2009Nature Reviews Immunology 9.10: 704-716.
  • In brief summary, the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector. The vectors can be suitable for replication and integration eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
  • The expression constructs of use in the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346 , 5,580,859 , 5,589,466 . In another embodiment, the invention may utilise a gene therapy vector.
  • The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1 -4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno- associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584 ; WO 01/29058 ; and U.S. Pat. No. 6,326,193 ).
  • A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, retrovirus vectors are used. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, lentivirus vectors are used.
  • Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription. Exemplary promoters include the CMV IE gene, EF-1α, ubiquitin C, or phosphoglycerokinase (PGK) promoters.
  • Engineered T Cells ("ETP-CAR T cells")
  • Disclosed herein are T cells comprising one or more, e.g., one, two, or more, nucleic acid molecules comprising a nucleic acid sequence encoding a CAR described herein and a nucleic acid sequence encoding an ETP described herein. In the invention, the T cells comprise a nucleic acid encoding an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. In an embodiment, the nucleic acid comprises both the nucleic acid sequence encoding a CAR described herein and the nucleic acid sequence encoding an ETP in accordance with the claims, e.g., the nucleic acid sequences comprising the CAR and the ETP are disposed on the same nucleic acid molecule. In an embodiment, the nucleic acid comprises two nucleic acid molecules, wherein the nucleic acid sequence encoding a CAR described herein is disposed on one nucleic acid molecule and the nucleic acid sequence encoding an ETP in accordance with the claims is disposed on the other nucleic acid molecule. In the present invention, the nucleic acid molecule comprises RNA. In embodiments where the nucleic acid sequences encoding the CAR and ETP are disposed on two nucleic acid molecules, both nucleic acid molecules comprise RNA. Alternatively, in embodiments where the nucleic acid sequences encoding the CAR and ETP are disposed on two nucleic acid molecules, one nucleic acid molecule may comprise RNA and the other nucleic acid molecule may comprise DNA.
  • In the present invention, one or both of the nucleic acid sequences encoding a CAR and the nucleic acid sequences encoding an ETP comprise RNA. For example, the nucleic acid sequence encoding the CAR can comprise RNA and the nucleic acid sequence encoding the ETP can comprise DNA. In another example, the nucleic acid sequence encoding the CAR can comprise DNA and the nucleic acid sequence encoding the ETP can comprise RNA.
  • In some embodiments where the nucleic acid sequence encoding a CAR comprises DNA, e.g., a vector, e.g., a viral vector, the CAR comprises an extracellular domain, e.g., an antigen binding domain described herein, a transmembrane domain, and two or more intracellular signaling domains, e.g., a primary signaling domain and a costimulatory signaling domain. In an embodiment, the CAR comprises a primary signaling domain, e.g., a CD3 zeta domain as described herein, and a costimulatory signaling domain, e.g., a 4-1BB domain as described herein. In such embodiments, the CAR comprises one or more additional intracellular signaling domains, e.g., 1, 2, 3, 4, or 5 additional costimulatory signaling domains as described herein. In any of the foregoing embodiments, the CAR may be a regulatable CAR, e.g., an RCAR described herein, in which the CAR activity can be controlled, e.g., by administering or withdrawing the dimerization molecule. In such embodiments where an RCAR is used, the CAR activity may be transient, while the antigen presenting or T cell priming activity is prolonged, and results in a more long lasting immune response against the disease.
  • In embodiments, the T cell comprises a nucleic acid sequence encoding a CAR described herein and two or more, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more nucleic acid sequences encoding an ETP, wherein the nucleic acid sequences encode different ETPs described herein. In the invention, the T cells comprise a nucleic acid encoding an ETP selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming. In embodiments where the T cell comprises more than one nucleic acid sequence encoding an ETP described herein, each nucleic acid sequence encoding the ETPs can be present on the same nucleic acid molecule or on different nucleic acid molecules. Two or more nucleic acid sequences encoding ETPs, e.g., 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more, can be disposed on the same nucleic acid molecule. By way of example, in an embodiment where the T cell comprises three nucleic acid sequences encoding ETPs, two of the nucleic acid sequences encoding ETPs can be disposed on one nucleic acid molecule, and one nucleic acid sequence encoding an ETP can be disposed on another nucleic acid molecule. In any of these embodiments, the nucleic acid sequence encoding a CAR described herein can be disposed on a nucleic acid molecule further comprising one or more nucleic acid sequences encoding an ETP. In an alternative embodiment, the nucleic acid sequence encoding a CAR described herein is disposed on a nucleic acid molecule that does not comprise a nucleic acid sequence encoding an ETP.
  • Also disclosed herein are methods for generating a T cell comprising a nucleic acid sequence encoding a CAR and a nucleic acid sequence encoding an ETP. In methods where one or both of the nucleic acid sequences encoding a CAR and ETP comprise RNA, the RNA molecule(s) are transfected, e.g., electroporated, into the T cell using standard transfection methods and reagents known in the art. In methods where one or both of the nucleic acid sequences encoding a CAR and ETP comprise DNA, the DNA molecule(s) can be introduced, e.g., by transfection, electroporation, viral transduction, into the T cell using standard methods and reagents known in the art.
  • The in vitro transcribed CAR mRNA and ETP mRNA, cDNAs, or vectors, e.g., retroviral or lentiviral vectors, encoding the CAR and ETP of interest, can be delivered into different types of lymphocytes (e.g., T cells), as well as into tissues and whole organisms using transfected cells as carriers or cell-free local or systemic delivery of encapsulated, bound or naked nucleic acid molecules, e.g., in vitro transcribed RNA, mRNA, cDNA, or DNA vectors. The method used can be for any purpose where transient expression is required or sufficient. T cells that have been modified to express a nucleic acid sequence encoding CAR and a nucleic acid sequence encoding an ETP are referred to as "ETP-CAR T cells". T cells can be transduced, e.g., virally transduced, with CAR DNA, e.g., a vector encoding a CAR, and ETP DNA, e.g., a vector encoding an ETP. T cells co-transfected with CAR RNA and ETP RNA are referred to as "RNA ETP-CAR T cells."
  • The disclosed methods can be applied to modulation of cell activity in basic research and therapy, in the fields of cancer, stem cells, acute and chronic infections, and autoimmune diseases, including modulation of the developmental pathways.
  • The methods also provide the ability to control the level of expression over a wide range by changing the amount of input RNA, making it possible to individually regulate the expression level of each transfected gene. Furthermore, the PCR-based technique of mRNA production greatly facilitates the design of the chimeric receptor mRNAs with different structures and combination of their domains. For example, varying of different intracellular effector/costimulator domains on multiple chimeric receptors in the same cell allows determination of the structure of the receptor combinations which assess the highest level of cytotoxicity against multi-antigenic targets, and at the same time lowest cytotoxicity toward normal cells.
  • An advantage of the methods of the invention is that RNA transfection is essentially transient and a vector-free. Moreover, RNA transfection of multiple distinct RNAs can be performed with high efficiency without substantially altering the expression of the distinct polypeptides encoded by co-delivered RNA molecules. An RNA transgene can be delivered to a lymphocyte and expressed therein following a brief in vitro cell activation, as a minimal expressing cassette without the need for any additional viral sequences. Under these conditions, integration of the transgene into the host cell genome is unlikely. Cloning of cells is not necessary because of the high efficiency of transfection of the RNA and its ability to uniformly modify the entire lymphocyte population. Thus, cells containing an RNA construct introduced according to the disclosed method can be used therapeutically. For example, a lymphocyte cell population is withdrawn from a patient, transfected with different RNA constructs, and then reintroduced into the patient. The transfected cell population then can target, e.g., cancer cells or cells containing other disease-associated antigens. A benefit of the use of RNA transfected cells is that the RNA transgene has a limited half-life. The encoded protein will only be produced by the transfected cell for a limited period of time. This serves to reduce the risk of any unintended consequences when genetically modified cells are introduced into a patient.
  • In a preferred embodiment, the technology is used for personalized therapy. For example, for treatment of tumors, the patient's blood or cells is collected by an appropriate method such as apheresis, biopsy or venapuncture. The cells are cultured for at least 24 hours during which time the cells are modified with an appropriate nucleic acid, e.g., transfected with an appropriate RNA construct or transduced with an appropriate DNA, e.g., vector, construct, to treat the tumor. The cells can be stored frozen before transfection or tranduction, if necessary. They are then returned back to the patient at the appropriate time and in the appropriate dose. In one embodiment, modified cells, e.g., RNA-modified cells or DNA-modified cells, are administered to the patient multiple times.
  • Immune therapy with in vitro-transcribed RNA (IVT-RNA) makes use of two different strategies both of which have been successively tested in various animal models. Cells are transfected with in vitro-transcribed RNA by means of lipofection or electroporation and administered to the subject. Preferably, it is desirable to stabilize IVT-RNA using various modifications in order to achieve prolonged expression of transferred IVT-RNA.
  • Some IVT vectors are known in the literature which are utilized in a standardized manner as template for in vitro transcription and which have been genetically modified in such a way that stabilized RNA transcripts are produced. Currently protocols used in the art are based on a plasmid vector with the following structure: a 5' RNA polymerase promoter enabling RNA transcription, followed by a gene of interest which is flanked either 3' and/or 5' by untranslated regions (UTR), and a 3' polyadenyl cassette containing a chain of A nucleotides. Prior to in vitro transcription, the circular plasmid is linearized downstream of the polyadenyl cassette by type II restriction enzymes (recognition sequence corresponds to cleavage site). The polyadenyl cassette thus corresponds to the later poly(A) sequence in the transcript. As a result of this procedure, some nucleotides remain as part of the enzyme cleavage site after linearization and extend or mask the poly(A) sequence at the 3' end. It is not clear, whether this nonphysiological overhang affects the amount of protein produced intracellularly from such a construct.
  • RNA has several advantages over more traditional plasmid or viral approaches. Gene expression from an RNA source does not require transcription and the protein product is produced rapidly after the transfection. Further, the RNA needs only to gain access to the cytoplasm, rather than the nucleus, and therefore typical transfection methods result in an extremely high rate of transfection. In addition, plasmid based approaches require that the promoter driving the expression of the gene of interest be active in the cells under study.
  • In another embodiment, the RNAs of use in the invention can be delivered into the cells by electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US 2004/0014645 , US 2005/0052630A1 , US 2005/0070841 A1 , US 2004/0059285A1 , US 2004/0092907A1 . The various parameters including electric field strength required for electroporation of any known cell type are generally known in the relevant research literature as well as numerous patents and applications in the field. See e.g., U.S. Pat. No. 6,678,556 , U.S. Pat. No. 7,171,264 , and U.S. Pat. No. 7, 173, 116 . Apparatus for therapeutic application of electroporation are available commercially, e.g., the MedPulser™ DNA Electroporation Therapy System (Inovio/Genetronics, San Diego, Calif), and are described in patents such as U.S. Pat. No. 6,567,694 ; U.S. Pat. No. 6,516,223 , U.S. Pat. No. 5,993,434 , U.S. Pat. No. 6, 181,964 , U.S. Pat. No. 6,241,701 , and U.S. Pat. No. 6,233,482 ; electroporation may also be used for transfection of cells in vitro as described e.g. in US20070128708A1 . Electroporation may also be utilized to deliver nucleic acids into cells in vitro. Accordingly, electroporation-mediated administration into cells of nucleic acids including expression constructs utilizing any of the many available devices and electroporation systems known to those of skill in the art presents an exciting new means for delivering an RNA of interest to a target cell.
  • In other embodiments, the RNAs can be delivered into the cells by calcium phosphate precipitation, lipofection, particle bombardment, microinjection, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1 -4, Cold Spring Harbor Press, NY).
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle). Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles.
  • The use of lipid formulations is contemplated for the introduction of the RNAs into a host cell (in vitro, ex vivo or in vivo). In another aspect, the RNA may be associated with a lipid. The RNA associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid/RNA associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
  • Lipids suitable for use can be obtained from commercial sources. For example, dimyristyl phosphatidylcholine ("DMPC") can be obtained from Sigma, St. Louis, MO; dicetyl phosphate ("DCP") can be obtained from K & K Laboratories (Plainview, NY); cholesterol ("Choi") can be obtained from Calbiochem-Behring; dimyristyl phosphatidylglycerol ("DMPG") and other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, AL.). Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about -200C. Chloroform is used as the only solvent since it is more readily evaporated than methanol. "Liposome" is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 Glycobiology 5: 505-10). However, compositions that have different structures in solution than the normal vesicular structure are also encompassed. For example, the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules. Also contemplated are lipofectamine-nucleic acid complexes.
  • Sources of Cells
  • Prior to expansion and genetic modification or other modification, a source of cells, e.g., T cells, can be obtained from a subject. The term "subject" is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, monkeys, chimpanzees, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • In certain aspects of the present disclosure, immune effector cells, e.g., T cells, can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll™ separation. In one preferred aspect, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In one aspect, the cells collected by apheresis may be washed to remove the plasma fraction and, optionally, to place the cells in an appropriate buffer or media for subsequent processing steps. In one embodiment, the cells are washed with phosphate buffered saline (PBS). In an alternative embodiment, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • Initial activation steps in the absence of calcium can lead to magnified activation. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated "flow-through" centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • In one aspect, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL™ gradient or by counterflow centrifugal elutriation.
  • The methods described herein can include, e.g., selection of a specific subpopulation of immune effector cells, e.g., T cells, that are a T regulatory cell-depleted population, CD25+ depleted cells, using, e.g., a negative selection technique, e.g., described herein. Preferably, the population of T regulatory depleted cells contains less than 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells.
  • In one embodiment, T regulatory cells, e.g., CD25+ T cells, are removed from the population using an anti-C25 antibody, or fragment thereof, or a CD25-binding ligand, IL-2. In one embodiment, the anti-CD25 antibody, or fragment thereof, or CD25-binding ligand is conjugated to a substrate, e.g., a bead, or is otherwise coated on a substrate, e.g., a bead. In one embodiment, the anti-CD25 antibody, or fragment thereof, is conjugated to a substrate as described herein.
  • In one embodiment, the T regulatory cells, e.g., CD25+ T cells, are removed from the population using CD25 depletion reagent from Militenyi™. In one embodiment, the ratio of cells to CD25 depletion reagent is 1e7 cells to 20 uL, or 1e7 cells to15 uL, or 1e7 cells to 10 uL, or 1e7 cells to 5 uL, or 1e7 cells to 2.5 uL, or 1e7 cells to 1.25 uL.
  • In one embodiment, the population of immune effector cells to be depleted includes about 6 × 109 CD25+ T cells. In other aspects, the population of immune effector cells to be depleted include about 1 × 109 to 1× 1010 CD25+ T cell, and any integer value in between. In one embodiment, the resulting population T regulatory depleted cells has 2 × 109 T regulatory cells, e.g., CD25+ cells, or less (e.g., 1 × 109, 5 × 108, 1 × 108, 5 × 107, 1 × 107, or less CD25+ cells).
  • In one embodiment, the T regulatory cells, e.g., CD25+ cells, are removed from the population using the CliniMAC system with a depletion tubing set, such as, e.g., tubing 162-01. In one embodiment, the CliniMAC system is run on a depletion setting such as, e.g., DEPLETION2.1.
  • The methods described herein can include more than one selection step, e.g., more than one depletion step. Enrichment of a T cell population by negative selection can be accomplished, e.g., with a combination of antibodies directed to surface markers unique to the negatively selected cells. One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail can include antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.
  • The methods described herein can further include removing cells from the population which express a tumor antigen, e.g., a tumor antigen that does not comprise CD25, e.g., CD19, CD30, CD38, CD123, CD20, CD14 or CD11b, to thereby provide a population of T regulatory depleted, e.g., CD25+ depleted, and tumor antigen depleted cells that are suitable for expression of a CAR, e.g., a CAR described herein. In one embodiment, tumor antigen expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells. For example, an anti-C25 antibody, or fragment thereof, and an anti-tumor antigen antibody, or fragment thereof, can be attached to the same substrate, e.g., bead, which can be used to remove the cells or an anti-CD25 antibody, or fragment thereof, or the anti-tumor antigen antibody, or fragment thereof, can be attached to separate beads, a mixture of which can be used to remove the cells. In other embodiments, the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the tumor antigen expressing cells is sequential, and can occur, e.g., in either order.
  • Also provided are methods that include removing cells from the population which express a check point inhibitor, e.g., a check point inhibitor described herein, e.g., one or more of PD1+ cells, LAG3+ cells, and TIM3+ cells, to thereby provide a population of T regulatory depleted, e.g., CD25+ depleted cells, and check point inhibitor depleted cells, e.g., PD1+, LAG3+ and/or TIM3+ depleted cells. Exemplary check point inhibitors include B7-H1, B&-1, CD160, P1H, 2B4, PD1, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, TIGIT, CTLA-4, BTLA and LAIR1. In one embodiment, check point inhibitor expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells. For example, an anti-C25 antibody, or fragment thereof, and an anti-check point inhibitor antibody, or fragment thereof, can be attached to the same bead which can be used to remove the cells, or an anti-CD25 antibody, or fragment thereof, and the anti-check point inhibitor antibody, or fragment there, can be attached to separate beads, a mixture of which can be used to remove the cells. In other embodiments, the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the check point inhibitor expressing cells is sequential, and can occur, e.g., in either order.
  • Methods described herein can include a positive selection step. For example, T cells can isolated by incubation with anti-CD3/anti-CD28 (e.g., 3x28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells. In one embodiment, the time period is about 30 minutes. In a further embodiment, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further embodiment, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another embodiment, the time period is 10 to 24 hours, e.g., 24 hours. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells. Thus, by simply shortening or lengthening the time T cells are allowed to bind to the CD3/CD28 beads and/or by increasing or decreasing the ratio of beads to T cells (as described further herein), subpopulations of T cells can be preferentially selected for or against at culture initiation or at other time points during the process. Additionally, by increasing or decreasing the ratio of anti-CD3 and/or anti-CD28 antibodies on the beads or other surface, subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • In one embodiment, a T cell population can be selected that expresses one or more of IFN-γ, TNFα, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, or other appropriate molecules, e.g., other cytokines. Methods for screening for cell expression can be determined, e.g., by the methods described in PCT Publication No.: WO 2013/126712 .
  • For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In certain aspects, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (e.g., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one aspect, a concentration of 10 billion cells/ml, 9 billion/ml, 8 billion/ml, 7 billion/ml, 6 billion/ml, or 5 billion/ml is used. In one aspect, a concentration of 1 billion cells/ml is used. In yet one aspect, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further aspects, concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (e.g., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • In a related aspect, it may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized. This selects for cells that express high amounts of desired antigens to be bound to the particles. For example, CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute concentrations. In one aspect, the concentration of cells used is 5 × 106/ml. In other aspects, the concentration used can be from about 1 × 105/ml to 1 × 106/ml, and any integer value in between.
  • In other aspects, the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10°C or at room temperature.
  • T cells for stimulation can also be frozen after a washing step. Wishing not to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After the washing step that removes plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10 % Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10 % Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80°C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20° C or in liquid nitrogen.
  • In certain aspects, cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
  • Also contemplated in the context of the invention is the collection of blood samples or apheresis product from a subject at a time period prior to when the expanded cells as described herein might be needed. As such, the source of the cells to be expanded can be collected at any time point necessary, and desired cells, such as T cells, isolated and frozen for later use in immune effector cell therapy for any number of diseases or conditions that would benefit from immune effector cell therapy, such as those described herein. In one aspect a blood sample or an apheresis is taken from a generally healthy subject. In certain aspects, a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use. In certain aspects, the T cells may be expanded, frozen, and used at a later time. In certain aspects, samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments. In a further aspect, the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228 , and irradiation.
  • In a further aspect of the present invention, T cells are obtained from a patient directly following treatment that leaves the subject with functional T cells. In this regard, it has been observed that following certain cancer treatments, in particular treatments with drugs that damage the immune system, shortly after treatment during the period when patients would normally be recovering from the treatment, the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo. Likewise, following ex vivo manipulation using the methods described herein, these cells may be in a preferred state for enhanced engraftment and in vivo expansion. Thus, it is contemplated within the context of the present invention to collect blood cells, including T cells, dendritic cells, or other cells of the hematopoietic lineage, during this recovery phase. Further, in certain aspects, mobilization (for example, mobilization with GM-CSF) and conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy. Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • In one embodiment, the immune effector cells expressing a CAR molecule, e.g., a CAR molecule described herein, are obtained from a subject that has received a low, immune enhancing dose of an mTOR inhibitor. In an embodiment, the population of immune effector cells, e.g., T cells, to be engineered to express a CAR, are harvested after a sufficient time, or after sufficient dosing of the low, immune enhancing, dose of an mTOR inhibitor, such that the level of PD1 negative immune effector cells, e.g., T cells, or the ratio of PD1 negative immune effector cells, e.g., T cells/ PD1 positive immune effector cells, e.g., T cells, in the subject or harvested from the subject has been, at least transiently, increased.
  • In other embodiments, population of immune effector cells, e.g., T cells, which have, or will be engineered to express a CAR, can be treated ex vivo by contact with an amount of an mTOR inhibitor that increases the number of PD1 negative immune effector cells, e.g., T cells or increases the ratio of PD1 negative immune effector cells, e.g., T cells/ PD1 positive immune effector cells, e.g., T cells.
  • In one embodiment, a T cell population is diaglycerol kinase (DGK)-deficient. DGK-deficient cells include cells that do not express DGK RNA or protein, or have reduced or inhibited DGK activity. DGK-deficient cells can be generated by genetic approaches, e.g., administering RNA-interfering agents, e.g., siRNA, shRNA, miRNA, to reduce or prevent DGK expression. Alternatively, DGK-deficient cells can be generated by treatment with DGK inhibitors described herein.
  • In one embodiment, a T cell population is Ikaros-deficient. Ikaros-deficient cells include cells that do not express Ikaros RNA or protein, or have reduced or inhibited Ikaros activity, Ikaros-deficient cells can be generated by genetic approaches, e.g., administering RNA-interfering agents, e.g., siRNA, shRNA, miRNA, to reduce or prevent Ikaros expression. Alternatively, Ikaros-deficient cells can be generated by treatment with Ikaros inhibitors, e.g., lenalidomide.
  • In embodiments, a T cell population is DGK-deficient and Ikaros-deficient, e.g., does not express DGK and Ikaros, or has reduced or inhibited DGK and Ikaros activity. Such DGK and Ikaros-deficient cells can be generated by any of the methods described herein.
  • In an embodiment, the NK cells are obtained from the subject. In another embodiment, the NK cells are an NK cell line, e.g., NK-92 cell line (Conkwest).
  • Activation and Expansion of T Cells
  • Generally, a population of immune effector cells may be expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells. In particular, T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4+ T cells or CD8+ T cells, an anti-CD3 antibody and an anti-CD28 antibody. Examples of an anti-CD28 antibody include 9.3, B-T3, XR-CD28 (Diaclone, Besançon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol Meth. 227(1-2):53-63, 1999).
  • In certain aspects, the primary stimulatory signal and the costimulatory signal for the T cell may be provided by different protocols. For example, the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in "cis" formation) or to separate surfaces (i.e., in "trans" formation). Alternatively, one agent may be coupled to a surface and the other agent in solution. In one aspect, the agent providing the costimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain aspects, both agents can be in solution. In one aspect, the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents. In this regard, see for example, U.S. Patent Application Publication Nos. 20040101519 and 20060034810 for artificial antigen presenting cells (aAPCs) that are contemplated for use in activating and expanding T cells in the present invention.
  • In one aspect, the two agents are immobilized on beads, either on the same bead, i.e., "cis," or to separate beads, i.e., "trans." By way of example, the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the costimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts. In one aspect, a 1:1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used. In certain aspects of the present invention, a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular aspect an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1. In one aspect, the ratio of CD3 :CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain aspects, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1. In one particular aspect, a 1:100 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:75 CD3:CD28 ratio of antibody bound to beads is used. In a further aspect, a 1:50 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:30 CD3:CD28 ratio of antibody bound to beads is used. In one preferred aspect, a 1:10 CD3:CD28 ratio of antibody bound to beads is used. In one aspect, a 1:3 CD3:CD28 ratio of antibody bound to the beads is used. In yet one aspect, a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
  • Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells. As those of ordinary skill in the art can readily appreciate, the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many. In certain aspects the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further aspects the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells. The ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, and 15:1 with one preferred ratio being at least 1:1 particles per T cell. In one aspect, a ratio of particles to cells of 1:1 or less is used. In one particular aspect, a preferred particle: cell ratio is 1:5. In further aspects, the ratio of particles to cells can be varied depending on the day of stimulation. For example, in one aspect, the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition). In one particular aspect, the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation. In one aspect, particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation. In one aspect, the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation. In one aspect, particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation. One of skill in the art will appreciate that a variety of other ratios may be suitable for use in the present invention. In particular, ratios will vary depending on particle size and on cell size and type. In one aspect, the most typical ratios for use are in the neighborhood of 1:1, 2:1 and 3:1 on the first day.
  • In further aspects, the cells, such as T cells, are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured. In an alternative aspect, prior to culture, the agent-coated beads and cells are not separated but are cultured together. In a further aspect, the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
  • By way of example, cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3x28 beads) to contact the T cells. In one aspect the cells (for example, 104 to 109 T cells) and beads (for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1:1) are combined in a buffer, for example PBS (without divalent cations such as, calcium and magnesium). Again, those of ordinary skill in the art can readily appreciate any cell concentration may be used. For example, the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest. Accordingly, any cell number is within the context of the present invention. In certain aspects, it may be desirable to significantly decrease the volume in which particles and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and particles. For example, in one aspect, a concentration of about 2 billion cells/ml is used. In one aspect, greater than 100 million cells/ml is used. In a further aspect, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet one aspect, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further aspects, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain aspects. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • In one embodiment, cells transduced with a nucleic acid encoding a CAR, e.g., a CAR described herein, are expanded, e.g., by a method described herein. In one embodiment, the cells are expanded in culture for a period of several hours (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 18, 21 hours) to about 14 days (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days). In one embodiment, the cells are expanded for a period of 4 to 9 days. In one embodiment, the cells are expanded for a period of 8 days or less, e.g., 7, 6 or 5 days. In one embodiment, the cells, e.g., a CD19 CAR cell described herein, are expanded in culture for 5 days, and the resulting cells are more potent than the same cells expanded in culture for 9 days under the same culture conditions. Potency can be defined, e.g., by various T cell functions, e.g. proliferation, target cell killing, cytokine production, activation, migration, or combinations thereof. In one embodiment, the cells, e.g., a CD19 CAR cell described herein, expanded for 5 days show at least a one, two, three or four fold increase in cells doublings upon antigen stimulation as compared to the same cells expanded in culture for 9 days under the same culture conditions. In one embodiment, the cells, e.g., the cells expressing a CD19 CAR described herein, are expanded in culture for 5 days, and the resulting cells exhibit higher proinflammatory cytokine production, e.g., IFN-γ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions. In one embodiment, the cells, e.g., a CD19 CAR cell described herein, expanded for 5 days show at least a one, two, three, four, five, ten fold or more increase in pg/ml of proinflammatory cytokine production, e.g., IFN-γ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more. Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-γ, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ, and TNF-α or any other additives for the growth of cells known to the skilled artisan. Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol. Media can include RPMI 1640, AIM-V, DMEM, MEM, α-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells. Antibiotics, e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject. The target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% CO2).
  • In one embodiment, the cells are expanded in an appropriate media (e.g., media described herein) that includes one or more interleukin that result in at least a 200-fold (e.g., 200-fold, 250-fold, 300-fold, 350-fold) increase in cells over a 14 day expansion period, e.g., as measured by a method described herein such as flow cytometry. In one embodiment, the cells are expanded in the presence IL-15 and/or IL-7 (e.g., IL-15 and IL-7).
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics. For example, typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (TH, CD4+) that is greater than the cytotoxic or suppressor T cell population (TC, CD8+). Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of TH cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising predominately of TH cells may be advantageous. Similarly, if an antigen-specific subset of TC cells has been isolated it may be beneficial to expand this subset to a greater degree.
  • Further, in addition to CD4 and CD8 markers, other phenotypic markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
  • Assays
  • Once a CAR is constructed, various assays can be used to evaluate the activity of the molecule, such as but not limited to, the ability to expand T cells following antigen stimulation, sustain T cell expansion in the absence of re-stimulation, and anti-cancer activities in appropriate animal models. Assays to evaluate the effects of a CAR are described in further detail below.
  • Western blot analysis of CAR expression in primary T cells can be used to detect the presence of monomers and dimers. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Very briefly, T cells (1:1 mixture of CD4+ and CD8+ T cells) expressing the CARs are expanded in vitro for more than 10 days followed by lysis and SDS-PAGE under reducing conditions. CARs containing the full length TCR-ζ cytoplasmic domain and the endogenous TCR-ζ chain are detected by western blotting using an antibody to the TCR-ζ chain. The same T cell subsets are used for SDS-PAGE analysis under non-reducing conditions to permit evaluation of covalent dimer formation.
  • In vitro expansion of CAR+ T cells following antigen stimulation can be measured by flow cytometry. For example, a mixture of CD4+ and CD8+ T cells are stimulated with αCD3/αCD28 aAPCs followed by transduction with lentiviral vectors expressing GFP under the control of the promoters to be analyzed. Exemplary promoters include the CMV IE gene, EF-1α, ubiquitin C, or phosphoglycerokinase (PGK) promoters. GFP fluorescence is evaluated on day 6 of culture in the CD4+ and/or CD8+ T cell subsets by flow cytometry. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).
  • Sustained CAR+ T cell expansion in the absence of re-stimulation can also be measured. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009). Briefly, mean T cell volume (fl) is measured on day 8 of culture using a Coulter Multisizer III particle counter following stimulation with αCD3/αCD28 coated magnetic beads on day 0, and transduction with the indicated CAR on day 1.
  • Assessment of cell proliferation and cytokine production can be performed as previously described in, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).
  • Cytotoxicity can be assessed by a standard 51Cr-release assay. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009), or by standard degranulation assays, as described in Example 5. For example, RNA CAR T cells co-expressing a CAR and one or more costimulatory molecules are incubated with target cells expressing the antigen targeted by the CAR. By way of example, a mesothelin-targeting CAR expressing T cells which also express one or more co-stimulatory molecules are incubated with mesothelin-expressing target cells (K-meso, SKOV3) and mesothelin-negative cells (K562) and evaluated for CD107a exposure in a degranulation assay.
  • Candidate ETPs can be tested for the ability to enhance T cell priming using the modified in vitro priming system described in Examples 2 and 3. Briefly, each candidate ETP is co-delivered with a CAR into T cells and exposed to one round of antigen stimulation with, e.g., a tumor antigen such as MART-1. An exemplary method is provided in the examples below.
  • Other assays, including those described in the Example section herein as well as those that are known in the art can also be used to evaluate the CAR constructs of use in the invention.
  • Therapeutic Applications
  • The present invention provides T cells for use in a variety of therapeutic methods, the T cells being genetically modified to express a chimeric antigen receptor (CAR) and one or more ETPs in accordance with the claims, e.g., ETP-CAR T cells. In an embodiment, the T cells are genetically modified to transiently express an RNA encoding CAR and an RNA encoding ETP, e.g., RNA ETP-CAR T cells. This is achieved by infusing the ETP-CAR T cells, e.g., RNA ETP-CAR T cells, in to a recipient in need thereof. The infused cell is able to kill cells which express the antigen to which the antigen-binding portion of the CAR binds. In certain embodiments, the antigen is a tumor antigen, and the T cell is administered to a recipient with cancer. The anti-tumor response elicited by the ETP-CAR T cell, e.g., RNA ETP-CAR T cell, involves both CAR-mediated cell killing, as well as ETP-enhanced cytotoxic T lymphocyte priming with tumor-specific antigenic
    peptides derived from, e.g., the tumor cells killed by CAR activity. Expression of RNA CAR and RNA ETP results in a transient therapy (due to transient expression of the CAR and ETPs) with permanent anti-tumor effects (due to persistence of RNA ETP-CAR T cell priming of tumor-reactive T cells). In particular embodiments, the CAR and ETP RNAs in the RNA ETP-CAR T cells administered to the patient, or their progeny, persist in the patient for 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 days after transduction after administration of the RNA ETP-CAR T cell to the patient.
  • Accordingly, in one embodiment, the invention provides RNA ETP-CAR T cells of the invention for use in a method for inhibiting the proliferation or reducing a cell population expressing a disease-associated antigen by contacting a population of cells expressing the disease-associated antigen with an RNA ETP-CAR T cell of the invention that binds to the disease-associated antigen. In one embodiment, the cells are cancer cells. In other embodiments, the ETP-CAR T cell, e.g., RNA ETP-CAR T cell, reduces the quantity, number, amount or percentage of cells and/or cancer cells by at least 25%, at least 30%, at least 40%, at least 50%, at least 65%, at least 75%, at least 85%, at least 95%, or at least 99% in a subject with cancer or an animal model of cancer relative to a negative control. In another embodiment, the subject is a human.
  • The efficacy of the ETP-CAR T cells, e.g., RNA ETP-CAR T cells, of the invention can be tested using art-recognized animal models for the particular indication of interest. For example, in the context of cancer, established cancer mouse models are widely available for the particular cancer of interest.
  • In another embodiment, the invention provides ETP-CAR T cells of the invention for use in methods for preventing, treating and/or managing a disorder associated with cells expressing a disease-associated antigen by administering to a subject in need an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention that binds to the disease-associated antigen-expressing cell. In one embodiment, the subject is a human.
  • In another embodiment, the invention provides ETP-CAR T cells of the invention for use in methods for preventing relapse of cancer associated with cells expressing a particular tumor antigen by administering to a subject in need thereof an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention that binds to the tumor antigen-expressing cell. In another embodiment, the methods comprise administering to the subject in need thereof an effective amount of an ETP-CAR T cell, e.g., RNA ETP-CAR T
    cell, of the invention that binds to the disease-associated antigen-expressing cell in combination with an effective amount of another therapy.
  • In another embodiment, the invention provides ETP-CAR T cells of the invention for use in a method of inhibiting growth of a cell expressing a tumor antigen by contacting the tumor cell with an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention such that the ETP-CAR T cell is activated in response to the antigen and targets the cancer cell, wherein the growth of the tumor is inhibited. In one embodiment, the activated ETP-CAR T cell, e.g., RNA ETP-CAR T cell, targets and kills the cancer cell and/or enhances epitope spreading.
  • In another embodiment, the invention provides ETP-CAR T cells of the invention for use in a method of treating a proliferative disease (e.g., cancer) by administering to a subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention, such that the cancer is treated in the subject. Non-limiting examples of a cancer that can be treated by the present invention include brain cancer, bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  • In another embodiment, the invention provides ETP-CAR T cells of the invention for use in a method of treating a precancerous condition by administering to a subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the invention, such that the precancerous condition is treated in the subject.
  • In another embodiment, the invention provides ETP-CAR T cells of the invention for use in a method of treating a non-cancer indication by administering to a subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention such that the non-cancer indication is treated in the subject. Non-limiting examples of non-cancer indications include inflammatory disorders, autoimmune disorders, parasitic, viral, bacterial, fungal or other infections.
  • In a particular embodiment, the fully-human ETP-CAR T cells of the invention are for use as a vaccine for ex vivo immunization and/or in vivo therapy in a mammal (e.g., a human). For ex vivo immunization, at least one of the following preferably occurs in vitro prior to administering the cell into a mammal: i) expansion of the cells, ii) introducing a nucleic acid encoding a CAR and an ETP, as described herein, to the cells or iii) cryopreservation of the cells. In another embodiment, the invention provides ETP-CAR T cells of the invention for use in a method for vaccinating a subject comprising administering
    to the subject an ETP-CAR T cell, e.g., RNA ETP-CAR T cell, of the present invention. E.g., the subject is vaccinated for a cancer, a viral infection, or a bacterial infection. In an embodiment, the method further comprises administering to the subject an antigen, e.g., a tumor antigen, a viral antigen, or a bacterial antigen. Vaccination of a subject can be determined by detecting the capability of the subject to mount an immune response to the particular disease, e.g., by measuring antibody titer against a disease-associated antigen, e.g., a tumor antigen, a viral antigen, or a bacterial antigen.
  • Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells are isolated from a mammal (e.g., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAR disclosed herein. The CAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit. The mammalian recipient may be a human and the CAR-modified cell can be autologous with respect to the recipient. Alternatively, the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
  • Procedures for ex vivo expansion of hematopoietic stem and progenitor cells are described, for example, in U.S. Pat. No. 5,199,942 can be applied to the cells of the present invention. Other suitable methods are known in the art therefore the present invention is not limited to any particular method of ex vivo expansion of the cells. Briefly, ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo. In addition to the cellular growth factors described in U.S. Pat. No. 5,199,942 , other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
  • In addition to providing a cell-based vaccine for ex vivo immunization, the present invention also provides compositions for in vivo immunization to elicit an immune response directed against an antigen in a patient.
  • Generally, the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised. In certain aspects, the cells of the invention are used in the treatment of patients at risk for developing diseases, disorders and conditions associated with the expression of a disease-associated antigen. Thus, the present invention provides ETP-CAR T cells of the invention for use in methods for the treatment or prevention of diseases, disorders and conditions associated with expression of a disease-associated antigen comprising administering to a subject in need thereof, a therapeutically effective amount of the ETP-CAR T cells of the invention, e.g., RNA ETP-CAR T cell, which bind cells expressing the disease-associated antigen.
  • The ETP-CAR T cells of the present invention, e.g., RNA ETP-CAR T cell, may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations.
  • Pharmaceutical Compositions
  • Pharmaceutical compositions of the present invention comprise an ETP-CAR T cell, e.g., RNA ETP-CAR T cell of the present invention, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present invention are in one aspect formulated for intravenous administration.
  • Pharmaceutical compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented). The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • When "an immunologically effective amount," "an anti-tumor effective amount," "a tumor-inhibiting effective amount," or "therapeutic amount" is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 104 to 109 cells/kg body weight, in some instances 105 to 106 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988). The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
  • In certain instances, it may be desired to administer activated T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom according to the present disclosure, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain aspects, T cells can be activated from blood draws of from 10cc to 400cc. In certain aspects, T cells are activated from blood draws of 20cc, 30cc, 40cc, 50cc, 60cc, 70cc, 80cc, 90cc, or 100cc. Not to be bound by theory, using this multiple blood draw/multiple reinfusion protocol, may select out certain populations of T cells.
  • Administration of the compositions may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions may be administered to a patient trans arterially, subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In one embodiment, the compositions are administered to a patient by intradermal or subcutaneous injection. In one embodiment, the compositions are administered by i.v. injection. In one embodiment, the compositions are injected directly into a tumor, lymph node, or site of infection.
  • In one embodiment, cells activated and expanded using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels, are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients. In further aspects, the T cells of the invention may be used in a treatment regimen in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228 , cytokines, and irradiation. Drugs that inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin). (Liu et al., Cell 66 :807-815, 1991 ; Henderson et al., Immun. 73 :316-321, 1991 ; Bierer et al., Curr. Opin. Immun. 5:763-773, 1993) can also be used. In a further aspect, the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH. In one aspect, the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan. For example, in one embodiment, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In certain embodiments, following the transplant, subjects receive an infusion of the expanded immune cells of the present invention. In an additional embodiment, expanded cells are administered before or following surgery.
  • In a particular embodiment, subjects undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells. These T cell isolates may be expanded by methods known in the art and treated such that one or more CAR and ETP constructs of use in the invention may be introduced, thereby creating an ETP-CAR T cell of the invention, e.g., RNA ETP-CAR T cell. Subjects in need thereof may subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In certain aspects, following or concurrent with the transplant, subjects receive an infusion of the expanded ETP-CAR T cells of the present invention, e.g., RNA ETP-CAR T cell. In an additional aspect, expanded cells are administered before or following surgery.
  • The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices. The dose for CAMPATH, for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days. The preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Patent No. 6,120,766 ).
  • The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples. The invention is defined by the attached claims.
  • Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compounds of the present invention and practice the claimed methods. The following working examples specifically point out various aspects of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.
  • EXAMPLES Example 1: General Materials and Methods
  • The following general materials and methods are used in the experiments and examples described herein.
  • Cell culture
  • Primary PBMs, purified CD4+ T cells, and purified CD8+ T cells were from normal healthy HLA-A2+ donors and purchased from University of Pennsylvania Perelman School of Medicine Human Immunology Core, Philadelphia, PA. K562 and SKOV3 cells were from ATCC (Manassas, VA) and K-meso cells were from the Laboratory of C. June (Philadelphia, PA). K562 cells were derived from a chronic myeloid leukemia (NY-ESO-1-CD19-), SKOV3 from an adenocarcinoma, and K-meso cells were K562 cells transduced to express mesothelin. All cells were quantified and sized using a Multisizer 3 COULTER COUNTER (MS3; Beckman Coulter, Brea, CA).
  • DCs were cultured from PBMCs which were washed twice with Dulbecco's Phosphate Buffered Saline (PBS; Gibco® Life Technologies (LTI), Grand Island, NY), resuspended in AIM-V® Medium (AIM-V; LTI), and then incubated in a plastic tissue-culture treated flask (Corning, Tewksbury, MA) for 2 h at 37°C in a 5% CO2 incubator. Non-adherent (PBLs) cells were separated from adherent (monocytes) cells by first swirling the medium in the flask until the non-adherent cells collected together, transferring the supernatant containing the non-adherent cells to a separate container, and then washing the adherent cells twice with PBS to remove remaining non-adherent cells. Non-adherent PBLs were then frozen for later use as effectors in the modified in vitro priming assay. Briefly, freshly isolated PBLs were washed twice with PBS, resuspended in AIM-V medium containing 40% Fetal Bovine Serum (FBS; HyClone® Thermo Fisher Scientific, Logan, UT) and 10% Dimehyl Sulphoxide (DMSO) Hybri-Max® (DMSO; Sigma-Aldrich, St. Louis, MO), frozen in a rate-controlled container to -80°C, and then transferred to liquid nitrogen for storage.
  • Immature DCs were cultured from adherent monocytes in AIM-V containing recombinant human IL-4 (500 U/ml) and GM-CSF (800 U/ml) for 7 days (R&D, Minneapolis, MN), including feedings on days 1, 3, and 5. On day 7, adherent immature DCs were washed with PBS and then harvested using incubation with Versene (EDTA) (Versene; BioWhittaker® Lonza, Walkersville, MD) for 15 min in a 37°C incubator. Mature DCs were cultured AIM-V containing IL-4 (500 U/ml) and GM-CSF (800 U/ml) for 5 days, including feedings on days 1 and 3, followed by the addition of stimulation reagents on day 5 that included TNFα (10 ng/ml; R&D), IL-1β (2 ng/ml; R&D), IL-6 (1,000 U/ml; R&D), and Prostaglandin E2 (PGE2) (1,000 ng/ml; Sigma-Aldrich). On day 7, non-adherent mature DCs were harvested from the supernatant.
  • Purified primary human CD4+ and CD8+ T cells were stimulated by CD3/CD28 beads (Dynabeads® Human T-Expander CD3/CD28 (Invitrogen Dynal, Osol, Norway); immunomagnetic beads to which CD3-specific and CD28-specific monoclonal antibodies had been conjugated) as described (Carpenito, Milone et al. 2009). Briefly, purified CD4+ and CD8+ cells were washed twice in PBS, mixed together at a 1:1 ratio, and then resuspended at a final concentration of 0.6 - 0.8×106 cells/ml in fresh T cell culture medium (RPMI Medium 1640 (RPMI; LTI), containing 10% Human Serum AB (HABS; GemCell™ Gemini Bio-products, West Sacramento, CA), HEPES, GlutaMAX™ (L-glut), Pen Strep, Sodium Pyruvate, MEM non-essential Amino Acids (NEAA), and 2-Mercaptothanol (BME) LTI). Beads were gently mixed extensively, washed three times in PBS, and then combined with T cells at a ratio of 3:1, beads to T cells. The bead-T cell solution was transferred to a tissue culture-treated flask and incubated at 37°C in a 5% CO2 incubator for 3 days, undisturbed. On day 3, fresh T cell culture medium was added to the culture at a volume of ½ the initial culture volume and then incubated for an additional 2 days. On day 5, the magnetic beads were removed from the culture using a DynaMag™ magnet (Invitrogen Dynal) and the cells were then resuspended with T cell culture medium to a concentration of ~0.7 - 0.8 ×106 cells/ml. Starting from Day 6, the culture was fed with fresh T cell culture medium down to a concentration of ~0.7 - 0.8 ×106 cells/ml every other day. T cells were frozen as described above when the culture average cell diameter decreased to ~250 µm3.
  • In vitro transcription
  • CD19 and mesothelin (meso)-targeted CARs with 4-1BB and CD3 signaling domains (19-BBz and ss1-BBz, respectively) have been described previously (Carpenito, Milone et al. 2009, Milone, Fish et al. 2009). The PCR products were subcloned into a pGEM.64A-based vector by replacing GFP from pGEM-GFP.64A (Zhao, Zheng et al. 2006) with restriction-enzyme-digested PCR products with HindIII and NotI (New England Biolabs Inc. (NEB), Ipswich, MA) to produce pGEM-ss1.bbz.64A and pGEM-CD19bbz.64A. Similarly, third-generation versions of the CARs were constructed utilizing the CD28 signaling domain. The replaced CAR cDNAs were confirmed by direct sequencing and linearized by Spe I (NEB) digestion before RNA in vitro transcription. mScript RNA System (Epicentre, Madison, WI) or T7 mScript™ Standard mRNA Production System (CELLSCRIPT, Madison, WI) was utilized to generate capped IVT RNA. The IVT RNA was purified using an RNeasy Mini Kit (Qiagen, Valencia, CA) and purified RNA was eluted in RNase-free water at 1-2mg/ml.
  • RNA electroporation
  • Human T cells were stimulated by CD3/CD28 beads as described above. The stimulated T cells were washed three times with Opti-MEM® I Reduced Serum Medium (OPTI-MEM; LTI) and resuspended in OPTI-MEM at the final concentration of 25x106/ ml before electroporation. Subsequently, the stimulated T cells were mixed with 8-10 µg/0.1 ml T cells of IVT RNA and electroporated for a single pulse at 500 V for 0.7 ms in a 2mm cuvette (Harvard Apparatus BTX, Holliston, MA) using an ECM830 Electro Square Wave Porator (Harvard Apparatus BTX). Electroporated T cells were then cultured overnight in standard T cell culture medium and then stained for respective costimulatory molecule expression by flow cytometry. T cells were co-electroporated with 8 µg of Meso-CAR and 8 µg of RNA encoding each of the costimulatory molecules.
  • Flow cytometry/FACS
  • Cells were stained with commercially available antibodies (BD Biosciences (BD), San Jose, CA; BioLegend, San Diego, CA; dBioscience, Inc., San Diego, CA; Jackson Immunoresearch, West Grove, PA) specific for the indicated markers and analyzed by flow cytometry (FACS). Cells were washed and suspended in FACS buffer (PBS with 1% FBS) containing the indicated Abs, incubated at 4°C for 30 min, and then washed twice with FACS buffer. Tetramer staining was performed using APC-labeled MART-1 (iTAg Tetramer/APC - HLA-A∗0201 Mart-1 (ELAGIGILTV)) or Flu-M1 tetramers (iTAg Tetramer/APC - HLA-A∗0201 Influenza-M1 (GILGFVFTL)) at a 1:40 dilution (MBL International Co., Woburn, MA). Flow cytometry acquisition was performed with a BD LSR II (BD Biosciences), and analysis was performed with FlowJo (Treestar, Ashland, OR).
  • The results are shown in Figures 2, 3, 4B, 5, and 6.
  • Modified in vitro priming assay
  • A modified in vitro T cell priming assay was used to assess the capacity of RNA electroporated T cells to prime naive MART-1 peptide-specific T cells. This assay has been described, in part, previously, and is modified herein (Li, Bleakley et al. 2005, Li and Yee 2008, Kaka, Shaffer et al. 2009, Wolfl, Merker et al. 2011, Ramos, Narala et al. 2013). All donor-derived cells were from normal healthy HLA-A2+ donors. Autologous stimulator cells (DCs or RNA-engineered T cells) and effector/responder cells (thawed PBLs), as acquired and cultured above, were washed three times with PBS before establishment of the coculture priming assay (Figure 4A; Day 0). Stimulator (3.5×105/well) and effector (3.5x106/well) cells were cocultured at a ratio of 1:10 in 6-well plate, in 6 ml/well T cell culture medium containing recombinant human IL-2 (10 U/ml; R&D), IL-21 (30 ng/ml; LTI; IL-21 has been reported to suppress the activity of regulatory T cells that may be present in PBLs), and peptide (0.25 µg/ml). Peptides were either MART-126-35 (ELAGIGILTV (SEQ ID NO: 47)), Flu-M158-66 (GILGFVFTL (SEQ ID NO: 48); positive control) or h-CLIP103-117 (PVSKMRMATPLLMQA (SEQ ID NO: 49); negative control), and were purchased from GenScript USA Inc. (Piscataway, NJ). On days 3, 5, 7, 9 and 11, cocultures were fed by carefully replacing 3 ml of coculture medium (1/2 the total coculture volume per well) with 3 ml fresh T cell culture medium containing recombinant human IL-2 (20 U/ml), IL-21 (60 ng/ml), IL-7 (20 ng/ml; R&D) and IL15 (20 ng/ml; R&D), each at 2X final concentration. On Day 13, induction of peptide-specific T cell responses were assessed by FACS using tetramer staining, as described above.
  • Degranulation assay
  • The CD107a mobilization assay was performed as described (Betts, Brenchley et al. 2003). One hundred microliters of effector and target cells was plated in 96-well round-bottom plates at a ratio of 1:1, 2:1, or 4:1 (1, 2, or 4x105 effectors + 105 targets). Ten microliters of PE-Cy5-labeled anti-CD107a antibody (eBioscience) was added to each cell mixture and incubated at 37°C for 1 hr before adding GolgiStop (BD). After an additional 2.5 hr of incubation, these cells were stained with anti-CD8-APC-Cy7 (BD) and levels of surface CD107 were determined by flow cytometry, as described above.
  • Example 2: Screening of candidate molecules involved in cytotoxic T lymphocyte (CTL) priming for co-delivery with CARs or TCRs into T cells
  • The following studies were performed to demonstrate that the anti-tumor activity of CAR/TCR-expressing T cells can be enhanced by co-delivery of costimulatory molecules, thereby increasing the ability of T cells to function as antigen presenting cells and prime T cells (i.e., T:T priming). As described herein, in addition to CAR T cell-directed tumor cell killing, this allowed T cell-mediated priming of non-engineered tumor-reactive T cells, which can persist as tumor suppressors once CAR expression by adoptive RNA CAR T cells has subsided, creating a transient therapy with permanent anti-tumor effects.
  • Given the many possible immune modulatory genes that can be used to enhance the antigen-presenting cell (APC) function of RNA CAR T cells (e.g., surface-bound molecules that deliver primary and secondary costimulation, are associated with antigen presentation, determine trafficking and migration patterns, are ligands for DC, as well as cytokines that facilitate priming or suppress regulatory T cell (Treg) responses), the present example focused on evaluating genes regulated in dendritic cells (one of the most potent of the professional APCs) (Chen and Flies 2013).
  • Initially, proteins known to function as costimulatory molecules were examined. Immature DCs (iDCs) and mature DCs (mDCs) were cultured and assessed for costimulatory molecule expression (CD252, CD70, CD83, CD80, CD49a, CD40, HLA-ABC, CD86, HLA-DR, CD275, CD154, CD137L, and CD43). As shown in Figure 2, a number of candidate markers were efficiently upregulated in mDCs. In particular, CD252, CD70, CD83, and CD80 showed substantially higher expression in mDCs compared to iDCs. Accordingly, CD252 and CD70 were chosen for further analysis as candidate costimulatory molecules for co-delivery with CARs into T cells. CD86 and CD137l also were included as candidate costimulatory molecules because they have been reported to provide important secondary costimulation signals for T cell priming. Figure 2 is merely an example demonstrating that costimulatory molecules can be dramatically regulated during classical APC-T cell priming.
  • To confirm that the above candidates would be expressed upon electroporation of their mRNAs into T cells, CD70, CD83, CD80 (B7-1), CD86 (B7-2), CD275 (ICOS-L), CD43, CD137L (4-1BBL), CD252 (OX40L), CD58 (LFA-3), CD48, TL1A, CD270 (HVEM), CD40, CD154 (CD40L), CD150 (SLAM), and CD64 were cloned and used as templates for in vitro transcription to produce high quality mRNA. All candidates were highly expressed when their mRNAs were electroporated into T cells (Figure 3), indicating that these candidates could be used to express in T cells for enhancing T cell priming capability.
  • Example 3: Establishment of an in vitro priming system for the identification of candidate costimulatory molecules that promote priming of tumor-specific T cells
  • To test the ability of each candidate costimulatory molecule co-delivered into RNA CAR T cells to enhance priming, a modified in vitro priming system was established. This system was based on published studies describing autologous co-culture assays using DCs and T cells that have been used for in vitro T cell induction (Li, Bleakley et al. 2005, Han and Chang 2009, Ramos, Narala et al. 2013), but modified to include only one round of antigen stimulation, as opposed to up to 3 or 4 as described in previous studies, since detectable CTL responses were observed in multiple donors with one round of stimulation (Figure 4A).
  • To validate the modified system, autologous DCs and PBLs were used as effectors, as described in published studies. The A2+ CD8+ T cell epitope MART-1, which is present at relatively high frequencies in healthy individuals (Pittet, Valmori et al. 1999), was used as the model tumor antigen. Consistent with previous reports with this peptide antigen (Li, Bleakley et al. 2005, Li and Yee 2008, Kaka, Shaffer et al. 2009, Wolfl, Merker et al. 2011, Ramos, Narala et al. 2013), cultured mature DCs (mDCs) in the modified system were capable of priming MART-1+ T cells to an expectedly greater extent than immature DCs (iDCs) (Figure 4B).
  • This result suggests that the newly-developed modified in vitro priming system can be used to test T:T priming and effectively screen a panel of co-delivered RNAs encoding molecules associated with CTL priming.
  • Example 4: Enhanced costimulatory molecule-mediated priming of T cells
  • Using the modified in vitro co-culture priming assay, each of the four candidate costimulatory molecules were tested for the ability to enhance the capacity of T cells to directly prime MART-1+ CTLs. When their RNAs were electroporated into T cells, each costimulatory molecule was capable of enhancing MART-1+ CTL priming, as reflected in the increased number of CD8+MART-1+ T cells relative to controls (no electroporation, h-Clip peptide irrelevant antigen control (h-CLIP103-117 (PVSKMRMATPLLMQA (SEQ ID NO: 50))), and PBL stimulators alone; Figure 5 ).
  • Of the four tested candidate co-stimulatory molecules, CD70 provided the strongest enhancement of T:T-mediated MART-1+ CTL induction, increasing priming by over 10-fold when compared to control cells which were electroporated without RNA. T cells expressing CD86, CD137L, and CD252 were able to enhance priming by 8.5-fold, 3.2-fold, and 3.2-fold, respectively, relative to control cells. These results show that costimulatory molecules, such as the 4 candidates tested, can enhance priming capability.
  • Example 5: Co-delivery of costimulatory molecule with CAR does not affect the expression of either construct
  • An important goal of this co-delivery strategy is that expression of molecules associated with CTL priming does not interfere with, e.g., decrease or inhibit, CAR expression or function. To this end, the effect of costimulatory molecule expression on CAR expression in T cells was first assessed. To test this, an exemplary CAR, Mesothelin-CAR (Meso-CAR), which has been published by our group previously (Zhao, Moon et al. 2010), was introduced into T cells along with each of the four ETP costimulatory molecules , CD70, CD86, CD 137L, and CD252, to assess how the expression of the ETP costimulatory molecules affected the expression of mesothelin-CAR, or vice versa.
    (MALPVTALLLPLALLLHAARPGSQVQLQQSGPELEKPGASVKISCKASGYSFTGYTMN WVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVY FCARGGYDGRGFDYWGQGTTVTVSSGGGGSGGGGSSGGGSDIELTQSPAIMSASPGEK VTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPGRFSGSGSGNSYSLTISSV EAEDDATYYCQQWSKHPLTYGAGTKLEIKASTTTPAPRPPTPAPTIASQPLSLRPEACRP AAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPV QTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVL DKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQ GLSTATKDTYDALHMQALPPR (SEQ ID NO: 51)). Meso-CAR RNA and RNA for each of the four ETP costimulatory molecules were co-delivered into the same T cell and the expression of each on the surface of T cells was assessed the next day ( Figure 5 ).
  • Co-expression of Meso-CAR along with costimulatory molecules did not result in an adverse effect on either the CAR or the costimulatory molecule, e.g., did not result in decreased expression of the CAR or ETP, or inhibition of CAR or ETP expression. These data demonstrate that CARs may be effectively co-expressed with additional molecules, e.g., ETPs, with minimal interference on the surface expression of the CAR.
  • Example 6: Co-expression of costimulatory molecules does not affect CAR-mediated cell killing
  • A key consideration when co-expressing costimulatory molecules to improve the priming ability of CAR T cells is that co-expression has minimal effect on CAR-mediated cell killing, e.g., does not substantially reduce or inhibit CAR-mediated cell killing. Indeed, CAR-mediated tumor cell killing has important downstream effects such as the potential to disrupt the local tumor immunosuppressive environment by destroying tumor cells, releasing tumor antigens, recruiting pro-immune and antigen-presenting cells (APCs), secreting pro-inflammatory cytokines, and promoting inflammation in general. These immunomodulatory events may all work together to facilitate in vivo priming at the tumor site and/or local lymph nodes of non-engineered tumor-specific CD8+ T cells that may recognize tumor antigens not only targeted by the CAR itself, but also others within the same tumor (i.e., epitope spreading).
  • In this example, the CAR-mediated cell killing ability of T cells co-expressing Meso-CAR and ETP costimulatory molecules was assessed to determine whether co-expression of a CAR with costimulatory molecules would negatively affect CAR-mediated cell killing. Meso-CAR expressing T cells that also express costimulatory molecules were incubated with two different mesothelin-expressing tumor lines (K-meso and SKOV3) and one mesothelin-negative line (K562) and evaluated for CD107a exposure in a degranulation assay. The CD107a mobilization assay is widely used to measure the capacity of T cells to kill target cells, which has been directly correlated to their level of degranulation as quantified by the exposure of LAMP 1 protein (CD107a) that normally resides in cytotoxic T cell lytic granules (Betts, Brenchley et al. 2003). Co-expression of CAR and costimulatory molecules did not markedly affect CAR function ( Figure 6 ). Data points for the Meso-CAR alone from another experiment for K-meso and K562 cells were added to the graph, from Zhao, Moon et al., 2010..
  • These results suggest that co-expression of costimulatory molecules with CAR has little impact on CAR function, e.g., does not substantially reduce or inhibit CAR-mediated cell killing ability.
  • Example 7: Effects of different molecules involved in CTL priming, individually and in combination, on RNA CAR T cell priming ability
  • The effects of different candidate molecules involved in pathways associated with CTL priming are tested for the ability to enhance RNA CAR T cell priming of CTLs, as described in the foregoing Examples. Candidate molecules that increase T:T cell priming will also be tested in different combinations for synergistic effects.
  • Example 8: Efficacy of RNA CAR T cells co-expressing molecules involved in CTL priming on eradicating tumor cells
  • The RNA CART cell co-expressing ETPs are tested in other in vitro priming systems. For example, human CAR T cells are cocultured with tumor cells (likely irradiated), in the presence of a pool of non-engineered T cells and possibly DCs. The readout of this assay includes the induction of tumor-specific T cell responses in the pool of non-engineered T cells, which may be the result of cross-priming of released tumor Ags by the CAR T cells engineered to be dual functional Ag presenters.
  • Sequences of some examples of various components of CARs of the instant invention is listed in Table 2, where aa stands for amino acids, and na stands for nucleic acids that encode the corresponding peptide. Table 2. Sequences of various components of CAR (aa - amino acids, na - nucleic acids that encodes the corresponding protein)
    SEQ. ID NO description Sequence
    1 EF-1 promoter
    Figure imgb0010
    2 Leader (aa) MALPVTALLLPLALLLHAARP
    3 Leader (na)
    Figure imgb0011
    4 CD 8 hinge (aa) TTTP APRPPTP APTIASQPLS LRPEACRP AAGGA VHTRGLDFACD
    5 CD8 hinge (na)
    Figure imgb0012
    6 Ig4 hinge (aa)
    Figure imgb0013
    7 Ig4 hinge
    Figure imgb0014
    (na)
    Figure imgb0015
    8 IgD hinge (aa)
    Figure imgb0016
    9 IgD hinge (na)
    Figure imgb0017
    10 GS hinge/linker (aa) GGGGSGGGGS
    11 GS hinge/linker (na) GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC
    12 CD8TM (aa) IYIWAPLAGTCGVLLLSLVITLYC
    13 CD8 TM (na)
    Figure imgb0018
    14 4-1BB intracellular domain (aa) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
    15 4-1BB intracellular domain (na)
    Figure imgb0019
    16 CD27 (aa) QRRKYRSN KG ESPVEP AE PCRYSCPRE EEGSTI PIQE DYRKPEP ACSP
    17 CD27 (na)
    Figure imgb0020
    18 CD3-zeta (aa)
    Figure imgb0021
    19 CD3-zeta (na)
    Figure imgb0022
    20 CD3-zeta (aa)
    Figure imgb0023
    21 CD3-zeta (na)
    Figure imgb0024
    22 linker GGGGS
    23 linker GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC
    24 linker (Gly-Gly-Gly-Ser)n, where n = 1-10
    25 linker (Gly4 Ser)4
    26 linker (Gly4 Ser)3
    27 linker (Gly3Ser)
    28 polyA
    Figure imgb0025
    Figure imgb0026
    29 polyA
    Figure imgb0027
    30 polyA
    Figure imgb0028
    Figure imgb0029
    Figure imgb0030
    31 polyA
    Figure imgb0031
    32 polyA
    Figure imgb0032
    Figure imgb0033
    33 polyA
    Figure imgb0034
    Figure imgb0035
    Figure imgb0036
    34 polyA
    Figure imgb0037
  • EQUIVALENTS
  • While this invention has been disclosed with reference to specific aspects, it is apparent that other aspects and variations of this invention may be devised by others skilled in the art without departing from the scope of the invention as defined by the claims.
  • References

Claims (20)

  1. A T cell comprising exogenous nucleic acid, wherein:
    (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and
    (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
    the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence, and
    the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming,
    wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  2. The T cell of claim 1, wherein the first and second nucleic acid sequences are disposed on a single nucleic acid molecule, or on two or more distinct nucleic acid molecules, wherein the single or two or more distinct nucleic acid molecules are RNA.
  3. The T cell of claim 1 or 2, wherein the CAR further comprises a second intracellular signaling domain.
  4. The T cell of claim 3, wherein the intracellular signaling domain of the CAR comprises a CD3zeta domain and the second intracellular signaling domain comprises a 4-1BB domain.
  5. The T cell of any of claims 1-4, wherein the T cell does not comprise an exogenous DNA encoding the first or second RNA.
  6. The T cell of any of claims 1-5, wherein the first and/or second RNAs:
    i) include nucleotide/nucleoside derivatives or analogs,
    ii) are generated by in vitro transcription,
    iii) are synthetic RNAs, and/or
    iv) are introduced into the T cell by electroporation.
  7. The T cell of any of claims 1-6, wherein the first or second nucleic acid sequences are comprised in a vector, e.g. a viral vector such as a retroviral vector or a lentiviral vector.
  8. The T cell of any of the preceding claims, wherein the extracellular domain of the CAR comprises an antigen-binding domain, optionally wherein the antigen-binding domain is a scFv domain.
  9. The T cell of any one of the preceding claims, wherein:
    i) the transmembrane domain comprises a transmembrane protein of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154;
    ii) the intracellular signaling domain comprises a functional signaling domain of a protein selected from the group consisting of CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3 gamma, CD3 delta, CD3 epsilon, CD79a, CD79b, DAP10, and DAP12, and/or
    iii) the extracellular domain is connected to the transmembrane domain by a hinge region.
  10. The T cell of any one of the preceding claims, wherein the CAR further comprises one or more costimulatory signaling domains, optionally wherein the costimulatory signaling domain is a functional signaling domain from a protein selected from the group consisting of OX40, CD27, CD28, CD30, CD40, PD-1, CD2, CD7, CD258, NKG2C, B7-H3, a ligand that binds to CD83, ICAM-1, LFA-1 (CD1a/CD18), ICOS and 4-1BB (CD137), or any combination thereof.
  11. The T cell of any one of the preceding claims, wherein the extracellular domain of the CAR comprises an antigen-binding domain that binds to an antigen associated with a disease state, optionally wherein the disease state is selected from the group consisting of a proliferative disease, a precancerous condition, a non-cancer indication, a viral infection, and a bacterial infection.
  12. The T cell of claim 11, wherein the antigen-binding domain binds to a tumor antigen, a viral antigen, or a bacterial antigen, optionally wherein the tumor antigen is an antigen associated with a cancer selected from the group consisting of brain cancer, bladder cancer, breast cancer, cervical cancer, colorectal cancer, liver cancer, kidney cancer, lymphoma, leukemia, lung cancer, melanoma, metastatic melanoma, mesothelioma, neuroblastoma, ovarian cancer, prostate cancer, pancreatic cancer, renal cancer, skin cancer, thymoma, sarcoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, uterine cancer, and combinations thereof.
  13. The T cell of any one of the preceding claims, wherein:
    i) the T cell has increased efficacy in killing tumor cells or reducing tumor size in a subject with a tumor relative to a T cell comprising only the first nucleic acid sequence;
    ii) the T cell enhances the priming of T cells with a tumor antigen, a viral antigen, or a bacterial antigen; and/or
    iii) the first and/or second nucleic acid sequences are transcribed from an in vitro transcription vector.
  14. A composition comprising the T cell of any one of the preceding claims and, optionally, further comprising a second therapeutic agent.
  15. A method of generating a T cell having enhanced anti-tumor activity, the method comprising introducing a nucleic acid, wherein:
    (a) the nucleic acid comprises a first nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and
    (b) the nucleic acid comprises a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
    the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming,
    wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  16. The T cell of any one of claims 1-13, for use in a method of:
    i) providing anti-tumor immunity in a subject;
    ii) treating a subject having a disease associated with the expression of a disease-associated antigen;
    iii) enhancing epitope spreading in a subject with cancer; or
    iv) vaccinating a subject,
    wherein the method comprises administering an effective amount of the T cell to the subject, optionally wherein the subject is a human.
  17. The T cell, for use of claim 16, wherein
    (a) the disease of ii) is selected from the group consisting of a proliferative disease, a precancerous condition, a non-cancer related indication, a viral infection, and a bacterial infection; or
    (b) the method of iv) further comprises administering to the subject an antigen, optionally wherein the antigen is a tumor antigen, a viral antigen, or a bacterial antigen.
  18. A T cell engineered to express a chimeric antigen receptor (CAR), for use in the treatment of cancer by CAR-mediated cancer cell killing and enhanced priming of T cells with tumor antigen, wherein the CAR-engineered T cell comprises exogenous nucleic acid comprising:
    (a) a first nucleic acid sequence encoding the CAR, wherein said CAR comprises an extracellular domain, a transmembrane domain, and an intracellular signaling domain, and
    (b) a second nucleic acid sequence encoding a polypeptide which enhances T cell priming, wherein:
    the T cell has enhanced T cell priming ability relative to a T cell which lacks the second nucleic acid sequence, and
    the polypeptide is selected from the group consisting of CD70, CD86, and CD252, and functional fragments and variants of CD70, CD86 and CD252 that retain the ability to enhance T cell priming,
    wherein the first and/or second nucleic acid sequence is an RNA, further wherein said first and/or second RNA is transiently expressed.
  19. The T cell, for use of claim 18, wherein the CAR-engineered T cell has enhanced antigen presentation ability relative to a T cell which lacks the second nucleic acid sequence.
  20. The T cell, for use of claim 18 or 19, wherein the T cell is as defined in any one of claims 2-13.
EP15704414.0A 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules Active EP3097117B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP23193480.3A EP4303229A3 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201461929813P 2014-01-21 2014-01-21
PCT/US2015/012284 WO2015112626A1 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules

Related Child Applications (2)

Application Number Title Priority Date Filing Date
EP23193480.3A Division EP4303229A3 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
EP23193480.3A Division-Into EP4303229A3 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules

Publications (2)

Publication Number Publication Date
EP3097117A1 EP3097117A1 (en) 2016-11-30
EP3097117B1 true EP3097117B1 (en) 2023-10-04

Family

ID=52469911

Family Applications (2)

Application Number Title Priority Date Filing Date
EP15704414.0A Active EP3097117B1 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
EP23193480.3A Pending EP4303229A3 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules

Family Applications After (1)

Application Number Title Priority Date Filing Date
EP23193480.3A Pending EP4303229A3 (en) 2014-01-21 2015-01-21 Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules

Country Status (4)

Country Link
US (3) US11028143B2 (en)
EP (2) EP3097117B1 (en)
ES (1) ES2963718T3 (en)
WO (1) WO2015112626A1 (en)

Families Citing this family (112)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9573988B2 (en) 2013-02-20 2017-02-21 Novartis Ag Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells
LT2958943T (en) 2013-02-20 2020-01-27 The Trustees Of The University Of Pennsylvania CANCER TREATMENT USING HUMANIZED ANTI-EGFRVIII CHIMERY ANTIGEN RECEPTOR
EP2970426B1 (en) 2013-03-15 2019-08-28 Michael C. Milone Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
TWI654206B (en) 2013-03-16 2019-03-21 諾華公司 Treatment of cancer with a humanized anti-CD19 chimeric antigen receptor
CN105209054A (en) 2013-04-18 2015-12-30 阿尔莫生物科技股份有限公司 Methods of treating diseases and conditions using interleukin-10
JP2016528879A (en) 2013-06-17 2016-09-23 アルモ・バイオサイエンシーズ・インコーポレイテッド Methods for assessing protein identity and stability
HK1226308A1 (en) 2013-08-30 2017-09-29 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
US11413332B2 (en) 2013-11-11 2022-08-16 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
CA2931684C (en) 2013-12-19 2024-02-20 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
EP3087101B1 (en) 2013-12-20 2024-06-05 Novartis AG Regulatable chimeric antigen receptor
WO2015112626A1 (en) 2014-01-21 2015-07-30 June Carl H Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
IL322264A (en) 2014-04-07 2025-09-01 Novartis Ag Treatment of cancer using anti-cd19 chimeric antigen receptor
US10293043B2 (en) 2014-06-02 2019-05-21 Armo Biosciences, Inc. Methods of lowering serum cholesterol
MY181834A (en) 2014-07-21 2021-01-08 Novartis Ag Treatment of cancer using humanized anti-bcma chimeric antigen receptor
US9777061B2 (en) 2014-07-21 2017-10-03 Novartis Ag Treatment of cancer using a CD33 chimeric antigen receptor
US11542488B2 (en) 2014-07-21 2023-01-03 Novartis Ag Sortase synthesized chimeric antigen receptors
JP6736540B2 (en) 2014-07-21 2020-08-05 ノバルティス アーゲー Treatment of cancer using CLL-1 chimeric antigen receptor
WO2016026854A2 (en) * 2014-08-18 2016-02-25 Apceth Gmbh & Co. Kg Genetically modified mesenchymal stem cells expressing an immune response-stimulating cytokine to attract and/or activate immune cells
SG11201700770PA (en) 2014-08-19 2017-03-30 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
ES2891332T3 (en) 2014-09-17 2022-01-27 Novartis Ag Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
AU2015330898B2 (en) 2014-10-08 2022-03-10 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof
BR112017007765B1 (en) 2014-10-14 2023-10-03 Halozyme, Inc COMPOSITIONS OF ADENOSINE DEAMINASE-2 (ADA2), VARIANTS THEREOF AND METHODS OF USING THE SAME
JP6675394B2 (en) 2014-10-22 2020-04-01 アルモ・バイオサイエンシーズ・インコーポレイテッド Use of interleukin-10 for the treatment of diseases and disorders
WO2016094783A1 (en) 2014-12-12 2016-06-16 Voyager Therapeutics, Inc. Compositions and methods for the production of scaav
US20190054117A1 (en) * 2014-12-19 2019-02-21 Novartis Ag Dimerization switches and uses thereof
CN107567461A (en) 2014-12-29 2018-01-09 诺华股份有限公司 The method for preparing Chimeric antigen receptor expression cell
US11459390B2 (en) 2015-01-16 2022-10-04 Novartis Ag Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor
US11161907B2 (en) 2015-02-02 2021-11-02 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
MX2017012939A (en) 2015-04-08 2018-05-22 Novartis Ag CD20 THERAPIES, CD22 THERAPIES AND COMBINATION THERAPIES WITH A CELL THAT EXPRESSES AN ANTIGEN (CAR) CHEMICAL RECEIVER OF CD19.
AU2016249005B2 (en) 2015-04-17 2022-06-16 Novartis Ag Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
BR112017024757A2 (en) * 2015-05-18 2018-11-13 TCR2 Therapeutics Inc. compositions and methods for reprogramming tcr using fusion proteins
US20160361415A1 (en) 2015-05-28 2016-12-15 Armo Biosciences, Inc. Methods of Using Interleukin-10 for Treating Diseases and Disorders
TW202444897A (en) 2015-06-25 2024-11-16 美商生物細胞基因治療有限公司 Chimeric antigen receptors (cars), compositions and methods of use thereof
US11173179B2 (en) 2015-06-25 2021-11-16 Icell Gene Therapeutics Llc Chimeric antigen receptor (CAR) targeting multiple antigens, compositions and methods of use thereof
WO2017015427A1 (en) 2015-07-21 2017-01-26 Novartis Ag Methods for improving the efficacy and expansion of immune cells
CN105030825A (en) * 2015-07-27 2015-11-11 深圳爱生再生医学科技有限公司 Vaccine for treating mRNA-DC lung cancer, enhanced preparation method of vaccine and CTL cell
US11667691B2 (en) 2015-08-07 2023-06-06 Novartis Ag Treatment of cancer using chimeric CD3 receptor proteins
JP7053453B2 (en) 2015-08-25 2022-04-12 アルモ・バイオサイエンシーズ・インコーポレイテッド How to use interleukin 10 to treat diseases and disorders
WO2017040324A1 (en) 2015-08-28 2017-03-09 The Trustees Of The University Of Pennsylvania Methods and compositions for cells expressing a chimeric intracellular signaling molecule
CN108348551A (en) * 2015-08-28 2018-07-31 宾夕法尼亚大学董事会 Methods and compositions for cells expressing chimeric intracellular signaling molecules
CN116334205A (en) 2015-09-03 2023-06-27 诺华股份有限公司 Biomarkers predictive of cytokine release syndrome
KR20180053744A (en) * 2015-09-23 2018-05-23 사이토이뮨 테라퓨틱스 엘엘씨 FLT3-induced CAR cells for immunotherapy
CN114231486A (en) 2015-10-30 2022-03-25 儿童国家医疗中心 Generation of HPV antigen-specific T cells from naive T cell populations
MX2018005618A (en) * 2015-11-05 2018-08-01 Juno Therapeutics Inc CHEMICAL RECEPTORS CONTAINING TRAF INDUCTIVE DOMAINS AND RELATED COMPOSITIONS AND METHODS.
CN108699557B (en) 2015-12-04 2025-08-15 诺华股份有限公司 Compositions and methods for immunooncology
PT3393504T (en) 2015-12-22 2025-12-30 Novartis Ag Mesothelin chimeric antigen receptor (CAR) and anti-PD-L1 inhibitor antibody for combined use in anticancer therapy.
MX2018007295A (en) * 2016-01-11 2019-03-28 Armo Biosciences Inc Interleukin-10 in production of antigen-specific cd8+ t cells and methods of use of same.
US20200063157A9 (en) * 2016-02-26 2020-02-27 Poseida Therapeutics, Inc. Transposon system and methods of use
US10563172B2 (en) 2016-03-14 2020-02-18 Wisconsin Alumni Research Foundation Methods of T cell expansion and activation
SG11201808058PA (en) * 2016-03-18 2018-10-30 Nantcell Inc Multimodal vector for dendritic cell infection
US11549099B2 (en) 2016-03-23 2023-01-10 Novartis Ag Cell secreted minibodies and uses thereof
CN107522786A (en) * 2016-06-20 2017-12-29 深圳市体内生物医药科技有限公司 A kind of molecule, the cell for expressing it and its production and use
JP7114490B2 (en) 2016-06-24 2022-08-08 アイセル・ジーン・セラピューティクス・エルエルシー Construction of chimeric antibody receptors (CARs) and methods of their use
WO2018026953A1 (en) 2016-08-02 2018-02-08 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
CA3032838A1 (en) * 2016-08-04 2018-02-08 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
US9642906B2 (en) * 2016-09-16 2017-05-09 Baylor College Of Medicine Generation of HPV-specific T-cells
MX2019003899A (en) * 2016-10-07 2019-08-14 Tcr2 Therapeutics Inc Compositions and methods for t-cell receptors reprogramming using fusion proteins.
WO2018067992A1 (en) 2016-10-07 2018-04-12 Novartis Ag Chimeric antigen receptors for the treatment of cancer
AU2017363311A1 (en) 2016-11-22 2019-06-13 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
JP7685735B2 (en) 2016-12-02 2025-05-30 アンヘレス セラピューティクス インコーポレイテッド Synthetic immunoreceptors and methods of use thereof
CN110121505B (en) 2016-12-28 2023-08-01 株式会社绿十字细胞治疗 Chimeric antigen receptors and natural killer cells expressing them
WO2018132508A1 (en) * 2017-01-10 2018-07-19 The General Hospital Corporation Methods and compositions relating to ex vivo culture and modulation of t cells
EP3574005B1 (en) 2017-01-26 2021-12-15 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
KR20190130608A (en) 2017-03-22 2019-11-22 노파르티스 아게 Compositions and Methods for Immune Oncology
JP2020524512A (en) 2017-06-21 2020-08-20 アイセル・ジーン・セラピューティクス・エルエルシー Compositions of chimeric antibody receptors (CARs) and methods of use thereof
CN110914295B (en) * 2017-06-28 2024-08-09 里珍纳龙药品有限公司 Anti-human papillomavirus (HPV) antigen binding proteins and methods of use thereof
US12496310B2 (en) * 2017-06-30 2025-12-16 Memorial Sloan Kettering Cancer Center Compositions and methods for adoptive cell therapy
CA3068636A1 (en) 2017-06-30 2019-01-03 Memorial Sloan Kettering Cancer Center Compositions and methods for adoptive cell therapy for cancer
CA3068634A1 (en) 2017-06-30 2019-01-03 Memorial Sloan Kettering Cancer Center Compositions and methods for adoptive cell therapy for cancer
BR112019028280A2 (en) * 2017-07-04 2020-07-14 Curevac Ag nucleic acid molecules
CN109423495A (en) * 2017-08-24 2019-03-05 上海恒润达生生物科技有限公司 A kind of pair of targeting Chimeric antigen receptor and application thereof
CN111148533A (en) 2017-09-19 2020-05-12 麻省理工学院 Compositions for chimeric antigen receptor T cell therapy and uses thereof
US11905528B2 (en) * 2017-10-12 2024-02-20 Icell Gene Therapeutics Inc. Compound chimeric antigen receptor (cCAR) targeting multiple antigens, compositions and methods of use thereof
KR20200086278A (en) 2017-10-18 2020-07-16 노파르티스 아게 Compositions and methods for selective proteolysis
US11649294B2 (en) 2017-11-14 2023-05-16 GC Cell Corporation Anti-HER2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same
EP3712178A4 (en) 2017-11-14 2021-08-11 Green Cross Lab Cell Corporation ANTI-HER2 ANTIBODIES OR ANTIGEN BINDING FRAGMENT OF THE SAME, AND CHEMERICAL ANTIGENIC RECEPTOR INCLUDING IT
CN112218651A (en) 2018-01-08 2021-01-12 诺华公司 Immunopotentiating RNA for combination with chimeric antigen receptor therapy
US12410234B2 (en) 2018-04-26 2025-09-09 The Trustees Of The University Of Pennsylvania Compositions and methods for retrieving tumor-related antibodies and antigens
AU2019284911B2 (en) 2018-06-13 2026-04-09 Novartis Ag BCMA chimeric antigen receptors and uses thereof
CN110615842B (en) * 2018-06-20 2023-05-09 上海隆耀生物科技有限公司 Chimeric antigen receptor containing co-stimulatory receptor and application thereof
SG11202101204TA (en) * 2018-08-09 2021-03-30 Juno Therapeutics Inc Processes for generating engineered cells and compositions thereof
US11866494B2 (en) * 2018-08-31 2024-01-09 Innovative Cellular Therapeutics Holdings, Ltd. CAR T therapy through uses of co-stimulation
US20220119476A1 (en) * 2018-08-31 2022-04-21 The Trustees Of The University Of Pennsylvania Activation of Antigen Presenting Cells and Methods for Using the Same
AU2019346335B2 (en) 2018-09-28 2024-07-25 Massachusetts Institute Of Technology Collagen-localized immunomodulatory molecules and methods thereof
US20230053449A1 (en) 2018-10-31 2023-02-23 Novartis Ag Dc-sign antibody drug conjugates
CA3118889A1 (en) * 2018-11-07 2020-05-14 Sotio, LLC Anti-gpc3 chimeric antigen receptors (cars) in combination with trans co-stimulatory molecules and therapeutic uses thereof
JP7585228B2 (en) * 2019-04-04 2024-11-18 上海医薬集団股▲フン▼有限公司 Immune cells with tumor antigen-recognizing receptors and their applications
US11642409B2 (en) 2019-06-26 2023-05-09 Massachusetts Insttute of Technology Immunomodulatory fusion protein-metal hydroxide complexes and methods thereof
JP7521815B2 (en) * 2019-08-01 2024-07-24 国立大学法人三重大学 Antigen Receptor
WO2021061648A1 (en) 2019-09-23 2021-04-01 Massachusetts Institute Of Technology Methods and compositions for stimulation of endogenous t cell responses
EP4065158A2 (en) 2019-11-26 2022-10-05 Novartis AG Chimeric antigen receptors binding bcma and cd19 and uses thereof
KR20220104217A (en) 2019-11-26 2022-07-26 노파르티스 아게 CD19 and CD22 chimeric antigen receptors and uses thereof
CN110872577B (en) * 2020-01-20 2020-05-08 中国科学院动物研究所 Modified immune cells and their applications
WO2021207171A1 (en) * 2020-04-06 2021-10-14 St. Jude Children's Research Hospital, Inc. B7-h3 chimeric antigen receptors
US12365871B2 (en) 2020-04-28 2025-07-22 Lyell Immunopharma, Inc. Methods for culturing cells
WO2021221783A1 (en) 2020-05-01 2021-11-04 Massachusetts Institute Of Technology Methods for identifying chimeric antigen receptor-targeting ligands and uses thereof
WO2021221782A1 (en) 2020-05-01 2021-11-04 Massachusetts Institute Of Technology Chimeric antigen receptor-targeting ligands and uses thereof
KR20230042691A (en) 2020-06-04 2023-03-29 카리스마 테라퓨틱스 인코포레이티드 Novel constructs for chimeric antigen receptors
CN113754778A (en) * 2020-06-05 2021-12-07 上海交通大学 Chimeric antigen receptor targeting CLDN18.2 and uses thereof
CA3189671A1 (en) * 2020-07-17 2022-01-20 Instil Bio (Uk) Limited Receptors providing targeted costimulation for adoptive cell therapy
JP2023536627A (en) 2020-08-05 2023-08-28 ドラゴンフライ セラピューティクス, インコーポレイテッド Antibodies targeting EGFR and uses thereof
TW202237827A (en) 2020-12-03 2022-10-01 美商世紀治療股份有限公司 Genetically engineered cells and uses thereof
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
JP2024500847A (en) 2020-12-18 2024-01-10 センチュリー セラピューティクス,インコーポレイテッド Chimeric antigen receptor systems with compatible receptor specificities
US11945876B2 (en) 2021-06-16 2024-04-02 Instil Bio (Uk) Limited Receptors providing targeted costimulation for adoptive cell therapy
WO2023288278A1 (en) 2021-07-16 2023-01-19 Instil Bio (Uk) Limited Chimeric molecules providing targeted costimulation for adoptive cell therapy
US20260083848A1 (en) 2021-11-03 2026-03-26 Viracta Therapeutics, Inc. Combination of car t-cell therapy with btk inhibitors and methods of use thereof
US20230220106A1 (en) 2021-12-08 2023-07-13 Dragonfly Therapeutics, Inc. Antibodies targeting 5t4 and uses thereof
WO2024086827A2 (en) 2022-10-20 2024-04-25 Repertoire Immune Medicines, Inc. Cd8 t cell targeted il2
WO2024229196A2 (en) * 2023-05-02 2024-11-07 The Trustees Of Dartmouth College Cd44 costimulatory domain containing chimeric antigen receptors for treatment of neurodegenerative diseases and disorders
WO2025224684A1 (en) * 2024-04-24 2025-10-30 BioNTech SE Compositions and methods for producing engineered immune cells

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008121420A1 (en) * 2007-03-30 2008-10-09 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes
WO2013126712A1 (en) * 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer

Family Cites Families (221)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR901228A (en) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Ring gap magnet system
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5906936A (en) 1988-05-04 1999-05-25 Yeda Research And Development Co. Ltd. Endowing lymphocytes with antibody specificity
US6303121B1 (en) 1992-07-30 2001-10-16 Advanced Research And Technology Method of using human receptor protein 4-1BB
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
GB8928874D0 (en) 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
US6319494B1 (en) 1990-12-14 2001-11-20 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
ATE145428T1 (en) 1990-12-14 1996-12-15 Cell Genesys Inc CHIMERIC CHAINS FOR TRANSDUCTION OF RECEPTOR-CONNECTED SIGNALING PATHWAYS
US7049136B2 (en) 1991-03-07 2006-05-23 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
US6004811A (en) 1991-03-07 1999-12-21 The Massachussetts General Hospital Redirection of cellular immunity by protein tyrosine kinase chimeras
IL101147A (en) 1991-03-07 2004-06-20 Gen Hospital Corp Redirection of cellular immunity by receptor chimeras
DE69233482T2 (en) 1991-05-17 2006-01-12 Merck & Co., Inc. Method for reducing the immunogenicity of antibody variable domains
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
ATE255131T1 (en) 1991-06-14 2003-12-15 Genentech Inc HUMANIZED HEREGULIN ANTIBODIES
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
GB9125768D0 (en) 1991-12-04 1992-02-05 Hale Geoffrey Therapeutic method
JP4157160B2 (en) 1991-12-13 2008-09-24 ゾーマ テクノロジー リミテッド Methods for the preparation of modified antibody variable regions
GB9203459D0 (en) 1992-02-19 1992-04-08 Scotgen Ltd Antibodies with germ-line variable regions
IL104570A0 (en) 1992-03-18 1993-05-13 Yeda Res & Dev Chimeric genes and cells transformed therewith
US8211422B2 (en) 1992-03-18 2012-07-03 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric receptor genes and cells transformed therewith
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5993434A (en) 1993-04-01 1999-11-30 Genetronics, Inc. Method of treatment using electroporation mediated delivery of drugs and genes
US7211259B1 (en) 1993-05-07 2007-05-01 Immunex Corporation 4-1BB polypeptides and DNA encoding 4-1BB polypeptides
KR100373813B1 (en) 1994-05-02 2003-10-08 베른트 그로너 Bifunctional protein, its manufacture and use
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US5712149A (en) 1995-02-03 1998-01-27 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
US6103521A (en) 1995-02-06 2000-08-15 Cell Genesys, Inc. Multispecific chimeric receptors
JP4170390B2 (en) 1995-02-24 2008-10-22 ザ ジェネラル ホスピタル コーポレーション Redirection of cellular immunity by receptor chimeras
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6111095A (en) 1995-06-07 2000-08-29 Merck & Co., Inc. Capped synthetic RNA, analogs, and aptamers
GB9526131D0 (en) 1995-12-21 1996-02-21 Celltech Therapeutics Ltd Recombinant chimeric receptors
US5874240A (en) 1996-03-15 1999-02-23 Human Genome Sciences, Inc. Human 4-1BB receptor splicing variant
AU744160B2 (en) 1996-10-25 2002-02-14 Cell Genesys, Inc. Targeted cytolysis of cancer cells
US6261281B1 (en) 1997-04-03 2001-07-17 Electrofect As Method for genetic immunization and introduction of molecules into skeletal muscle and immune cells
JP3614866B2 (en) 1997-06-12 2005-01-26 リサーチ コーポレイション テクノロジーズ,インコーポレイティド Artificial antibody polypeptide
US20030060444A1 (en) 1997-06-25 2003-03-27 Celltech Therapeutics, Ltd. Cell activation process and reagents therefor
GB9713473D0 (en) 1997-06-25 1997-09-03 Celltech Therapeutics Ltd Biological products
US6241701B1 (en) 1997-08-01 2001-06-05 Genetronics, Inc. Apparatus for electroporation mediated delivery of drugs and genes
US6055453A (en) 1997-08-01 2000-04-25 Genetronics, Inc. Apparatus for addressing needle array electrodes for electroporation therapy
GB9809658D0 (en) 1998-05-06 1998-07-01 Celltech Therapeutics Ltd Biological products
US6678556B1 (en) 1998-07-13 2004-01-13 Genetronics, Inc. Electrical field therapy with reduced histopathological change in muscle
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
AU2472400A (en) 1998-10-20 2000-05-08 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
AU4418900A (en) 1999-04-16 2000-11-02 Celltech Therapeutics Limited Synthetic transmembrane components
US7171264B1 (en) 1999-05-10 2007-01-30 Genetronics, Inc. Intradermal delivery of active agents by needle-free injection and electroporation
EP1235842A4 (en) 1999-10-15 2003-04-23 Univ Massachusetts GENESIS OF THE RNA INTERFERENCE PATH AS AID OF TARGETED GENTIAN INTERFERENCE
GB9925848D0 (en) 1999-11-01 1999-12-29 Celltech Therapeutics Ltd Biological products
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
BR0108545A (en) 2000-02-24 2004-06-29 Xcyte Therapies Inc Simultaneous cell stimulation and concentration
CA2401327C (en) 2000-03-03 2014-05-06 Valentis, Inc. Nucleic acid formulations comprising poly-amino acids for gene delivery and methods of use
IL136511A0 (en) 2000-06-01 2001-06-14 Gavish Galilee Bio Appl Ltd Genetically engineered mhc molecules
AU2001275474A1 (en) 2000-06-12 2001-12-24 Akkadix Corporation Materials and methods for the control of nematodes
GB0025307D0 (en) 2000-10-16 2000-11-29 Celltech Chiroscience Ltd Biological products
AU2001297703B2 (en) 2000-11-07 2006-10-19 City Of Hope CD19-specific redirected immune cells
CN1294148C (en) 2001-04-11 2007-01-10 中国科学院遗传与发育生物学研究所 Single-stranded cyctic trispecific antibody
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7514537B2 (en) 2001-04-30 2009-04-07 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US20090257994A1 (en) 2001-04-30 2009-10-15 City Of Hope Chimeric immunoreceptor useful in treating human cancers
CA2445746C (en) 2001-04-30 2012-09-18 City Of Hope Chimeric immunoreceptor useful in treating human cancers
US20030148982A1 (en) 2001-11-13 2003-08-07 Brenner Malcolm K. Bi-spcific chimeric T cells
US7745140B2 (en) 2002-01-03 2010-06-29 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US7638326B2 (en) 2002-01-03 2009-12-29 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform
AU2003202908A1 (en) 2002-01-03 2003-07-24 The Trustees Of The University Of Pennsylvania Activation and expansion of t-cells using an engineered multivalent signaling platform
US8209006B2 (en) 2002-03-07 2012-06-26 Vgx Pharmaceuticals, Inc. Constant current electroporation device and methods of use
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US20040014645A1 (en) 2002-05-28 2004-01-22 Advisys, Inc. Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system
US7328064B2 (en) 2002-07-04 2008-02-05 Inovio As Electroporation device and injection apparatus
US20050070841A1 (en) 2002-07-04 2005-03-31 Inovio As Electroporation device and injection apparatus
US20050129671A1 (en) 2003-03-11 2005-06-16 City Of Hope Mammalian antigen-presenting T cells and bi-specific T cells
EP1638510B1 (en) 2003-07-01 2015-09-02 Immunomedics, Inc. Multivalent carriers of bi-specific antibodies
US20050048617A1 (en) 2003-08-18 2005-03-03 Medimmune, Inc. Humanization of antibodies
WO2005019429A2 (en) 2003-08-22 2005-03-03 Potentia Pharmaceuticals, Inc. Compositions and methods for enhancing phagocytosis or phagocyte activity
JP2007528723A (en) 2003-08-22 2007-10-18 メディミューン,インコーポレーテッド Antibody humanization
US20050113564A1 (en) 2003-11-05 2005-05-26 St. Jude Children's Research Hospital Chimeric receptors with 4-1BB stimulatory signaling domain
US7435596B2 (en) 2004-11-04 2008-10-14 St. Jude Children's Research Hospital, Inc. Modified cell line and method for expansion of NK cell
CA2568344C (en) 2004-05-27 2016-01-19 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
WO2006020258A2 (en) 2004-07-17 2006-02-23 Imclone Systems Incorporated Novel tetravalent bispecific antibody
US7994298B2 (en) 2004-09-24 2011-08-09 Trustees Of Dartmouth College Chimeric NK receptor and methods for treating cancer
EP3530321A1 (en) 2004-12-10 2019-08-28 Peter MacCallum Cancer Institute Methods and compositions for adoptive immunotherapy
US7684815B2 (en) 2005-04-21 2010-03-23 Microsoft Corporation Implicit group formation around feed content for mobile devices
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
JP5364870B2 (en) 2005-08-19 2013-12-11 アッヴィ・インコーポレイテッド Dual variable domain immunoglobulins and uses thereof
WO2007031081A2 (en) 2005-09-15 2007-03-22 Santaris Pharma A/S RNA ANTAGONIST COMPOUNDS FOR THE INHIBITION OF APO-Bl00 EXPRESSION
EP1957642A2 (en) 2005-12-07 2008-08-20 Genetronics, Inc. Variable volume electroporation chamber and methods therefore
WO2008045437A2 (en) 2006-10-09 2008-04-17 The General Hospital Corporation Chimeric t-cell receptors and t-cells targeting egfrviii on tumors
US20080131415A1 (en) 2006-11-30 2008-06-05 Riddell Stanley R Adoptive transfer of cd8 + t cell clones derived from central memory cells
WO2009097140A1 (en) 2008-01-30 2009-08-06 Memorial Sloan-Kettering Cancer Center Methods for off -the -shelf tumor immunotherapy using allogeneic t-cell precursors
US8379824B2 (en) 2008-03-06 2013-02-19 At&T Intellectual Property I, Lp Methods and apparatus to provide a network-based caller identification service in a voice over internet protocol network
US8822647B2 (en) 2008-08-26 2014-09-02 City Of Hope Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells
EP2326656B1 (en) 2008-09-06 2017-01-25 Chemgenes Corporation Rna synthesis - phosphoramidites for synthetic rna in the reverse direction, and application in convenient introduction of ligands, chromophores and modifications of synthetic rna at the 3' - end
EP2389443B1 (en) 2009-01-23 2018-11-14 Roger Williams Hospital Retroviral vectors encoding multiple highly homologous non-viral polypeptides and the use of same
US8242248B2 (en) 2009-03-23 2012-08-14 Nodality, Inc. Kits for multiparametric phospho analysis
US8465743B2 (en) 2009-10-01 2013-06-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer
WO2011059836A2 (en) 2009-10-29 2011-05-19 Trustees Of Dartmouth College T cell receptor-deficient t cell compositions
EP2531216B1 (en) 2010-02-04 2019-03-27 The Trustees Of The University Of Pennsylvania Icos critically regulates the expansion and function of inflammatory human th17 cells
NZ723974A (en) 2010-10-27 2017-03-31 Baylor College Medicine Chimeric cd27 receptors for redirecting t cells to cd70-positive malignancies
PH12013501201A1 (en) * 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
EP3693017A1 (en) 2010-12-14 2020-08-12 University of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer
US9402865B2 (en) * 2011-01-18 2016-08-02 The Trustees Of The University Of Pennsylvania Compositions and methods for treating cancer
WO2012127464A2 (en) 2011-03-23 2012-09-27 Gavish-Galilee Bio Applications Ltd Constitutively activated t cells for use in adoptive cell therapy
US9987308B2 (en) 2011-03-23 2018-06-05 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
AU2012236068A1 (en) 2011-04-01 2013-10-17 Eureka Therapeutics, Inc. T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2
TR201815488T4 (en) 2011-04-08 2018-11-21 Health Use of anti-epidermal growth factor receptor variant III for chimeric antigen receptors and cancer treatment.
CA2832569A1 (en) 2011-04-08 2012-10-11 Baylor College Of Medicine Reversing the effects of the tumor microenvironment using chimeric cytokine receptors
US20130071414A1 (en) 2011-04-27 2013-03-21 Gianpietro Dotti Engineered cd19-specific t lymphocytes that coexpress il-15 and an inducible caspase-9 based suicide gene for the treatment of b-cell malignancies
AU2012286994B2 (en) 2011-07-25 2017-08-10 Nationwide Children's Hospital, Inc. Recombinant virus products and methods for inhibition of expression of DUX4
PH12014500247A1 (en) 2011-07-29 2014-03-24 Univ Pennsylvania Switch costimulatory receptors
US9833476B2 (en) 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
US10421960B2 (en) 2011-09-16 2019-09-24 The Trustees Of The University Of Pennsylvania RNA engineered T cells for the treatment of cancer
EP2755487B1 (en) 2011-09-16 2018-12-19 Baylor College Of Medicine Targeting the tumor microenvironment using manipulated nkt cells
IN2014CN02906A (en) 2011-10-20 2015-07-03 Us Health
US9272002B2 (en) * 2011-10-28 2016-03-01 The Trustees Of The University Of Pennsylvania Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting
US9422351B2 (en) * 2011-11-03 2016-08-23 The Trustees Of The University Of Pennsylvania Isolated B7-H4 specific compositions and methods of use thereof
SG11201404769UA (en) * 2012-02-22 2014-11-27 Univ Pennsylvania Use of icos-based cars to enhance antitumor activity and car persistence
SG11201404284SA (en) 2012-02-22 2014-10-30 Univ Pennsylvania Use of the cd2 signaling domain in second-generation chimeric antigen receptors
CN112375846A (en) 2012-07-13 2021-02-19 宾夕法尼亚大学董事会 Methods of assessing suitability of transduced T cells for administration
AU2013289971A1 (en) * 2012-07-13 2015-01-22 The Trustees Of The University Of Pennsylvania Enhancing activity of CAR T cells by co-introducing a bispecific antibody
US20160235787A1 (en) 2012-07-13 2016-08-18 The Trustees Of The University Of Pennsylvania Epitope Spreading Associated with CAR T-Cells
LT3338794T (en) 2012-07-13 2020-05-25 The Trustees Of The University Of Pennsylvania ADJUSTMENT OF CAR ANTICODIC TOXICITY
WO2014011987A1 (en) 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Compositions and methods for regulating car t cells
US20150290244A1 (en) 2012-07-13 2015-10-15 The Trustees Of The University Of Pennsylvania Use of cart19 to deplete normal b cells to induce tolerance
PL3824905T3 (en) 2012-08-20 2025-05-05 Fred Hutchinson Cancer Center Method and compositions for cellular immunotherapy
US9937205B2 (en) * 2012-09-04 2018-04-10 The Trustees Of The University Of Pennsylvania Inhibition of diacylglycerol kinase to augment adoptive T cell transfer
AR092745A1 (en) 2012-10-01 2015-04-29 Univ Pennsylvania COMPOSITIONS THAT INCLUDE AN ANTI-FAP UNION DOMAIN AND METHODS TO MAKE WHITE IN STROMAL CELLS FOR THE TREATMENT OF CANCER
WO2014055657A1 (en) * 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Use of a trans-signaling approach in chimeric antigen receptors
WO2014055771A1 (en) * 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Human alpha-folate receptor chimeric antigen receptor
US9573988B2 (en) 2013-02-20 2017-02-21 Novartis Ag Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells
LT2958943T (en) 2013-02-20 2020-01-27 The Trustees Of The University Of Pennsylvania CANCER TREATMENT USING HUMANIZED ANTI-EGFRVIII CHIMERY ANTIGEN RECEPTOR
US9446105B2 (en) * 2013-03-15 2016-09-20 The Trustees Of The University Of Pennsylvania Chimeric antigen receptor specific for folate receptor β
EP2970426B1 (en) 2013-03-15 2019-08-28 Michael C. Milone Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
TWI654206B (en) 2013-03-16 2019-03-21 諾華公司 Treatment of cancer with a humanized anti-CD19 chimeric antigen receptor
EP3974520A1 (en) * 2013-05-14 2022-03-30 Board of Regents, The University of Texas System Human application of engineered chimeric antigen receptor (car) t-cells
CA2931684C (en) 2013-12-19 2024-02-20 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
EP3087101B1 (en) 2013-12-20 2024-06-05 Novartis AG Regulatable chimeric antigen receptor
WO2015112626A1 (en) 2014-01-21 2015-07-30 June Carl H Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
EP3593812A3 (en) 2014-03-15 2020-05-27 Novartis AG Treatment of cancer using chimeric antigen receptor
US20170081411A1 (en) 2014-03-15 2017-03-23 Novartis Ag Regulatable chimeric antigen receptor
IL322264A (en) 2014-04-07 2025-09-01 Novartis Ag Treatment of cancer using anti-cd19 chimeric antigen receptor
MY181834A (en) 2014-07-21 2021-01-08 Novartis Ag Treatment of cancer using humanized anti-bcma chimeric antigen receptor
US9777061B2 (en) 2014-07-21 2017-10-03 Novartis Ag Treatment of cancer using a CD33 chimeric antigen receptor
WO2016014530A1 (en) 2014-07-21 2016-01-28 Novartis Ag Combinations of low, immune enhancing. doses of mtor inhibitors and cars
WO2016014501A1 (en) 2014-07-21 2016-01-28 Novartis Ag Sortase molecules and uses thereof
US11542488B2 (en) 2014-07-21 2023-01-03 Novartis Ag Sortase synthesized chimeric antigen receptors
US20170274014A1 (en) 2014-07-21 2017-09-28 Jennifer Brogdon Combinations of low, immune enhancing, doses of mtor inhibitors and cars
JP6736540B2 (en) 2014-07-21 2020-08-05 ノバルティス アーゲー Treatment of cancer using CLL-1 chimeric antigen receptor
US20170209492A1 (en) 2014-07-31 2017-07-27 Novartis Ag Subset-optimized chimeric antigen receptor-containing t-cells
WO2016025880A1 (en) 2014-08-14 2016-02-18 Novartis Ag Treatment of cancer using gfr alpha-4 chimeric antigen receptor
SG11201700770PA (en) 2014-08-19 2017-03-30 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
ES2891332T3 (en) 2014-09-17 2022-01-27 Novartis Ag Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
AU2015330898B2 (en) 2014-10-08 2022-03-10 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof
WO2016061368A1 (en) 2014-10-15 2016-04-21 The Children's Hospital Of Philadelphia Compositions and methods for treating b-lymphoid malignancies
CN107567461A (en) 2014-12-29 2018-01-09 诺华股份有限公司 The method for preparing Chimeric antigen receptor expression cell
US11459390B2 (en) 2015-01-16 2022-10-04 Novartis Ag Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor
US11161907B2 (en) 2015-02-02 2021-11-02 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
EP3280795B1 (en) 2015-04-07 2021-03-24 Novartis AG Combination of chimeric antigen receptor therapy and amino pyrimidine derivatives
MX2017012939A (en) 2015-04-08 2018-05-22 Novartis Ag CD20 THERAPIES, CD22 THERAPIES AND COMBINATION THERAPIES WITH A CELL THAT EXPRESSES AN ANTIGEN (CAR) CHEMICAL RECEIVER OF CD19.
AU2016249005B2 (en) 2015-04-17 2022-06-16 Novartis Ag Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
WO2017015427A1 (en) 2015-07-21 2017-01-26 Novartis Ag Methods for improving the efficacy and expansion of immune cells
US11667691B2 (en) 2015-08-07 2023-06-06 Novartis Ag Treatment of cancer using chimeric CD3 receptor proteins
CN116334205A (en) 2015-09-03 2023-06-27 诺华股份有限公司 Biomarkers predictive of cytokine release syndrome
HK1250517A1 (en) 2015-09-17 2018-12-21 Novartis Ag Car t cell therapies with enhanced efficacy
PT3393504T (en) 2015-12-22 2025-12-30 Novartis Ag Mesothelin chimeric antigen receptor (CAR) and anti-PD-L1 inhibitor antibody for combined use in anticancer therapy.
CA3009852A1 (en) 2015-12-28 2017-07-06 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
BR112018013074A2 (en) 2015-12-30 2018-12-11 Novartis Ag immune effector cell therapies with enhanced efficacy
CA3016287A1 (en) 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
US11549099B2 (en) 2016-03-23 2023-01-10 Novartis Ag Cell secreted minibodies and uses thereof
EP3443096B1 (en) 2016-04-15 2023-03-01 Novartis AG Compositions and methods for selective expression of chimeric antigen receptors
US20210177896A1 (en) 2016-06-02 2021-06-17 Novartis Ag Therapeutic regimens for chimeric antigen receptor (car)- expressing cells
SG11201900344YA (en) 2016-07-15 2019-02-27 Novartis Ag Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
CN110214150A (en) 2016-07-28 2019-09-06 诺华股份有限公司 Combination therapy of chimeric antigen receptor and PD-1 inhibitor
EP3490590A2 (en) 2016-08-01 2019-06-05 Novartis AG Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule
US20190298715A1 (en) 2016-09-30 2019-10-03 Novartis Ag Immune effector cell therapies with enhanced efficacy
WO2018067992A1 (en) 2016-10-07 2018-04-12 Novartis Ag Chimeric antigen receptors for the treatment of cancer
EP3574005B1 (en) 2017-01-26 2021-12-15 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
JP2020506700A (en) 2017-01-31 2020-03-05 ノバルティス アーゲー Cancer treatment using multispecific chimeric T cell receptor protein
US20200048359A1 (en) 2017-02-28 2020-02-13 Novartis Ag Shp inhibitor compositions and uses for chimeric antigen receptor therapy
CA3057306A1 (en) 2017-03-22 2018-09-27 Novartis Ag Biomarkers and car t cell therapies with enhanced efficacy
US20200179511A1 (en) 2017-04-28 2020-06-11 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
US20200055948A1 (en) 2017-04-28 2020-02-20 Novartis Ag Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
KR20200086278A (en) 2017-10-18 2020-07-16 노파르티스 아게 Compositions and methods for selective proteolysis
WO2019084288A1 (en) 2017-10-25 2019-05-02 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
SG11202004512XA (en) 2017-11-15 2020-06-29 Novartis Ag Bcma-targeting chimeric antigen receptor, cd19-targeting chimeric antigen receptor, and combination therapies
WO2019108900A1 (en) 2017-11-30 2019-06-06 Novartis Ag Bcma-targeting chimeric antigen receptor, and uses thereof
CN112218651A (en) 2018-01-08 2021-01-12 诺华公司 Immunopotentiating RNA for combination with chimeric antigen receptor therapy
WO2019160956A1 (en) 2018-02-13 2019-08-22 Novartis Ag Chimeric antigen receptor therapy in combination with il-15r and il15
US20200061113A1 (en) 2018-04-12 2020-02-27 Novartis Ag Chimeric antigen receptor therapy characterization assays and uses thereof
EP3784351A1 (en) 2018-04-27 2021-03-03 Novartis AG Car t cell therapies with enhanced efficacy
EP3788369A1 (en) 2018-05-01 2021-03-10 Novartis Ag Biomarkers for evaluating car-t cells to predict clinical outcome
US20200085869A1 (en) 2018-05-16 2020-03-19 Novartis Ag Therapeutic regimens for chimeric antigen receptor therapies
WO2019227003A1 (en) 2018-05-25 2019-11-28 Novartis Ag Combination therapy with chimeric antigen receptor (car) therapies
AU2019284911B2 (en) 2018-06-13 2026-04-09 Novartis Ag BCMA chimeric antigen receptors and uses thereof
WO2020047449A2 (en) 2018-08-31 2020-03-05 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
US20210347851A1 (en) 2018-09-28 2021-11-11 Novartis Ag Cd19 chimeric antigen receptor (car) and cd22 car combination therapies
WO2020069405A1 (en) 2018-09-28 2020-04-02 Novartis Ag Cd22 chimeric antigen receptor (car) therapies
AU2020229806A1 (en) 2019-02-25 2021-07-29 Novartis Ag Mesoporous silica particles compositions for viral delivery
US20230074800A1 (en) 2019-03-21 2023-03-09 Novartis Ag Car-t cell therapies with enhanced efficacy
US20220168389A1 (en) 2019-04-12 2022-06-02 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
EP3959320A1 (en) 2019-04-24 2022-03-02 Novartis AG Compositions and methods for selective protein degradation
EP4065158A2 (en) 2019-11-26 2022-10-05 Novartis AG Chimeric antigen receptors binding bcma and cd19 and uses thereof
KR20220104217A (en) 2019-11-26 2022-07-26 노파르티스 아게 CD19 and CD22 chimeric antigen receptors and uses thereof
WO2021163618A1 (en) 2020-02-14 2021-08-19 Novartis Ag Method of predicting response to chimeric antigen receptor therapy
MX2022010685A (en) 2020-02-27 2022-09-23 Novartis Ag Methods of making chimeric antigen receptor-expressing cells.
CN115175695A (en) 2020-02-27 2022-10-11 诺华股份有限公司 Method for producing cells expressing chimeric antigen receptor
CN116096862A (en) 2020-06-11 2023-05-09 诺华股份有限公司 ZBTB32 inhibitors and uses thereof
TW202227124A (en) 2020-08-21 2022-07-16 瑞士商諾華公司 Compositions and methods for in vivo generation of car expressing cells
MX2023005609A (en) 2020-11-13 2023-05-29 Novartis Ag Combination therapies with chimeric antigen receptor (car)-expressing cells.

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008121420A1 (en) * 2007-03-30 2008-10-09 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes
WO2013126712A1 (en) * 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer

Also Published As

Publication number Publication date
US11028143B2 (en) 2021-06-08
EP4303229A3 (en) 2024-04-17
WO2015112626A1 (en) 2015-07-30
ES2963718T3 (en) 2024-04-01
WO2015112626A8 (en) 2015-10-01
EP3097117A1 (en) 2016-11-30
US12162922B2 (en) 2024-12-10
US20160340406A1 (en) 2016-11-24
US20250296977A1 (en) 2025-09-25
US20210317183A1 (en) 2021-10-14
WO2015112626A9 (en) 2016-10-13
EP4303229A2 (en) 2024-01-10

Similar Documents

Publication Publication Date Title
US12162922B2 (en) Enhanced antigen presenting ability of RNA car T cells by co-introduction of costimulatory molecules
US12350334B2 (en) Compositions and methods for generating a persisting population of T cells useful for the treatment of cancer
US11919946B2 (en) Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
TWI790213B (en) Compositions and methods for tcr reprogramming using fusion proteins
CN114656569B (en) Multispecific chimeric receptor comprising NKG2D domains and methods of use thereof
JP2024167266A (en) Method for producing cells expressing chimeric antigen receptor
EP2872526B1 (en) Enhancing activity of car t cells by co-introducing a bispecific antibody
JP2015509716A (en) Use of CD2 signaling domains in second generation chimeric antigen receptors
CN106535925A (en) CAR based immunotherapy
WO2021035170A1 (en) Compositions and methods for tcr reprogramming using fusion proteins
US12624085B2 (en) Compositions and methods of NKG2D chimeric antigen receptor T cells for controlling triple-negative breast cancer
WO2023091420A2 (en) Compositions and methods for t cell engineering
HK40004389A (en) Compositions and methods for tcr reprogramming using fusion proteins

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20160805

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20171011

RAP3 Party data changed (applicant data changed or rights of an application transferred)

Owner name: THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA

Owner name: NOVARTIS AG

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: GRANT OF PATENT IS INTENDED

INTG Intention to grant announced

Effective date: 20230417

GRAS Grant fee paid

Free format text: ORIGINAL CODE: EPIDOSNIGR3

GRAA (expected) grant

Free format text: ORIGINAL CODE: 0009210

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE PATENT HAS BEEN GRANTED

P01 Opt-out of the competence of the unified patent court (upc) registered

Effective date: 20230818

AK Designated contracting states

Kind code of ref document: B1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

REG Reference to a national code

Ref country code: GB

Ref legal event code: FG4D

REG Reference to a national code

Ref country code: CH

Ref legal event code: EP

REG Reference to a national code

Ref country code: IE

Ref legal event code: FG4D

REG Reference to a national code

Ref country code: DE

Ref legal event code: R096

Ref document number: 602015085924

Country of ref document: DE

REG Reference to a national code

Ref country code: LT

Ref legal event code: MG9D

REG Reference to a national code

Ref country code: NL

Ref legal event code: MP

Effective date: 20231004

REG Reference to a national code

Ref country code: AT

Ref legal event code: MK05

Ref document number: 1617702

Country of ref document: AT

Kind code of ref document: T

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: NL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

REG Reference to a national code

Ref country code: ES

Ref legal event code: FG2A

Ref document number: 2963718

Country of ref document: ES

Kind code of ref document: T3

Effective date: 20240401

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: GR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240105

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: IS

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240204

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: AT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: IS

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240204

Ref country code: GR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240105

Ref country code: BG

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240104

Ref country code: AT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: PT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240205

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SE

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: RS

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: PL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: NO

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20240104

Ref country code: LV

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: HR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

REG Reference to a national code

Ref country code: DE

Ref legal event code: R097

Ref document number: 602015085924

Country of ref document: DE

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: DK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: CZ

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SM

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: SK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: RO

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: EE

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: DK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: CZ

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PLBE No opposition filed within time limit

Free format text: ORIGINAL CODE: 0009261

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: MC

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: MC

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

REG Reference to a national code

Ref country code: CH

Ref legal event code: PL

26N No opposition filed

Effective date: 20240705

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LU

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240121

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LU

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240121

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: BE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240131

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: CH

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240131

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

Ref country code: CH

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240131

Ref country code: BE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240131

REG Reference to a national code

Ref country code: BE

Ref legal event code: MM

Effective date: 20240131

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: IE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240121

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: IE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20240121

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: CY

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT; INVALID AB INITIO

Effective date: 20150121

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: HU

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT; INVALID AB INITIO

Effective date: 20150121

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: FI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: TR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20231004

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: GB

Payment date: 20251218

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: FR

Payment date: 20251222

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: ES

Payment date: 20260212

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: DE

Payment date: 20251216

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: IT

Payment date: 20251230

Year of fee payment: 12