EP3027652A1 - Anti-pla2r antibody and uses thereof - Google Patents

Anti-pla2r antibody and uses thereof

Info

Publication number
EP3027652A1
EP3027652A1 EP14761694.0A EP14761694A EP3027652A1 EP 3027652 A1 EP3027652 A1 EP 3027652A1 EP 14761694 A EP14761694 A EP 14761694A EP 3027652 A1 EP3027652 A1 EP 3027652A1
Authority
EP
European Patent Office
Prior art keywords
pla
binding molecule
peptide
sample
human
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP14761694.0A
Other languages
German (de)
French (fr)
Inventor
Pierre RONCO
Hanna DEBIEC
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universite Pierre et Marie Curie
Assistance Publique Hopitaux de Paris APHP
Institut National de la Sante et de la Recherche Medicale INSERM
Original Assignee
Universite Pierre et Marie Curie
Assistance Publique Hopitaux de Paris APHP
Institut National de la Sante et de la Recherche Medicale INSERM
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite Pierre et Marie Curie, Assistance Publique Hopitaux de Paris APHP, Institut National de la Sante et de la Recherche Medicale INSERM filed Critical Universite Pierre et Marie Curie
Priority to EP14761694.0A priority Critical patent/EP3027652A1/en
Publication of EP3027652A1 publication Critical patent/EP3027652A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2851Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/32Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2842Pain, e.g. neuropathic pain, psychogenic pain

Definitions

  • the invention relates to PLA 2 R-binding molecules such as anti-PLA 2 R antibodies.
  • PLA 2 R-binding molecules such as anti-PLA 2 R antibodies.
  • the invention relates also to the identification of novel epitopes of PLA 2 R, immunogenic compounds, kits and compositions, as well as methods for obtaining such antibodies.
  • the invention relates to methods for detecting the presence of PLA 2 R in a sample.
  • the invention relates to methods for diagnosing the occurrence of a membranous nephropathy in an individual, such as an idiopathic (or PLA 2 R-positive) membranous nephropathy.
  • MN Membranous nephropathy
  • GBM glomerular basement membrane
  • Membranous nephropathy may be classified as a primary MN, or as a secondary MN, and is preferably diagnosed by renal biopsy.
  • Primary membranous nephropathy may be also referred herein as an idiopathic membranous nephropathy (iMN), or as a PLA 2 R-positive membranous nephropathy.
  • iMN idiopathic membranous nephropathy
  • PLA 2 R-positive membranous nephropathy More generally, the diagnosis of idiopathic membranous nephropathy is established in the absence of secondary features, which include positivity for anti-nuclear antibodies, anti-double stranded DNA, hepatitis B antigenemia, or electron-dense deposits on renal biopsy in locations other than subepithelial.
  • a secondary MN may be, non-exhaustively, linked to an infection, a tumor, a drug intoxication or an autoimmune condition such as lupus.
  • Membranous nephropathy may also be referred in the literature as a membranous glomerulonephritis. Because of this heterogeneity, the prognosis of membranous nephropathy remains difficult due to the lack of reliable biomarkers (Debiec & Ronco; 2011; PLA 2 R autoantibodies and PLA 2 R glomerular deposits in membranous nephropathy; N. Engl. J. Med.; 364(7):689-90).
  • Diffuse subepithelial deposits of immune complexes are characteristic membranous lesions which may be observed both in primary and in secondary MN including lupus membranous nephropathy, albeit with several distinct pathologic characteristics (Kolasinski et al; 2002; What Do We Know About Lupus Membranous Nephropathy? An Analytic Review ; Arthritis & Rheumatism ; 47(4) pp 450-455).
  • the M-type phospholipase A 2 receptor (PLA 2 R) was recently identified as a major target antigen in "idiopathic" MN (iMN) in adults, as shown in Beck et al. (Beck et al. ; 2009; M-type phospholipase A 2 receptor as target antigen in idiopathic membranous nephropathy ; N Engl J Med. ; 361 : 11-21).
  • PLA 2 R antigen in glomeruli should be examined in all biopsies of patients with a suspected idiopathic (or PLA 2 R-positive) MN, especially if they have negative anti-PL A 2 R activity in the serum Search for PLA 2 R antigen in archival kidney biopsies is also important for the monitoring of patients who will benefit from a kidney transplant
  • detection of PLA 2 R in kidney biopsies can discriminate between different forms of membranous nephropathy, in particular between iMN and a secondary MN such as lupus MN. Because therapeutic strategies are different for patients with iMN and lupus MN, discriminating between these two groups of patients is of utmost clinical importance.
  • polyclonal rabbit anti-PLA 2 R antibody commercialized by SIGMA- ALDRICH ® (ref. HPA012657) is raised against another epitope which ranges from amino- acid 395 to 530 of the receptor PLA 2 R of sequence SEQ ID N°l .
  • This polyclonal antibody is validated by the Human Protein Atlas project and is suitable for immunohistochemistry, but also for protein array and western blotting.
  • Another polyclonal rabbit anti-PLA 2 R antibody is commercialized by ABCAM® (ref. ab99466) and is raised against the epitope which ranges from amino-acid 946 to 957 of the receptor PL A 2 R of sequence SEQ ID N° 1.
  • membranous nephropathy such as for example idiopathic membranous nephropathy and lupus membranous nephropathy.
  • Phospholipase A 2 receptor (PLA 2 R) is involved in the formation of immune glomerular deposits, which are characteristic to membranous nephropathy.
  • the emergence of kidney biopsy for the diagnostic of membranous nephropathy requires to identify new tools for the detection of PLA 2 R.
  • the invention relates to the assessment of the presence of PLA 2 R for diagnostic purposes.
  • the invention relates to novel PLA 2 R epitopes and the identification of highly specific PLA 2 R binding molecules.
  • the invention relates to a human Phospholipase A2 receptor (PLA 2 R) binding molecule directed against a PLA 2 R-derived peptide of formula (I) comprising the following amino sequence:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - Xi and X 2 are identical or different and represent any amino acid.
  • the invention relates to a PLA 2 R-derived peptide in the form of an immunogenic compound comprising the PLA 2 R-derived peptide of SEQ ID N°8, wherein the said peptide is covalently linked to a carrier molecule.
  • This invention also pertains to an immunogenic compound comprising a PLA 2 R-derived peptide of formula:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - ImEp is an immunogenic epitope of PLA 2 R of SEQ ID N°8.
  • the invention also relates to a method for generating antibodies binding to immune complexes between auto-antibodies directed against human phospholipase A 2 receptor (PLA 2 R) and human PLA 2 R comprising a step of providing an immunogenic compound containing a PLA 2 R-derived peptide of SEQ ID N°8.
  • the invention relates to a complex between (i) a human PLA 2 R binding molecule and (ii) human PLA 2 .
  • the invention relates to an epitope of a human Phospholipase A 2 receptor bound by the said human PLA 2 R binding molecule.
  • the invention also relates to a composition comprising a PLA 2 R binding molecule according to the invention.
  • the invention relates to a method for detecting the presence of human PLA 2 R in a sample comprising the steps of:
  • step b) bringing into contact the sample provided at step a) with a PLA 2 R binding molecule according to the invention, and c) detecting the binding of the said PLA 2 R binding molecule onto the said sample, whereby the presence of human PLA 2 R is detected.
  • the invention relates to a kit for detecting human PLA 2 R, the said kit comprising a PLA 2 R binding molecule according to the invention and one or more reagents necessary for detecting the extent of binding between the said PLA 2 R binding molecule and a sample to be tested.
  • the sample may be a biological sample taken from an individual suspected of having glomerular deposits.
  • the invention also relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual comprising the steps of:
  • the invention further relates to a method for discriminating between idiopathic (or PLA 2 R-positive) MN and lupus MN comprising the steps of:
  • Figure 1 Sequences of the ten overlapping peptides that were used in ELISA to identify the specific minimal epitope of the anti-PLA 2 R antibody.
  • the amino-acid sequence "PepC" of sequence SEQ ID N°8 ranges from amino-acid 875 to 900 of PLA 2 R, of sequence SEQ ID N°l .
  • Corresponding overlapping 10-aa long peptides in double amino-acid steps were synthesized in order to identify a specific minimal epitope.
  • Figure 2 Assessment by ELISA of peptide antibody reactivity in monoclonal hybridoma fluid, in complex with a HRP-conjugated secondary antibody. Absorbance (y-axis) is read at 450 nm after addition of TMB substrate. Dark grey bars and light grey bars relate to two independent ELISA measurements. Numbering of peptides (x-axis) is identical to figure 1.
  • Figure 3 Alanine Scanning on the immunogenic epitope of PLA 2 R on hybridoma fluids and by ELISA.
  • Panel A Numbering of tested peptides.
  • Panel B Absorbance (y-axis) is read at 450 nm after addition of TMB substrate. Numbering of peptides (x-axis) is identified in panel A.
  • Figure 4 Assessment by Western Blot of the specificity of the PLA 2 R antibody.
  • FIG. 5 Location of various antigenic epitopes contained in PLA 2 R. The position of the corresponding PLA 2 R epitopes is indicated in the figure.
  • the PLA 2 R receptor is a type I transmembrane glycoprotein composed of a large extracellular portion that consists of an N-terminal cysteine-rich region (CRD), a fibronectin-like type II domain (FN2D), a tandem repeat of eight C-type lectin domains (CTLD), a transmembrane domain (TMD) and a short intracellular C-terminal domain (CD).
  • CCD N-terminal cysteine-rich region
  • FN2D fibronectin-like type II domain
  • CLD C-type lectin domain
  • TMD transmembrane domain
  • CD short intracellular C-terminal domain
  • kidney biopsies from patients with membranous nephropathy may present in situ glomerular deposits formed both by the accumulation of pathogenic antigens from PLA 2 R and of autoimmune anti-PLA 2 R antibodies.
  • glomerular deposits contain autoimmune antibodies, they may also be referred herein as immune glomerular deposits.
  • the present inventors believe that the formation of glomerular deposits may be viewed, at least in part, as a multiple-step process wherein circulating (auto)antibodies bind to a native protein.
  • the formed PLA 2 R- autoantibody complex may then be released in the subepithelial space, attach to the underlying glomerular basement membrane, resist degradation and persist as an immune deposit which would over time accumulate and be detectable on biopsies.
  • the PLA 2 R is a known 185 kDa type I transmembrane receptor for secretory phospholipase which belongs to the mannose receptor family. It is composed of a short C- terminal cytoplasmic domain, a transmembrane domain, and an N-terminal extracellular domain. The extracellular domain comprises a cysteine-rich domain, a fibronectin type II domain, and eight C-type lectin -like domains. Thus, the folded PLA 2 R transmembrane receptor is likely to possess linear, antigenic and/or accessibility motifs.
  • PLA 2 R monoclonal or polyclonal antibodies directed against PLA 2 R do not all possess the suitable binding properties for detecting the presence of PLA2R in biopsy tissue samples, including in paraffin-embedded biopsy tissue samples. It has been determined herein that relevant PLA 2 R-derived antigenic epitopes may not be available in situ within the glomerular deposits, or may not be available when the target sample consists of paraffin-embedded biopsy tissue samples. One reason may be that the targeted epitope is a conformational epitope, and thus not accessible on the natively-folded protein. Another reason may be that the epitope is hidden after binding of anti-PLA 2 R autoantibodies to the PLA 2 R target.
  • contacting the sample with a random PLA 2 R binding molecule would result in the absence of binding of the said PLA 2 R binding molecule to its antigenic target, and thus would result in a lack of detection signal, irrespective of whether glomerular deposits are present in the sample tested.
  • kidney biopsies such as paraffin-embedded kidney biopsies
  • an antibody suitable for kidney biopsies should be ideally directed against a PLA 2 R-derived epitope that is distinct from "pathogenic" epitopes recognized by patients' sera.
  • PLA 2 R receptor Due to the lack of structural information on the PLA 2 R receptor in situ in the art, the inventors have determined herein novel relevant epitopes from PLA 2 R that are exposed in tissue samples, including biopsy tissue samples, which encompasses paraffin- embedded tissue samples, for the purpose of generating antibodies directed against such epitopes that would be highly relevant for detection.
  • peptides derived from the PLA 2 R sequence and containing putative linear epitopes, antigenic and/or accessibility motifs were synthesized and used as an antigen for the immunization of rabbits.
  • amino acids will be referred herein according to their usual one-letter code, and as defined in the following list: A (Alanine), G (Glycine), V (Valine), L (Leucine), I (Isoleucine, M (Methionine), P (Proline), W (Tryptophane), F (Phenylalanine), M (Methionine), H (Histidine), S (Serine), T (Threonine), C (Cysteine), N (Asparagine), Q (Glutamine), Y (Tyrosine), D (Aspartic Acid), E (Glutamic Acid), K (Lysine) and R (Arginine).
  • an antigenic fragment also referred herein as peptide C (or “pep C”), which consists in the PLA 2 R-derived amino acid sequence WIGLOEERA DEFRWRD GTP VI YONWD (SEQ ID N°8).
  • the "pep C” antigenic fragment consists of the 875-900 fragment of full-length PLA 2 R of sequence SEQ ID N 0 1.
  • PLA 2 R-derived peptide leads to the production of antibodies with improved specificity towards a specific epitope of PLA 2 R, which will be referred herein as the minimal immunogenic epitope of PLA 2 R, which PLA 2 R-derived epitope is available in tissue samples containing PLA 2 R deposits, which includes tissue samples wherein the PLA 2 R deposits are complexed with anti-PLA 2 R autoantibodies.
  • tissue samples containing PLA 2 R deposits which includes tissue samples wherein the PLA 2 R deposits are complexed with anti-PLA 2 R autoantibodies.
  • the said PLA 2 R-derived epitope is available in paraffin-embedded tissue samples containing PLA 2 R deposits.
  • a minimal immunogenic epitope of PLA 2 R which comprises, or consists in, a short peptide motif of sequence SEQ ID N°2, or FX1WX2, wherein Xi and X 2 are identical or different and each of Xi and X 2 consists of an amino acid residue.
  • amino acid residue is disclosed previously in the instant specification.
  • Xi and X 2 may represent a lysine (K), an arginine (R) or an alanine (A), and preferably mean an arginine.
  • the immunogenic epitope may thus comprise or consist in an epitope of sequence SEQ ID N°2 to SEQ ID N°8, of sequence SEQ ID N°15 to SEQ ID N°18, of sequence SEQ ID N°22, of sequence SEQ ID N°24 to SEQ ID N°25, or of sequence SEQ ID N°26, in particular an epitope of sequence SEQ ID N°4.
  • the minimal immunogenic epitope consists in a short motif FRWR of sequence SEQ ID N°4.
  • the immunogenic epitope comprises, or consists in, the short peptide motif of sequence SEQ ID N°3, or X 3 FXiWX 2 , wherein Xi and X 2 are as defined above, and wherein X 3 may represent any amino acid residue.
  • Xi and X 2 may represent a lysine (K), an arginine (R) or an alanine (A), and preferably an arginine.
  • X 3 may represent an aspartate (D), a glutamate (E) or an alanine (A), and preferably a glutamate.
  • the immunogenic epitope comprises or consists of EFRWR (SEQ ID N°5).
  • the immunogenic epitope may comprise or consist of EERA DEFRWRD (SEQ ID N°6).
  • immunogenic epitope may comprise or consist of
  • the immunogenic epitope may comprise or consist of WIGLQEERA DEFRWRDGTPVIYQNWD (SEQ ID N°8).
  • the invention pertains to a PLA 2 R-derived peptide of formula:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - ImEp is an immunogenic epitope of PLA 2 R as defined above.
  • This invention also pertains to an immunogenic compound comprising a PLA 2 R-derived peptide of formula:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - ImEp is an immunogenic epitope of PLA 2 R as defined above.
  • This invention also relates to an immunogenic compound comprising the PLA 2 R-derived peptide of SEQ ID N°8.
  • This invention also relates to an immunogenic compound of SEQ ID N°8.
  • This invention also concerns an immunogenic compound comprising a PLA 2 R-derived peptide of formula:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - ImEp is an immunogenic epitope of PLA 2 R of SEQ ID N°8.
  • this invention pertains to an immunogenic compound covalently linked to a carrier molecule.
  • the said PLA 2 R- derived peptide is covalently linked to a carrier molecule, such as for example Keyhole Limpet Hemocyanin (also termed KLH).
  • a carrier molecule such as for example Keyhole Limpet Hemocyanin (also termed KLH).
  • the invention also pertains to an immunogenic compound of SEQ ID N°8 covalently linked to a carrier molecule.
  • the carrier molecule is preferably a carrier protein.
  • the carrier protein may be selected among those which are well known by the one skilled in the art for preparing immunogenic compounds aimed at inducing an antibody response after administration to a human or to a non- human mammal.
  • This invention also pertains to a human Phospholipase A 2 receptor (PLA 2 R) binding molecule directed against a PLA 2 R-derived peptide, including against a PLA 2 R- derived peptide comprised in an immunogenic compound as disclosed herein.
  • PHA 2 R Phospholipase A 2 receptor
  • the said human Phospholipase A 2 receptor (PLA 2 R) binding molecule is an antibody, or an antibody-derived fragment.
  • the said PLA 2 R binding molecule consists of a nucleic acid aptamer or of a peptide aptamer that specifically binds to a PLA2R-derived peptide comprising the minimal immunogenic epitope described above.
  • Methods for selecting target-specific nucleic acid aptamers or peptide aptamers are well known in the art.
  • An antibody-derived fragment may be selected in the group comprising Fab, Fab', F(ab') 2 , scFv Fd antibody fragments; Fv antibody fragments, isolated CDRs and diabodies, or an epitope-binding fragment thereof.
  • the said human Phospholipase A 2 receptor (PLA 2 R) binding molecule is an antibody.
  • the human Phospholipase A 2 receptor (PLA 2 R) binding molecule is a monoclonal antibody.
  • PLA 2 R human Phospholipase A 2 receptor
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - ImEp is an immunogenic epitope of PLA 2 R as defined above, and in particular of sequence SEQ ID N° 2, SEQ ID N°3 or SEQ ID N°8.
  • a peptide of 1 to 20 amino acids in length encompasses peptides possessing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20 amino acids length.
  • a peptide of 1 to 20 amino acids in length encompasses a peptide of 1 to 15 amino acids in length.
  • a human Phospholipase A 2 receptor (PLA 2 R) binding molecule of the invention is directed against a PLA 2 R-derived peptide with a minimal size of at least 10 amino acids, which includes at least 10, 11, 12, 13, 14 and 15 amino acids.
  • a human Phospholipase A 2 receptor (PLA 2 R) binding molecule of the invention such as an antibody, is directed against a PLA 2 R-derived peptide with a minimal size of at least 12 amino acids, and preferably of at least 15 amino acids, in order to be sufficiently immunogenic.
  • the individual length of the N-terminal (Nt) and C-terminal (Ct) ends of the said PLA 2 R-derived peptide may be equal or different.
  • the N-terminal end is of 12 amino acids in length and the C-terminal end is of 11 amino acids in length.
  • the PLA 2 R-derived peptide is 25- amino acids long.
  • This invention also concerns a human Phospholipase A 2 receptor (PLA 2 R) binding molecule directed against a PLA 2 R-derived peptide of formula (I) comprising the following amino acid sequence:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - Xi and X 2 are identical or different and represent any amino acid.
  • the invention also relates to a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA 2 R-derived peptide of formula (I) comprising the following amino acid sequence: H 2 -[Nt] y - X3FX1WX2 [Ct] z - COOH (I)
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length
  • - Xi and X 2 are identical or different and represent either a lysine or an arginine, and preferably an arginine,
  • the invention relates to a PLA 2 R binding molecule directed against a
  • PLA 2 R derived peptide wherein the said PLA 2 R-derived peptide comprises the amino acid sequence X 3 FXiWX 2 .
  • the invention relates to a PLA 2 R binding molecule directed against a PLA 2 R derived peptide, wherein the said PLA 2 R-derived peptide comprises, or consists of, the amino acid sequence FRWR (SEQ ID N° 4).
  • the invention pertains to a PLA 2 R binding molecule directed against a PLA 2 R derived peptide, wherein the said PLA 2 R-derived peptide comprises, or consists of, the amino acid sequence EFRWR (SEQ ID N° 5).
  • This invention also concerns a human Phospholipase A2 receptor (PLA 2 R) binding molecule directed against a PLA 2 R-derived peptide of formula (II) comprising the following amino acid sequence:
  • - y is an integer consisting in 0 or 1
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length.
  • the invention also relates to a human Phospholipase A2 receptor (PLA 2 R) binding molecule directed against a PLA 2 R-derived peptide of formula (III) comprising the following amino acid sequence:
  • - z is an integer consisting in 0 or 1
  • - Nt is a peptide of 1 to 20 amino acids in length
  • - Ct is a peptide of 1 to 20 amino acids in length.
  • This invention also relates to a PLA 2 R binding molecule directed against a
  • PLA 2 R-derived peptide wherein the said PLA 2 R-derived peptide comprises the amino acid sequence WIGLQEERA DEFRWRDGTPVIYQNWD (SEQ ID N° 8).
  • the invention relates to a PLA 2 R binding molecule directed against a PLA 2 R-derived peptide, wherein the said PLA 2 R- derived peptide consists in the amino acid sequence WIGLQEERANDEFRWRDGTPVIYQNWD (SEQ ID N° 8).
  • PLA 2 R binding molecule is directed against a PLA 2 R-derived peptide as defined in the present specification, for example by performing conventional immunoassays (e.g. ELISA or RIA assays) using the PLA 2 R-derived peptide as the bait molecule.
  • conventional immunoassays e.g. ELISA or RIA assays
  • the one skilled in the art may perform a "competition assay" with the ELISA screening method which is taught in example 1, the western blot method which is taught in example 3 or the immunohistochemistry method which is taught in example 3.
  • a PLA 2 R binding molecule of the invention is able to compete for binding to PLA 2 R with a peptide of sequence SEQ ID N°5 (EFRWR) but not with a peptide of sequence SEQ ID N°l 1 (SWIGLQ).
  • the PLA 2 R binding molecule is able to compete by ELISA screening method or immunohistochemistry method.
  • a PLA 2 R binding molecule of the invention is able to compete for binding to PLA 2 R with a peptide of sequence SEQ ID N°5 (EFRWR) but not with a peptide of sequence SEQ ID N°l l (SWIGLQ) by ELISA screening method or immunohistochemistry method, in particular by immunohistochemistry method.
  • a competition assay relies on the establishment of a background signal. Thus, a positive signal may be detected when the value is statistically above the established background.
  • This invention also relates to a complex between (i) a human PLA 2 R binding molecule as defined herein and (ii) human PLA 2 .
  • This invention notably relates to such complexes between (i) a human PLA 2 R binding molecule as defined herein and (ii) human PLA 2 .
  • the invention also relates to an epitope of a human PLA 2 R bound by a PLA 2 R binding molecule as defined above.
  • the inventors have found that generating antibodies binding to the human phospholipase A 2 receptor (PLA 2 R), and more specifically directed against a minimal immunogenic epitope as defined above, is particularly advantageous for targeting glomerular deposits.
  • PHA 2 R human phospholipase A 2 receptor
  • glomerular deposits refer to the accumulation of deposits which are characteristic of a membranous nephropathy (MN) disease.
  • MN membranous nephropathy
  • subepithelial glomerular deposits may be indicative of an idiopathic membranous nephropathy.
  • Such glomerular deposits are among the most dramatic findings in renal pathology and are well known in the art.
  • Glomerular deposits may be either PLA 2 R-positive or PLA 2 R-negative glomerular deposits.
  • glomerular deposits may be found in the following membranous nephropathy diseases: idiopathic membranous nephropathy, lupus membranous nephropathy and MN associated with cancer, sarcoidosis, infections such as hepatitis B, syphilis, and drug intoxication.
  • an "idiopathic membranous nephropathy” is also referred herein as a PLA 2 R-positive membranous nephropathy, or as primary membranous nephropathy.
  • membranous nephropathies may now be further classified as either PLA 2 R-positive or PLA 2 R-negative membranous nephropathies.
  • Such a change should not be viewed, however as a limitation regarding the ability of antibodies and methods of the invention as tools to detect the occurrence of a membranous nephropathy in general, and of the PLA 2 R epitope in glomerular deposits in particular.
  • the PLA 2 R binding molecules of the invention are able to target glomerular deposits comprising PLA 2 R, including glomerular deposits comprising PLA 2 R which are complexed with anti-PLA 2 R auto-antibodies.
  • Immuno glomerular deposits which are complexed with anti-PLA 2 R auto-antibodies may be also termed herein "immune glomerular deposits".
  • immune glomerular deposits may be subepithelial immune glomerular deposits along glomerular capillary loops.
  • auto-antibodies are antibodies that are endogenously produced by the immune system of an individual and that are directed against one or more of the individual's own proteins, which auto-antibodies encompass in particular those directed against PLA 2 R.
  • the invention relates to a PLA 2 R binding molecule as defined in the present specification, which PLA 2 R binding molecule binds to glomerular deposits and immune glomerular deposits.
  • This invention also relates to a method for generating antibodies binding to immune complexes between auto-antibodies directed against human phospholipase A 2 receptor (PLA 2 R) and human PLA 2 R comprising a step of providing an immunogenic compound containing a PLA 2 R-derived peptide of SEQ ID N°2, in particular of SEQ ID N°4, and preferably of sequence SEQ ID N°8.
  • this invention relates to a method for generating antibodies as defined above, wherein the immunogenic compound is covalently linked to a carrier molecule.
  • the said carrier molecule is Keyhole Limpet Hemocyanin (KLH).
  • This invention notably pertains to a method for generating antibodies directed against a PLA 2 R-derived peptide as described herein comprising the steps of:
  • step b collecting the antibodies produced by the immunized non-human mammal obtained at the end of step a).
  • Monoclonal antibodies may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. These include, but are not limited to, the hybridoma technique, the human B-cell hybridoma technique, and the EBV-hybridoma technique (Kohler, et al.,1975, Nature 256:495-497; Kozbor, et at , 1985, J. Immunol. Methods 81 :31-42; Cote, et al, 1983, Proc.Natl.Acad.Sci. 80:2026-2030; Cole, et al, 1984, MoL Cell Biol. 62: 109-120).
  • a PLA 2 R binding molecule as defined above may be labeled covalently or non-covalently to a detectable molecule.
  • detectable molecules are well known in the Art.
  • a PLA 2 R binding molecule may be linked to a detectable molecule chosen in the following list: (i) a radioactive molecule, (ii) a fluorescent molecule, (iii) a luminescent molecule, (iv) a receptor molecule that is selectively recognized by a ligand and (v) a metallic tag.
  • a PLA 2 R binding molecule linked to a naturally-occuring or radioactive heavy isotope a luminescent molecule such as a chromophore, a luminophore, a fluorophore, a calorimetric agent, a magnetic substance, an electro-chemo-luminescent marker, a spin marker, gold or silver particles, and enzymes or substrates.
  • a luminescent molecule such as a chromophore, a luminophore, a fluorophore, a calorimetric agent, a magnetic substance, an electro-chemo-luminescent marker, a spin marker, gold or silver particles, and enzymes or substrates.
  • a PLA 2 R binding molecule may be linked to fluorophores, to lanthanide complexes and metallic tags, such as Europium or Terbium, fluorescein, fluorescein isothiocyanate (FITC), dichlorotriazinylamine, rhodamine, eosine, coumarin, methyl-coumarin, pyrene, Malachite green, Cy ® -type or Alexa ® -type (Invitrogen) fluorophores such as Cy ® 3, Cy ® 5, Alexa Fluor ® 488, Lucifer Yellow, Cascade Blue, Texas Red, dansyle chrloride, phycoerythrin, luciferin, Green Fluorescent Protein and its variants, bore-dipyromethene (BODIPY), and others which are described in Haugland, Molecular Probes Handbook, (Eugene, Oreg.) 6th Edition; The Synthegen catalog (Houston, Tex.), Lakowic
  • a PLA 2 R binding molecule is not labeled with a detectable molecule. According to that embodiment, binding of the PLA 2 R binding molecule to its target may then be detected using a secondary labelled molecule. Such a case may occur for instance when the PLA 2 R binding molecule is an antibody. In a non- limitative way, such an antibody may be revealed using a secondary labelled antibody when performing a Western Blot assay or Immunohistochemistry.
  • a PLA 2 R binding molecule of the invention is particularly aimed at detecting the presence of human phospholipase A 2 receptor (PLA 2 R) in a sample.
  • a PLA 2 R binding molecule of the invention is labeled with a detectable molecule, or can interact with a labeled molecule.
  • a sample may be a biological sample, such as a blood-derived sample or a biopsy.
  • the sample is a biological sample that is susceptible to contain a human phospholipase A2 receptor, and/or glomerular deposits, such as a blood serum or a tissue sample.
  • a tissue sample may be a biopsy, such as a kidney biopsy, and more particularly a paraffin-embedded kidney biopsy.
  • the preparation of a kidney biopsy is well known in the Art.
  • One may for instance provide a paraffin embedded kidney biopsy specimen from an individual suspected of having a membranous nephropathy disease.
  • the binding of the PLA 2 R binding molecule may be detected using immunofluorescence staining, in particular Antigen retrieval immunofluorescence staining, and more particularly Heat Induced Epitope Retrieval (HIER) method, as described in examples 3 or 4.
  • immunofluorescence staining in particular Antigen retrieval immunofluorescence staining, and more particularly Heat Induced Epitope Retrieval (HIER) method, as described in examples 3 or 4.
  • HIER Heat Induced Epitope Retrieval
  • the invention relates to a method for detecting the presence of human phospholipase A2 receptor (PLA 2 R) in a sample comprising the steps of:
  • the method for detecting the presence of human phospholipase A2 receptor (PLA 2 R) in a sample when applied to a sample suspected of containing glomerular deposits, it can be used as a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual.
  • the invention relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual to be tested, and more particularly for diagnosing the occurrence of an idiopathic membranous nephropathy disease.
  • the method for diagnosing the occurrence of a membranous nephropathy (MN) disease relies on the detection of glomerular deposits within the sample by a PLA 2 R binding molecule of the invention.
  • Detection of the PLA 2 R-derived immunogenic epitope of the invention within glomerular deposits is indicative of a membranous nephropathy disease.
  • glomerular deposits may be an immune glomerular deposit, which means that glomerular deposits may further comprise autoantibodies, such as anti- PLA 2 R autoantibodies.
  • the immunogenic epitope of the invention is not recognized by anti-PLA 2 R autoantibodies, which means that it is also accessible in immune glomerular deposits.
  • the PLA 2 R immunogenic epitope may be detected both in glomerular deposits and immune glomerular deposits.
  • the invention also relates to a method for detecting the presence of immune complexes between auto-antibodies directed against human phospholipase A2 receptor (PLA 2 R) and human PLA 2 R in a sample comprising the steps of:
  • Detection of glomerular deposits comprising the PLA 2 R immunogenic epitope of the invention is indicative of the occurrence of a membranous nephropathy, preferably a primary or PLA 2 R-positive form of membranous nephropathy, which is also referred herein as idiopathic membranous nephropathy.
  • the invention also relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual to be tested comprising the steps of: (i) performing a method for detecting the presence of human phospholipase A 2 receptor (PLA 2 R) in a sample as defined above from the said individual and
  • the sample may be any sample from the said individual that is suspected of containing glomerular deposits.
  • a sample suspected of containing glomerular deposits may be a renal biopsy, or part of a renal biopsy.
  • the method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual may comprise a step of detecting the presence of anti-PLA 2 R autoantibodies in a sample.
  • the invention relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual, comprising the step of detecting the presence of anti-PLA 2 R autoantibodies in a sample from the said individual.
  • MN membranous nephropathy
  • the sample may be the same sample as the sample where the method for detecting the presence of human phospholipase A2 receptor (PLA 2 R) is performed, or a different sample.
  • PHA 2 R human phospholipase A2 receptor
  • the step of detecting the presence of anti-PLA 2 R autoantibodies in a sample may be performed according to any method known in the Art, and/or as described in Debiec & Ronco (Debiec & Ronco; 2011; PLA 2 R autoantibodies and PLA 2 R glomerular deposits in membranous nephropathy; N. Engl. J. Med.; 364(7): 689-90) or in Hofstra & Wetzels (Hofstra & Wetzels ; 2012 ; Anti-PLA 2 R antibodies in membranous nephropathy: ready for routine clinical practice? ; Neth J Med.; 70(3): 109-13).
  • the step of detecting the presence of anti-PLA 2 R autoantibodies may be performed on a blood-derived sample such as the serum of an individual.
  • the presence of anti-PLA 2 R autoantibodies may be assessed in serum by Western blotting under non-reducing conditions, using glycoproteins extracted from normal human glomeruli after removing contaminating endogenous immunoglobulin G. It may also be assessed using an immunofluorescence assay with the use of human embryonic kidney 293 cells that ware transiently transfected with full-length complementary DNA encoding a PLA 2 R1 isoform.
  • MN membranous nephropathy
  • steps (i) and (ii) may be performed in any order
  • steps (i) and (ii) may be performed on the said sample or on different samples.
  • the method for detecting the presence of human phospholipase A 2 receptor (PLA 2 R) in a sample or a tissue sample is performed on a kidney biopsy, and preferably a paraffin-embedded kidney biopsy.
  • PLA 2 R immunogenic epitope of the invention When the PLA 2 R immunogenic epitope of the invention is detected within glomerular deposits (PLA 2 R-positive deposits), it is indicative of a membranous nephropathy, and more particularly a primary ("idiopathic") membranous nephropathy.
  • subepithelial PLA 2 R-positive glomerular deposits may appear during iMN in a finely granular pattern of sub-epithelial deposits along glomerular capillary loops.
  • lupus membranous nephropathy is mostly characterized by PLA 2 R-negative mesangial or subendothelial deposits.
  • PLA 2 R immunogenic epitope of the invention when not detected within glomerular deposits (PLA 2 R-negative deposits), it may be indicative of a secondary membranous nephropathy.
  • the method for detecting the presence of anti-PLA 2 R autoantibodies in a sample is performed on serum.
  • anti-PLA 2 R autoantibodies When anti-PLA 2 R autoantibodies are detected in a sample from an individual, it is indicative of membranous nephropathy, and more particularly a primary ("idiopathic") membranous nephropathy.
  • the absence of circulating anti-PLA 2 R autoantibodies is not sufficient to rule out a membranous nephropathy, or even to discriminate between an idiopathic membranous nephropathy and a lupus membranous nephropathy, especially at an early stage of the disease.
  • the invention further relates to a method for discriminating between idiopathic MN and lupus MN comprising the steps of:
  • the invention relates to a method for discriminating between idiopathic (or PLA 2 R-positive) MN and lupus MN, which may optionally comprise a step of detecting the presence of autoantibodies indicative of a lupus and/or anti-PLA 2 R autoantibodies in a sample from the said individual, wherein the step of detecting the presence of autoantibodies may be performed on the tissue sample of step a) or on a different sample.
  • the invention relates to a method for discriminating between idiopathic MN and lupus MN comprising a step of detecting the presence of anti-PLA 2 R autoantibodies in a sample from the said individual, wherein the step of detecting the presence of anti-PLA 2 R autoantibodies may be performed on the tissue sample of step a) or on a different sample.
  • the invention also relates to a method for discriminating between idiopathic MN and lupus MN comprising the steps of:
  • step (d) may be performed in any order
  • steps (c) and (d) may be performed on the said sample or on different samples.
  • the invention relates to a composition comprising a PLA 2 R binding molecule as defined by the invention.
  • the invention relates to a kit for detecting human PLA 2 R, the said kit comprising a PLA 2 R binding molecule as defined by the invention and one or more reagents necessary for detecting the extent of binding between the said PLA 2 R binding molecule and a sample to be tested.
  • reagents included in the kit may vary depending on the nature of the sample to be tested, and the technique that is used for detection.
  • a reagent necessary for detecting the extent of binding between the said PLA 2 R binding molecule and a sample to be tested can be a peptide sequence of SEQ ID N°l to 26, an epitope of a human PLA 2 R bound by a PLA 2 R binding molecule, or a complex between (i) a human PLA 2 R binding molecule and (ii) human PLA 2 R.
  • the invention relates to a kit for diagnosing a membranous nephropathy disease, which comprises at least a PLA 2 R binding molecule of the invention. It may further comprise one or more reagents necessary for detecting the presence of autoantibodies in a sample, in particular for detecting autoantibodies against PLA 2 R and autoantibodies indicative of a lupus.
  • kits for the detection of autoantibodies are well known in the art.
  • commercial autoantibody assay kits may thus include reagents for immunofluorescence, immunodiffusion, immunoblotting, or ELISA methods.
  • peptide A 437-467 aa
  • peptide B pepB
  • peptide C pep C 875- 900 aa from the sequence of PLA2R of sequence SEQ ID N°l, that contain linear epitopes, antigenic and/or accessibility motifs.
  • Peptide A is a 29-long polypeptide of sequence SEQ ID N°9.
  • Peptide B is a 27-long polypeptide of sequence SEQ ID N°10.
  • Peptide C is a 25-long polypeptide of sequence SEQ ID N°8.
  • peptide C was chosen to immunize BALB/C mice. Immunisation, fusion and screening of the positive hybridoma and subsequent cloning of hybridomas selected at the polyclonal step were conducted according to the standard protocols known in the Art. In our laboratory, we screened all of the above samples on paraffin-embedded biopsy specimens from MN patients. Finally, we selected several hybridoma supernatants which stained PLA 2 R in subepithelial deposits in glomeruli.
  • the plate was incubated overnight at +4°C with monoclonal antibody 12D8 immunopurified from hybridoma fluid and diluted at l ⁇ g/ml in TBS 1 : 1 SuperBlock blocking buffer. After three washing steps with washing buffer, bound antibodies were detected by incubation with goat anti-mouse IgG-URP conjugate (goat anti-mouse abeam ref ab7023) diluted 1 :4000 in TBS 1 : 1 SuperBlock blocking buffer. After washing with washing buffer, enzyme substrate TMB was added, and after 10 min the reaction was stopped with H2SO4. The absorbance was read at 450 nm.
  • Antibodies from patients sera were isolated according to the standard protocols. Sera were sampled before treatment at the time of renal biopsy. Those patients had circulating anti-PLA2R antibodies and biopsy-proven MN.
  • the critical amino-acids in the minimal epitope were identified further by alanine screening.
  • Peptides with one amino-acid substituted by alanine spacer sequence GSGS and biotin residue at the N-terminus, a-carboxamide at the C terminus), of sequences SEQ ID N°5 and SEQ ID N°22 to 26, were coated on NeutrAvidin plate.
  • An ELISA with hybridoma fluids was performed according to the same protocols as previously described.
  • Bound antibodies were detected by incubation with goat anti-mouse Ig-HRP (abeam) conjugate diluted at 1 :5000 in TBS 1 : 1 SuperBlock blocking buffer. After washing with washing buffer, immunoglobulins were visualized with Super Signal West Pico Chemiluminescent Substrate (Pierce ref 34080)
  • HIER Heat Induced Epitope Retrieval
  • HIER at pH 6 was followed by 5-min incubation with HistoReveal (Abeam ref. ab 103720).
  • concentration of a monoclonal antibody of the invention is set at 0.3 ⁇ g/ml and the secondary antibody is a polyclonal goat Alexa488-conjugated anti- mouse IgG antibody at a dilution of 1/500 (Molecular Probes - ref.Al 1001)
  • Kidney biopsies were obtained from diagnosed MN patients; adjacent sections (4 ⁇ ) were incubated with the monoclonal antibody only (A). Adjacent sections were also pre-incubated with 20 ⁇ g of blocking peptide (B) or with 20 ⁇ g of control peptide (C) prior to incubation with the monoclonal antibody of the invention.
  • Example 1 Identification of a specific minimal binding epitope from a monoclonal hybridoma fluid
  • the monoclonal 12D8 hybridoma fluid was tested by ELISA with overlapping peptides.
  • the amino-acid sequences of pepC and overlapping 10-aa long peptides in double amino-acid steps were synthesized as shown in the Material & Methods section.
  • the absorbance at 450 nm is indicative of binding of the secondary anti-mouse IgG HRP conjugate to the primary monoclonal anti-PLA 2 R antibody isolated from a mouse hybridoma.
  • a high signal necessarily relates to the formation of a complex between the primary anti-PLA 2 R of the invention and the peptide to be tested.
  • peptides 4-7 show significant absorbance over the background, whereas peptide 3 shows a weak signal indicative of residual binding.
  • peptides 4-7 share the same minimal epitope which binds selectively to a monoclonal anti-PLA 2 R of the invention. All four peptides comprise the same FRWR minimal epitope.
  • the ELISA screening establishes that the monoclonal anti-PLA 2 R antibody of the invention recognizes specifically the minimal epitope FRWR.
  • the mild signal obtained from peptide 3 suggests that the glutamic acid which is part of the EFRWR motif may contribute weakly to the overall affinity of the antibody to the pep C polypeptide.
  • Example 2 Peptide C-specific antibodies as tools for targeting glomerular deposits within kidney biopsies
  • Antigen-affinity purified rabbit IgG against peptide C were tested on paraffin- embedded biopsy sample from patients with membranous nephropathy.
  • the PLA 2 receptor in glomerular immune deposits comprises epitopes which are not accessible within kidney biopsy specimens.
  • pepC comprises an epitope which can be targeted for detection of PLA 2 R-enriched glomerular deposits directly from biopsies.
  • Example 3 Immunofluorescence staining of the paraffin embedded patients ' kidney biopsy specimen showing membranous nephropathy: relevance of the (E)FRWR motif for detection in situ
  • this experiment shows that in situ targeting is abolished after competition with the EFRWR peptide.
  • the (E)FRWR motif is shown to be a biomarker of glomerular deposits within kidney biopsy specimen.
  • the SWIGLQ control peptide mimics the N-terminal end of the peptide C fragment; thus this experiment establishes, as a secondary control, that the (E)FRWR motif is relevant for modulating in situ staining of glomerular deposits.
  • Example 4 Immunofluorescence staining of the paraffin embedded patients ' kidney biopsy specimen showing membranous nephropathy: comparison of an anti-PLAiR antibody of the invention with previously reported anti-PLAjR antibodies
  • this experiment shows that anti-PLA 2 R antibodies against the immunogenic epitope (E)FRWR provide superior specificity for glomerular deposits as compared to other commercial polyclonal antibodies.
  • anti-PLA 2 R binding antibodies of the invention are the first very well characterized monoclonal antibody that can be made commercially available for histopathologic purposes.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Neurology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Neurosurgery (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A human Phospholipase A 2 receptor (PLA 2 R) binding molecule directed against a PLA 2 R- derived peptide of formula (II) comprising the following amino sequence: wherein: -y is an integer consistingin 0 or 1, -z is an integer consisting in 0 or 1, -Nt is a peptide of 1 to 20 amino acids in length, -Ct is a peptide of 1 to 20 amino acids in length.

Description

ANTI-PLA2R ANTIBODY AND USES THEREOF
FIELD OF THE INVENTION
The invention relates to PLA2R-binding molecules such as anti-PLA2R antibodies. Thus the invention relates also to the identification of novel epitopes of PLA2R, immunogenic compounds, kits and compositions, as well as methods for obtaining such antibodies.
According to one of its aspects, the invention relates to methods for detecting the presence of PLA2R in a sample.
According to another of its aspects, the invention relates to methods for diagnosing the occurrence of a membranous nephropathy in an individual, such as an idiopathic (or PLA2R-positive) membranous nephropathy.
BACKGROUND OF THE INVENTION
Membranous nephropathy (MN) is an organ-specific autoimmune disease which targets the kidney glomerulus, resulting in the formation of immune deposits on the outer aspect of the glomerular basement membrane (GBM) and complement mediated proteinuria). MN is the most common cause of nephrotic syndrome (defined by massive urinary protein loss) in Caucasian adults. It is a very heterogenous disease with variable outcome and sensitivity to treatment.
Membranous nephropathy may be classified as a primary MN, or as a secondary MN, and is preferably diagnosed by renal biopsy. Primary membranous nephropathy may be also referred herein as an idiopathic membranous nephropathy (iMN), or as a PLA2R-positive membranous nephropathy. More generally, the diagnosis of idiopathic membranous nephropathy is established in the absence of secondary features, which include positivity for anti-nuclear antibodies, anti-double stranded DNA, hepatitis B antigenemia, or electron-dense deposits on renal biopsy in locations other than subepithelial. On the other hand, a secondary MN may be, non-exhaustively, linked to an infection, a tumor, a drug intoxication or an autoimmune condition such as lupus.
Membranous nephropathy may also be referred in the literature as a membranous glomerulonephritis. Because of this heterogeneity, the prognosis of membranous nephropathy remains difficult due to the lack of reliable biomarkers (Debiec & Ronco; 2011; PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy; N. Engl. J. Med.; 364(7):689-90).
Diffuse subepithelial deposits of immune complexes are characteristic membranous lesions which may be observed both in primary and in secondary MN including lupus membranous nephropathy, albeit with several distinct pathologic characteristics (Kolasinski et al; 2002; What Do We Know About Lupus Membranous Nephropathy? An Analytic Review ; Arthritis & Rheumatism ; 47(4) pp 450-455).
The M-type phospholipase A2 receptor (PLA2 R) was recently identified as a major target antigen in "idiopathic" MN (iMN) in adults, as shown in Beck et al. (Beck et al. ; 2009; M-type phospholipase A2 receptor as target antigen in idiopathic membranous nephropathy ; N Engl J Med. ; 361 : 11-21).
In addition, the strong association of the PLA2R1 gene with iMN in a recent genome-wide association study suggests that genetic variants of PLA2R1 are at risk for the disease, as shown by Stanescu et al. (Stanescu et al. ; 2011; Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy; N Engl J Med ; 364(7):616-26).
Although the exact role of PLA2R in the pathogenesis of iMN is still not yet well understood, the presence of circulating anti-PLA2R is highly specific for iMN.
Indeed, several recent studies have shown that anti-PLA2R antibody levels correlate with the clinical manifestations of disease activity, decreasing during a spontaneous or treatment-induced remission and reappearing during a relapse (see for review Debiec & Ronco; 2010; Antigen Identification in Membranous Nephropathy Moves toward Targeted Monitoring and New Therapy ; JASN ; vol. 21(4), 564-569).
To our knowledge, no anti-PL A2R antibodies have been detected in healthy individuals.
Changes in circulating levels of anti-PLA2R antibody often precede changes in proteinuria. Without wishing to be bound by any theory, it is believed that, in human idiopathic membranous nephropathy, glomerular deposits (in particular subepithelial glomerular deposits) form in situ through binding of circulating anti-PLA2R antibodies to the PLA2R antigen which is expressed on the surface of podocytes. Because PLA2R antibody titers can fluctuate and even become negative, detection of PLA2R antigen in immune glomerular deposits is more sensitive than serology.
Our recent study in French and Czech cohorts of patients with iMN (Debiec & Ronco; 2011; PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy; N. Engl. J. Med.; 364(7):689-90) has suggested that assessment of both (i) circulating PLA2R antibodies and (ii) PLA2R in biopsy might better categorize patients into different groups, in comparison to the sole assessment of circulating anti-PLA2R antibodies. Indeed, this study has shown that the absence of circulating PLA2R antibody at the time of kidney biopsy and proteinuria was probably not sufficient to rule out a diagnosis of PLA2R-related MN. As a consequence, the diagnosis of membranous nephropathy is preferably established by renal biopsy in all cases.
Thus it is recommended that PLA2R antigen in glomeruli should be examined in all biopsies of patients with a suspected idiopathic (or PLA2R-positive) MN, especially if they have negative anti-PL A2R activity in the serum Search for PLA2R antigen in archival kidney biopsies is also important for the monitoring of patients who will benefit from a kidney transplant
Advantageously, detection of PLA2R in kidney biopsies can discriminate between different forms of membranous nephropathy, in particular between iMN and a secondary MN such as lupus MN. Because therapeutic strategies are different for patients with iMN and lupus MN, discriminating between these two groups of patients is of utmost clinical importance.
Commercial antibodies against PLA2R have been reported in the literature. One may, for instance, refer to the goat polyclonal antibody commercialized by LSBio (ref. LS-C108906), which is raised against an internal region of human PLA2R and which is suitable for western blots and ELISA methods. However, that antibody is not suitable for immunohistochemistry, which may indicate that the targeted epitope is not available in situ for antibody binding.
The polyclonal rabbit anti-PLA2R antibody commercialized by SIGMA- ALDRICH® (ref. HPA012657) is raised against another epitope which ranges from amino- acid 395 to 530 of the receptor PLA2R of sequence SEQ ID N°l . This polyclonal antibody is validated by the Human Protein Atlas project and is suitable for immunohistochemistry, but also for protein array and western blotting.
Another polyclonal rabbit anti-PLA2R antibody is commercialized by ABCAM® (ref. ab99466) and is raised against the epitope which ranges from amino-acid 946 to 957 of the receptor PL A2R of sequence SEQ ID N° 1.
There remains a need for novel antibodies which bind selectively to diagnostically relevant epitopes of PLA2R, and which may be used notably immunohistochemical detection assays.
There remains a need for new tools for detecting glomerular deposits within biopsies, and more particularly renal biopsies.
There remains a need for methods for detecting the presence of PLA2R in biological samples, and/or for diagnosing the occurrence of a membranous nephropathy disease.
In particular, there remains a need for improved tools which are able to discriminate between the different forms of membranous nephropathy, such as for example idiopathic membranous nephropathy and lupus membranous nephropathy.
SUMMARY OF THE INVENTION
The Phospholipase A2 receptor (PLA2R) is involved in the formation of immune glomerular deposits, which are characteristic to membranous nephropathy. The emergence of kidney biopsy for the diagnostic of membranous nephropathy requires to identify new tools for the detection of PLA2R.
Thus, the invention relates to the assessment of the presence of PLA2R for diagnostic purposes.
In particular, the invention relates to novel PLA2R epitopes and the identification of highly specific PLA2R binding molecules.
According to one of its aspects, the invention relates to a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula (I) comprising the following amino sequence:
H2-[Nt]y - FXiWX2 [Ct]z - COOH (I)
wherein: - y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- Xi and X2 are identical or different and represent any amino acid.
According to another of its aspects, the invention relates to a PLA2R-derived peptide in the form of an immunogenic compound comprising the PLA2R-derived peptide of SEQ ID N°8, wherein the said peptide is covalently linked to a carrier molecule.
This invention also pertains to an immunogenic compound comprising a PLA2R-derived peptide of formula:
H2-[Nt]y - ImEp - [Ct]z - COOH
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- ImEp is an immunogenic epitope of PLA2R of SEQ ID N°8.
Thus, the invention also relates to a method for generating antibodies binding to immune complexes between auto-antibodies directed against human phospholipase A2 receptor (PLA2R) and human PLA2R comprising a step of providing an immunogenic compound containing a PLA2R-derived peptide of SEQ ID N°8.
According to another of its aspects, the invention relates to a complex between (i) a human PLA2R binding molecule and (ii) human PLA2.
Thus the invention relates to an epitope of a human Phospholipase A2 receptor bound by the said human PLA2R binding molecule.
The invention also relates to a composition comprising a PLA2R binding molecule according to the invention.
According to another of its aspects, the invention relates to a method for detecting the presence of human PLA2R in a sample comprising the steps of:
a) providing a sample to be tested,
b) bringing into contact the sample provided at step a) with a PLA2R binding molecule according to the invention, and c) detecting the binding of the said PLA2R binding molecule onto the said sample, whereby the presence of human PLA2R is detected.
Thus the invention relates to a kit for detecting human PLA2R, the said kit comprising a PLA2R binding molecule according to the invention and one or more reagents necessary for detecting the extent of binding between the said PLA2R binding molecule and a sample to be tested.
Advantageously, the sample may be a biological sample taken from an individual suspected of having glomerular deposits.
Thus the invention also relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual comprising the steps of:
(i) performing a method for detecting the presence of human PLA2R in a sample from an individual to be tested, and
(ii) diagnosing the occurrence of a membranous nephropathy disease in the said individual if glomerular deposits comprising human PLA2R are detected.
The invention further relates to a method for discriminating between idiopathic (or PLA2R-positive) MN and lupus MN comprising the steps of:
a) providing a tissue sample from an individual to be tested,
b) bringing into contact the tissue sample provided at step a) with a PLA2R binding molecule according to the invention, and
c) detecting the binding of the said PLA2R binding molecule onto the said tissue sample, the presence of PLA2R is indicative of idiopathic MN.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1: Sequences of the ten overlapping peptides that were used in ELISA to identify the specific minimal epitope of the anti-PLA2R antibody. The amino-acid sequence "PepC" of sequence SEQ ID N°8 ranges from amino-acid 875 to 900 of PLA2R, of sequence SEQ ID N°l . Corresponding overlapping 10-aa long peptides in double amino-acid steps were synthesized in order to identify a specific minimal epitope.
Figure 2: Assessment by ELISA of peptide antibody reactivity in monoclonal hybridoma fluid, in complex with a HRP-conjugated secondary antibody. Absorbance (y-axis) is read at 450 nm after addition of TMB substrate. Dark grey bars and light grey bars relate to two independent ELISA measurements. Numbering of peptides (x-axis) is identical to figure 1.
Figure 3: Alanine Scanning on the immunogenic epitope of PLA2R on hybridoma fluids and by ELISA. Panel A: Numbering of tested peptides. Panel B: Absorbance (y-axis) is read at 450 nm after addition of TMB substrate. Numbering of peptides (x-axis) is identified in panel A.
Figure 4: Assessment by Western Blot of the specificity of the PLA2R antibody. Western blot analysis on recombinant PLA2R in presence of recombinant PLA2R (lane 1); after preincubation with an excess of EFRWR peptide (lane 2); after preincubation with a control peptide SWIGLQ (lane 3).
Figure 5 Location of various antigenic epitopes contained in PLA2R. The position of the corresponding PLA2R epitopes is indicated in the figure. The PLA2R receptor is a type I transmembrane glycoprotein composed of a large extracellular portion that consists of an N-terminal cysteine-rich region (CRD), a fibronectin-like type II domain (FN2D), a tandem repeat of eight C-type lectin domains (CTLD), a transmembrane domain (TMD) and a short intracellular C-terminal domain (CD).
DETAILED DESCRIPTION OF THE INVENTION
In order to search for the presence of PLA2R antigen in kidney biopsies, highly specific monoclonal antibodies that efficiently and specifically bind to PLA2R on tissue samples embedded in paraffin sections are highly needed.
Thus, it has been determined that anti-PLA2R autoantibodies from patients with nephropathy only recognize a reduction- sensitive, or conformation-dependent, epitope. In view of the above, it is assumed herein that not all epitopes from PLA2R are equally relevant for obtaining highly specific monoclonal antibodies suitable for kidney biopsies.
It is emphasized that kidney biopsies from patients with membranous nephropathy may present in situ glomerular deposits formed both by the accumulation of pathogenic antigens from PLA2R and of autoimmune anti-PLA2R antibodies. When such glomerular deposits contain autoimmune antibodies, they may also be referred herein as immune glomerular deposits.
Without wishing to be bound by any theory, the present inventors believe that the formation of glomerular deposits may be viewed, at least in part, as a multiple-step process wherein circulating (auto)antibodies bind to a native protein. The formed PLA2R- autoantibody complex may then be released in the subepithelial space, attach to the underlying glomerular basement membrane, resist degradation and persist as an immune deposit which would over time accumulate and be detectable on biopsies.
The PLA2R is a known 185 kDa type I transmembrane receptor for secretory phospholipase which belongs to the mannose receptor family. It is composed of a short C- terminal cytoplasmic domain, a transmembrane domain, and an N-terminal extracellular domain. The extracellular domain comprises a cysteine-rich domain, a fibronectin type II domain, and eight C-type lectin -like domains. Thus, the folded PLA2R transmembrane receptor is likely to possess linear, antigenic and/or accessibility motifs.
It has been determined herein that monoclonal or polyclonal antibodies directed against PLA2R do not all possess the suitable binding properties for detecting the presence of PLA2R in biopsy tissue samples, including in paraffin-embedded biopsy tissue samples. It has been determined herein that relevant PLA2R-derived antigenic epitopes may not be available in situ within the glomerular deposits, or may not be available when the target sample consists of paraffin-embedded biopsy tissue samples. One reason may be that the targeted epitope is a conformational epitope, and thus not accessible on the natively-folded protein. Another reason may be that the epitope is hidden after binding of anti-PLA2R autoantibodies to the PLA2R target. In this context, contacting the sample with a random PLA2R binding molecule would result in the absence of binding of the said PLA2R binding molecule to its antigenic target, and thus would result in a lack of detection signal, irrespective of whether glomerular deposits are present in the sample tested.
The lack of detection signal may thus be highly prejudicial for the reliability of a detection assay performed with such PLA2R binding molecule on a biopsy tissue sample, and ultimately may be highly prejudicial for the patients' health as it may delay the establishment of a suitable treatment. Thus, an antibody suitable for kidney biopsies, such as paraffin-embedded kidney biopsies, should be ideally directed against a PLA2R-derived epitope that is distinct from "pathogenic" epitopes recognized by patients' sera.
Due to the lack of structural information on the PLA2R receptor in situ in the art, the inventors have determined herein novel relevant epitopes from PLA2R that are exposed in tissue samples, including biopsy tissue samples, which encompasses paraffin- embedded tissue samples, for the purpose of generating antibodies directed against such epitopes that would be highly relevant for detection.
In order to find a good candidate for immunization, peptides derived from the PLA2R sequence and containing putative linear epitopes, antigenic and/or accessibility motifs were synthesized and used as an antigen for the immunization of rabbits.
The amino acids will be referred herein according to their usual one-letter code, and as defined in the following list: A (Alanine), G (Glycine), V (Valine), L (Leucine), I (Isoleucine, M (Methionine), P (Proline), W (Tryptophane), F (Phenylalanine), M (Methionine), H (Histidine), S (Serine), T (Threonine), C (Cysteine), N (Asparagine), Q (Glutamine), Y (Tyrosine), D (Aspartic Acid), E (Glutamic Acid), K (Lysine) and R (Arginine).
The immunization of rabbits with a polypeptide derived from a 25-long fragment of PLA2R led to the isolation of highly specific antibodies against PLA2R.
In particular, the inventors have selected an antigenic fragment, also referred herein as peptide C (or "pep C"), which consists in the PLA2R-derived amino acid sequence WIGLOEERA DEFRWRD GTP VI YONWD (SEQ ID N°8). The "pep C" antigenic fragment consists of the 875-900 fragment of full-length PLA2R of sequence SEQ ID N01.
Surprisingly, the inventors have found that the immunization of rabbits with the above-mentioned PLA2R-derived peptide leads to the production of antibodies with improved specificity towards a specific epitope of PLA2R, which will be referred herein as the minimal immunogenic epitope of PLA2R, which PLA2R-derived epitope is available in tissue samples containing PLA2R deposits, which includes tissue samples wherein the PLA2R deposits are complexed with anti-PLA2R autoantibodies. Importantly, it has been determined herein that the said PLA2R-derived epitope is available in paraffin-embedded tissue samples containing PLA2R deposits. Thus, the inventors have identified a minimal immunogenic epitope of PLA2R, which comprises, or consists in, a short peptide motif of sequence SEQ ID N°2, or FX1WX2, wherein Xi and X2 are identical or different and each of Xi and X2 consists of an amino acid residue. The meaning of the term "amino acid residue" is disclosed previously in the instant specification.
In particular, Xi and X2 may represent a lysine (K), an arginine (R) or an alanine (A), and preferably mean an arginine.
According to this embodiment, the immunogenic epitope may thus comprise or consist in an epitope of sequence SEQ ID N°2 to SEQ ID N°8, of sequence SEQ ID N°15 to SEQ ID N°18, of sequence SEQ ID N°22, of sequence SEQ ID N°24 to SEQ ID N°25, or of sequence SEQ ID N°26, in particular an epitope of sequence SEQ ID N°4.
More particularly, the minimal immunogenic epitope consists in a short motif FRWR of sequence SEQ ID N°4.
According to another embodiment, the immunogenic epitope comprises, or consists in, the short peptide motif of sequence SEQ ID N°3, or X3FXiWX2, wherein Xi and X2 are as defined above, and wherein X3 may represent any amino acid residue.
In particular, Xi and X2 may represent a lysine (K), an arginine (R) or an alanine (A), and preferably an arginine.
In particular, X3 may represent an aspartate (D), a glutamate (E) or an alanine (A), and preferably a glutamate.
According to this embodiment, the immunogenic epitope comprises or consists of EFRWR (SEQ ID N°5).
Thus, the immunogenic epitope may comprise or consist of EERA DEFRWRD (SEQ ID N°6).
Thus, the immunogenic epitope may comprise or consist of
EERA DEFRWRDGTPVIYQNWD (SEQ ID N°7).
Thus, the immunogenic epitope may comprise or consist of WIGLQEERA DEFRWRDGTPVIYQNWD (SEQ ID N°8).
According to another embodiment, the invention pertains to a PLA2R-derived peptide of formula:
H2-[Nt]y - ImEp - [Ct]z - COOH
wherein: - y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- ImEp is an immunogenic epitope of PLA2R as defined above.
This invention also pertains to an immunogenic compound comprising a PLA2R-derived peptide of formula:
H2-[Nt]y - ImEp - [Ct]z - COOH
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- ImEp is an immunogenic epitope of PLA2R as defined above.
This invention also relates to an immunogenic compound comprising the PLA2R-derived peptide of SEQ ID N°8.
This invention also relates to an immunogenic compound of SEQ ID N°8. This invention also concerns an immunogenic compound comprising a PLA2R-derived peptide of formula:
NH2-[Nt]y - ImEp - [Ct]z - COOH
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- ImEp is an immunogenic epitope of PLA2R of SEQ ID N°8.
In particular, this invention pertains to an immunogenic compound covalently linked to a carrier molecule.
In some embodiments of the said immunogenic compound, the said PLA2R- derived peptide is covalently linked to a carrier molecule, such as for example Keyhole Limpet Hemocyanin (also termed KLH). According to an exemplary embodiment, the invention also pertains to an immunogenic compound of SEQ ID N°8 covalently linked to a carrier molecule. The carrier molecule is preferably a carrier protein. The carrier protein may be selected among those which are well known by the one skilled in the art for preparing immunogenic compounds aimed at inducing an antibody response after administration to a human or to a non- human mammal.
This invention also pertains to a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide, including against a PLA2R- derived peptide comprised in an immunogenic compound as disclosed herein.
According to a preferred embodiment, the said human Phospholipase A2 receptor (PLA2R) binding molecule is an antibody, or an antibody-derived fragment.
According to other embodiments, the said PLA2R binding molecule consists of a nucleic acid aptamer or of a peptide aptamer that specifically binds to a PLA2R-derived peptide comprising the minimal immunogenic epitope described above. Methods for selecting target-specific nucleic acid aptamers or peptide aptamers are well known in the art.
An antibody-derived fragment may be selected in the group comprising Fab, Fab', F(ab')2, scFv Fd antibody fragments; Fv antibody fragments, isolated CDRs and diabodies, or an epitope-binding fragment thereof.
According to a more preferred embodiment, the said human Phospholipase A2 receptor (PLA2R) binding molecule is an antibody.
Most preferably, the human Phospholipase A2 receptor (PLA2R) binding molecule is a monoclonal antibody.
Thus the invention relates to a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula:
H2-[Nt]y - ImEp - [Ct]z - COOH
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length, - ImEp is an immunogenic epitope of PLA2R as defined above, and in particular of sequence SEQ ID N° 2, SEQ ID N°3 or SEQ ID N°8.
A peptide of 1 to 20 amino acids in length encompasses peptides possessing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20 amino acids length. In particular, a peptide of 1 to 20 amino acids in length encompasses a peptide of 1 to 15 amino acids in length.
Advantageously, a human Phospholipase A2 receptor (PLA2R) binding molecule of the invention, as defined above and further herebelow, is directed against a PLA2R-derived peptide with a minimal size of at least 10 amino acids, which includes at least 10, 11, 12, 13, 14 and 15 amino acids.
In particular, a human Phospholipase A2 receptor (PLA2R) binding molecule of the invention, such as an antibody, is directed against a PLA2R-derived peptide with a minimal size of at least 12 amino acids, and preferably of at least 15 amino acids, in order to be sufficiently immunogenic.
The individual length of the N-terminal (Nt) and C-terminal (Ct) ends of the said PLA2R-derived peptide may be equal or different.
According to a particular embodiment, the N-terminal end is of 12 amino acids in length and the C-terminal end is of 11 amino acids in length.
According to one exemplary embodiment, the PLA2R-derived peptide is 25- amino acids long. This invention also concerns a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula (I) comprising the following amino acid sequence:
NH2-[Nt]y - FXiWX2 [Ct]z - COOH (I)
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- Xi and X2 are identical or different and represent any amino acid.
The invention also relates to a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula (I) comprising the following amino acid sequence: H2-[Nt]y - X3FX1WX2 [Ct]z - COOH (I)
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- Xi and X2 are identical or different and represent either a lysine or an arginine, and preferably an arginine,
- X3 represents any amino acid.
Thus the invention relates to a PLA2R binding molecule directed against a
PLA2R derived peptide, wherein the said PLA2R-derived peptide comprises the amino acid sequence X3FXiWX2.
In particular the invention relates to a PLA2R binding molecule directed against a PLA2R derived peptide, wherein the said PLA2R-derived peptide comprises, or consists of, the amino acid sequence FRWR (SEQ ID N° 4).
According to another of its objects, the invention pertains to a PLA2R binding molecule directed against a PLA2R derived peptide, wherein the said PLA2R-derived peptide comprises, or consists of, the amino acid sequence EFRWR (SEQ ID N° 5).
This invention also concerns a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula (II) comprising the following amino acid sequence:
H2-[Nt]y - FRWR-[Ct]z - COOH (II),
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length.
According to another of its objects, the invention also relates to a human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula (III) comprising the following amino acid sequence:
NH2-[Nt]y - EFRWR-[Ct]z - COOH (III) wherein: - y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length.
This invention also relates to a PLA2R binding molecule directed against a
PLA2R-derived peptide, wherein the said PLA2R-derived peptide comprises the amino acid sequence WIGLQEERA DEFRWRDGTPVIYQNWD (SEQ ID N° 8).
According to a preferred embodiment, the invention relates to a PLA2R binding molecule directed against a PLA2R-derived peptide, wherein the said PLA2R- derived peptide consists in the amino acid sequence WIGLQEERANDEFRWRDGTPVIYQNWD (SEQ ID N° 8).
The one skilled in the art may easily confirm that a PLA2R binding molecule is directed against a PLA2R-derived peptide as defined in the present specification, for example by performing conventional immunoassays (e.g. ELISA or RIA assays) using the PLA2R-derived peptide as the bait molecule.
Also, the one skilled in the art may perform a "competition assay" with the ELISA screening method which is taught in example 1, the western blot method which is taught in example 3 or the immunohistochemistry method which is taught in example 3.
In some embodiments, a PLA2R binding molecule of the invention is able to compete for binding to PLA2R with a peptide of sequence SEQ ID N°5 (EFRWR) but not with a peptide of sequence SEQ ID N°l 1 (SWIGLQ).
In particular, the PLA2R binding molecule is able to compete by ELISA screening method or immunohistochemistry method.
Thus a PLA2R binding molecule of the invention is able to compete for binding to PLA2R with a peptide of sequence SEQ ID N°5 (EFRWR) but not with a peptide of sequence SEQ ID N°l l (SWIGLQ) by ELISA screening method or immunohistochemistry method, in particular by immunohistochemistry method.
Such a "competition assay" is well known in the art. In particular, a competition assay relies on the establishment of a background signal. Thus, a positive signal may be detected when the value is statistically above the established background.
This invention also relates to a complex between (i) a human PLA2R binding molecule as defined herein and (ii) human PLA2. This invention notably relates to such complexes between (i) a human PLA2R binding molecule as defined herein and (ii) human PLA2.
The invention also relates to an epitope of a human PLA2R bound by a PLA2R binding molecule as defined above.
Surprisingly, the inventors have found that generating antibodies binding to the human phospholipase A2 receptor (PLA2R), and more specifically directed against a minimal immunogenic epitope as defined above, is particularly advantageous for targeting glomerular deposits.
According to the invention, "glomerular deposits" refer to the accumulation of deposits which are characteristic of a membranous nephropathy (MN) disease. In particular, subepithelial glomerular deposits may be indicative of an idiopathic membranous nephropathy. Such glomerular deposits are among the most dramatic findings in renal pathology and are well known in the art.
Glomerular deposits may be either PLA2R-positive or PLA2R-negative glomerular deposits.
For more information on the organization of such deposits, the man skilled in the Art may refer to Beck et al. (Beck et al. ; 2009; M-type phospholipase A2 receptor as target antigen in idiopathic membranous nephropathy ; N Engl J Med. ; 361 : 11-21).
Non-exhaustively, glomerular deposits may be found in the following membranous nephropathy diseases: idiopathic membranous nephropathy, lupus membranous nephropathy and MN associated with cancer, sarcoidosis, infections such as hepatitis B, syphilis, and drug intoxication.
For the purpose of the invention, an "idiopathic membranous nephropathy" is also referred herein as a PLA2R-positive membranous nephropathy, or as primary membranous nephropathy.
Of course the "idiopathic" terminology usually refers to a pathology for which the cause is unknown. However the recent identification of PLA2R as a marker for membranous nephropathies, may lead to a change in the current classification (idiopathic vs. secondary MN).
In particular, membranous nephropathies may now be further classified as either PLA2R-positive or PLA2R-negative membranous nephropathies. Such a change should not be viewed, however as a limitation regarding the ability of antibodies and methods of the invention as tools to detect the occurrence of a membranous nephropathy in general, and of the PLA2R epitope in glomerular deposits in particular. In particular, the PLA2R binding molecules of the invention are able to target glomerular deposits comprising PLA2R, including glomerular deposits comprising PLA2R which are complexed with anti-PLA2R auto-antibodies. Glomerular deposits which are complexed with anti-PLA2R auto-antibodies may be also termed herein "immune glomerular deposits". In particular, immune glomerular deposits may be subepithelial immune glomerular deposits along glomerular capillary loops.
According to the invention, auto-antibodies are antibodies that are endogenously produced by the immune system of an individual and that are directed against one or more of the individual's own proteins, which auto-antibodies encompass in particular those directed against PLA2R.
Thus, the invention relates to a PLA2R binding molecule as defined in the present specification, which PLA2R binding molecule binds to glomerular deposits and immune glomerular deposits.
This invention also relates to a method for generating antibodies binding to immune complexes between auto-antibodies directed against human phospholipase A2 receptor (PLA2R) and human PLA2R comprising a step of providing an immunogenic compound containing a PLA2R-derived peptide of SEQ ID N°2, in particular of SEQ ID N°4, and preferably of sequence SEQ ID N°8.
Notably, this invention relates to a method for generating antibodies as defined above, wherein the immunogenic compound is covalently linked to a carrier molecule. Most preferably, the said carrier molecule is Keyhole Limpet Hemocyanin (KLH).
This invention notably pertains to a method for generating antibodies directed against a PLA2R-derived peptide as described herein comprising the steps of:
a) immunizing a non-human mammal with an immunogenic compound as described herein, and
b) collecting the antibodies produced by the immunized non-human mammal obtained at the end of step a).
Monoclonal antibodies may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. These include, but are not limited to, the hybridoma technique, the human B-cell hybridoma technique, and the EBV-hybridoma technique (Kohler, et al.,1975, Nature 256:495-497; Kozbor, et at , 1985, J. Immunol. Methods 81 :31-42; Cote, et al, 1983, Proc.Natl.Acad.Sci. 80:2026-2030; Cole, et al, 1984, MoL Cell Biol. 62: 109-120).
In some embodiments, a PLA2R binding molecule as defined above may be labeled covalently or non-covalently to a detectable molecule. Examples of detectable molecules are well known in the Art.
In a non-limitative way, a PLA2R binding molecule (for instance an antibody) may be linked to a detectable molecule chosen in the following list: (i) a radioactive molecule, (ii) a fluorescent molecule, (iii) a luminescent molecule, (iv) a receptor molecule that is selectively recognized by a ligand and (v) a metallic tag.
In particular one may consider a PLA2R binding molecule linked to a naturally-occuring or radioactive heavy isotope, a luminescent molecule such as a chromophore, a luminophore, a fluorophore, a calorimetric agent, a magnetic substance, an electro-chemo-luminescent marker, a spin marker, gold or silver particles, and enzymes or substrates.
Advantageously, a PLA2R binding molecule may be linked to fluorophores, to lanthanide complexes and metallic tags, such as Europium or Terbium, fluorescein, fluorescein isothiocyanate (FITC), dichlorotriazinylamine, rhodamine, eosine, coumarin, methyl-coumarin, pyrene, Malachite green, Cy®-type or Alexa®-type (Invitrogen) fluorophores such as Cy®3, Cy®5, Alexa Fluor® 488, Lucifer Yellow, Cascade Blue, Texas Red, dansyle chrloride, phycoerythrin, luciferin, Green Fluorescent Protein and its variants, bore-dipyromethene (BODIPY), and others which are described in Haugland, Molecular Probes Handbook, (Eugene, Oreg.) 6th Edition; The Synthegen catalog (Houston, Tex.), Lakowicz, Principles of Fluorescence Spectroscopy, 2nd Ed., Plenum Press New York (1999).
In other embodiments, a PLA2R binding molecule is not labeled with a detectable molecule. According to that embodiment, binding of the PLA2R binding molecule to its target may then be detected using a secondary labelled molecule. Such a case may occur for instance when the PLA2R binding molecule is an antibody. In a non- limitative way, such an antibody may be revealed using a secondary labelled antibody when performing a Western Blot assay or Immunohistochemistry. Methods of detection and diagnosis
A PLA2R binding molecule of the invention is particularly aimed at detecting the presence of human phospholipase A2 receptor (PLA2R) in a sample.
Advantageously, a PLA2R binding molecule of the invention is labeled with a detectable molecule, or can interact with a labeled molecule.
For instance, a sample may be a biological sample, such as a blood-derived sample or a biopsy. Advantageously, the sample is a biological sample that is susceptible to contain a human phospholipase A2 receptor, and/or glomerular deposits, such as a blood serum or a tissue sample.
A tissue sample may be a biopsy, such as a kidney biopsy, and more particularly a paraffin-embedded kidney biopsy. The preparation of a kidney biopsy is well known in the Art. One may for instance provide a paraffin embedded kidney biopsy specimen from an individual suspected of having a membranous nephropathy disease.
Advantageously, the binding of the PLA2R binding molecule may be detected using immunofluorescence staining, in particular Antigen retrieval immunofluorescence staining, and more particularly Heat Induced Epitope Retrieval (HIER) method, as described in examples 3 or 4. Such methods are well known in the Art (see for instance Shi et al; 2011; Antigen Retrieval Immunohistochemistry Review and Future Prospects in Research and Diagnosis over Two Decades ; J Histochem Cytochem.; 59(1): 13-32).
Thus, the invention relates to a method for detecting the presence of human phospholipase A2 receptor (PLA2R) in a sample comprising the steps of:
a) providing a sample to be tested,
b) bringing into contact the sample provided at step a) with a PLA2R binding molecule, and
c) detecting the binding of the said PLA2R binding molecule onto the said sample, whereby the presence of human PLA2R is detected.
Advantageously, when the method for detecting the presence of human phospholipase A2 receptor (PLA2R) in a sample is applied to a sample suspected of containing glomerular deposits, it can be used as a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual. Thus the invention relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual to be tested, and more particularly for diagnosing the occurrence of an idiopathic membranous nephropathy disease.
According to that embodiment, the method for diagnosing the occurrence of a membranous nephropathy (MN) disease relies on the detection of glomerular deposits within the sample by a PLA2R binding molecule of the invention.
Detection of the PLA2R-derived immunogenic epitope of the invention within glomerular deposits is indicative of a membranous nephropathy disease.
In particular, glomerular deposits may be an immune glomerular deposit, which means that glomerular deposits may further comprise autoantibodies, such as anti- PLA2R autoantibodies.
Advantageously, the immunogenic epitope of the invention is not recognized by anti-PLA2R autoantibodies, which means that it is also accessible in immune glomerular deposits. Thus, the PLA2R immunogenic epitope may be detected both in glomerular deposits and immune glomerular deposits.
Thus, the invention also relates to a method for detecting the presence of immune complexes between auto-antibodies directed against human phospholipase A2 receptor (PLA2R) and human PLA2R in a sample comprising the steps of:
a) providing a tissue sample from an individual to be tested,
b) bringing into contact the tissue sample provided at step a) with a PLA2R binding molecule of the invention, and
c) detecting the binding of the said PLA2R binding molecule onto the said tissue sample, whereby the said immune complexes are detected.
Detection of glomerular deposits comprising the PLA2R immunogenic epitope of the invention is indicative of the occurrence of a membranous nephropathy, preferably a primary or PLA2R-positive form of membranous nephropathy, which is also referred herein as idiopathic membranous nephropathy.
Thus the invention also relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual to be tested comprising the steps of: (i) performing a method for detecting the presence of human phospholipase A2 receptor (PLA2R) in a sample as defined above from the said individual and
(ii) diagnosing the occurrence of a membranous nephropathy disease if glomerular deposits comprising human PLA2R are detected in the said sample.
According to that embodiment, the sample may be any sample from the said individual that is suspected of containing glomerular deposits. Preferably, a sample suspected of containing glomerular deposits may be a renal biopsy, or part of a renal biopsy.
Even more advantageously, the method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual may comprise a step of detecting the presence of anti-PLA2R autoantibodies in a sample.
Thus the invention relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual, comprising the step of detecting the presence of anti-PLA2R autoantibodies in a sample from the said individual.
According to that embodiment, the sample may be the same sample as the sample where the method for detecting the presence of human phospholipase A2 receptor (PLA2R) is performed, or a different sample.
The step of detecting the presence of anti-PLA2R autoantibodies in a sample may be performed according to any method known in the Art, and/or as described in Debiec & Ronco (Debiec & Ronco; 2011; PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy; N. Engl. J. Med.; 364(7): 689-90) or in Hofstra & Wetzels (Hofstra & Wetzels ; 2012 ; Anti-PLA2R antibodies in membranous nephropathy: ready for routine clinical practice? ; Neth J Med.; 70(3): 109-13).
According to a particular embodiment, the step of detecting the presence of anti-PLA2R autoantibodies may be performed on a blood-derived sample such as the serum of an individual.
In a non-limitative way, the presence of anti-PLA2R autoantibodies may be assessed in serum by Western blotting under non-reducing conditions, using glycoproteins extracted from normal human glomeruli after removing contaminating endogenous immunoglobulin G. It may also be assessed using an immunofluorescence assay with the use of human embryonic kidney 293 cells that ware transiently transfected with full-length complementary DNA encoding a PLA2R1 isoform. Thus the invention relates to a method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual comprising the steps of:
(i) performing a method for detecting the presence of human phospholipase A2 receptor (PLA2R) in a tissue sample from the said individual and as defined above,
(ii) detecting the presence of anti-PLA2R autoantibodies in a sample from the said individual,
(iii) diagnosing the occurrence of a membranous nephropathy disease if anti-PLA2R autoantibodies and glomerular deposits are detected in the said individual,
wherein steps (i) and (ii) may be performed in any order,
wherein steps (i) and (ii) may be performed on the said sample or on different samples.
According to a preferred embodiment, the method for detecting the presence of human phospholipase A2 receptor (PLA2R) in a sample or a tissue sample is performed on a kidney biopsy, and preferably a paraffin-embedded kidney biopsy.
When the PLA2R immunogenic epitope of the invention is detected within glomerular deposits (PLA2R-positive deposits), it is indicative of a membranous nephropathy, and more particularly a primary ("idiopathic") membranous nephropathy.
More precisely, subepithelial PLA2R-positive glomerular deposits may appear during iMN in a finely granular pattern of sub-epithelial deposits along glomerular capillary loops.
In contract, lupus membranous nephropathy is mostly characterized by PLA2R-negative mesangial or subendothelial deposits.
Thus, when the PLA2R immunogenic epitope of the invention is not detected within glomerular deposits (PLA2R-negative deposits), it may be indicative of a secondary membranous nephropathy.
According to a particular embodiment, the method for detecting the presence of anti-PLA2R autoantibodies in a sample is performed on serum.
When anti-PLA2R autoantibodies are detected in a sample from an individual, it is indicative of membranous nephropathy, and more particularly a primary ("idiopathic") membranous nephropathy.
On the other hand, the absence of circulating anti-PLA2R autoantibodies is not sufficient to rule out a membranous nephropathy, or even to discriminate between an idiopathic membranous nephropathy and a lupus membranous nephropathy, especially at an early stage of the disease.
Thus, it is not always possible to rule out the possibility of a secondary membranous nephropathy, especially when the clinical signs and the serology do not clearly fit into any standard criteria.
That is the case when a lupus membranous nephropathy is suspected. Thus, it may be difficult to assess in an individual whether a suspected membranous nephropathy may be actually due to an underlying lupus or to an idiopathic cause.
A recent study (Svobodova et al. 2012; Kidney biopsy is a sensitive tool for retrospective diagnosis of PLA2R-related membranous nephropathy; Nephrol Dial Transplant; 0: 1-5) has shown that a PLA2R antigen may be detected in immune deposits and within kidney biopsies for a majority of primary "idiopathic" membranous nephropathy patients. On the other hand, the same study has shown that PLA2R-positive immune deposits were not detected in lupus MN.
Thus, the invention further relates to a method for discriminating between idiopathic MN and lupus MN comprising the steps of:
a) providing a tissue sample from an individual to be tested,
b) bringing into contact the tissue sample provided at step a) with a PLA2R binding molecule of the invention, and
c) detecting the binding of the said PLA2R binding molecule onto the said tissue sample, the presence of PLA2R being indicative of idiopathic MN.
According to a particular embodiment, the invention relates to a method for discriminating between idiopathic (or PLA2R-positive) MN and lupus MN, which may optionally comprise a step of detecting the presence of autoantibodies indicative of a lupus and/or anti-PLA2R autoantibodies in a sample from the said individual, wherein the step of detecting the presence of autoantibodies may be performed on the tissue sample of step a) or on a different sample.
Preferably, the invention relates to a method for discriminating between idiopathic MN and lupus MN comprising a step of detecting the presence of anti-PLA2R autoantibodies in a sample from the said individual, wherein the step of detecting the presence of anti-PLA2R autoantibodies may be performed on the tissue sample of step a) or on a different sample. Thus the invention also relates to a method for discriminating between idiopathic MN and lupus MN comprising the steps of:
a) providing a tissue sample from an individual to be tested,
b) bringing into contact the tissue sample provided at step a) with a PLA2R binding molecule of the invention,
c) detecting the binding of the said PLA2R binding molecule onto the said tissue sample, the presence of PLA2R being indicative of idiopathic MN,
d) detecting the presence of anti-PLA2R autoantibodies in a sample from the said individual,
the presence of PLA2R in the tissue sample and of anti-PLA2R autoantibodies in the sample being indicative of idiopathic MN,
wherein step (d) may be performed in any order,
wherein steps (c) and (d) may be performed on the said sample or on different samples. Compositions and kits
According to one embodiment, the invention relates to a composition comprising a PLA2R binding molecule as defined by the invention.
According to another embodiment, the invention relates to a kit for detecting human PLA2R, the said kit comprising a PLA2R binding molecule as defined by the invention and one or more reagents necessary for detecting the extent of binding between the said PLA2R binding molecule and a sample to be tested.
Of course, the nature and quantity of reagents included in the kit may vary depending on the nature of the sample to be tested, and the technique that is used for detection.
According to said embodiment, a reagent necessary for detecting the extent of binding between the said PLA2R binding molecule and a sample to be tested can be a peptide sequence of SEQ ID N°l to 26, an epitope of a human PLA2R bound by a PLA2R binding molecule, or a complex between (i) a human PLA2R binding molecule and (ii) human PLA2R.
According to another embodiment, the invention relates to a kit for diagnosing a membranous nephropathy disease, which comprises at least a PLA2R binding molecule of the invention. It may further comprise one or more reagents necessary for detecting the presence of autoantibodies in a sample, in particular for detecting autoantibodies against PLA2R and autoantibodies indicative of a lupus.
Kits for the detection of autoantibodies are well known in the art. In a non- limitative way, commercial autoantibody assay kits may thus include reagents for immunofluorescence, immunodiffusion, immunoblotting, or ELISA methods.
EXAMPLES
A. MATERIAL & METHODS
A.l. Immunization with PLA2R-derived antigenic peptides and purification of rabbit antibodies
We selected three antigenic peptides derived from the PLA2R sequence: peptide A (pepA) 437-467 aa, peptide B (pepB) 481-507 aa, and peptide C (pep C) 875- 900 aa from the sequence of PLA2R of sequence SEQ ID N°l, that contain linear epitopes, antigenic and/or accessibility motifs.
Peptide A is a 29-long polypeptide of sequence SEQ ID N°9.
Peptide B is a 27-long polypeptide of sequence SEQ ID N°10.
Peptide C is a 25-long polypeptide of sequence SEQ ID N°8.
These three peptides were synthesized and after coupling with KLH carrier were used, as an antigen for immunization of rabbits (two rabbits for each peptide) and development of polyclonal anti-peptide antibodies according to the standard protocols known in the Art. After the last immunization, the serum from each rabbit was tested by ELISA against the peptide used for immunization. All sera taken from rabbits were positive in this test. Next, rabbit IgG against pep C were purified on a carrier sepharose linked with peptide C by a cysteine residue according to the usual methods.
A.2. Production and cloning of hybridomas
For production of monoclonal antibodies, peptide C was chosen to immunize BALB/C mice. Immunisation, fusion and screening of the positive hybridoma and subsequent cloning of hybridomas selected at the polyclonal step were conducted according to the standard protocols known in the Art. In our laboratory, we screened all of the above samples on paraffin-embedded biopsy specimens from MN patients. Finally, we selected several hybridoma supernatants which stained PLA2R in subepithelial deposits in glomeruli.
A.3. Analysis of sera and hybridoma fluids by peptide ELISA and alanine scanning
The immunization protocol, production and cloning of hybridomas, and analysis of sera and hybridoma fluids by peptide ELISA were done in our laboratory. Overlapping peptides (of sequences SEQ ID N° 12 to 21) defined in figure 1 with a spacer sequence GSGS and biotin residue at the N-terminus were coated on NeutrAvidin ELISA (Thermo Fisher ref 15507) plate at a concentration of l .C^g/ml. The peptide-containing plates were washed three times with washing buffer (0.05% Tween-20 in TBS), and blocked with SuperBlock blocking buffer (ThermoFisher ref 37535). Next, the plate was incubated overnight at +4°C with monoclonal antibody 12D8 immunopurified from hybridoma fluid and diluted at l^g/ml in TBS 1 : 1 SuperBlock blocking buffer. After three washing steps with washing buffer, bound antibodies were detected by incubation with goat anti-mouse IgG-URP conjugate (goat anti-mouse abeam ref ab7023) diluted 1 :4000 in TBS 1 : 1 SuperBlock blocking buffer. After washing with washing buffer, enzyme substrate TMB was added, and after 10 min the reaction was stopped with H2SO4. The absorbance was read at 450 nm.
Antibodies from patients sera were isolated according to the standard protocols. Sera were sampled before treatment at the time of renal biopsy. Those patients had circulating anti-PLA2R antibodies and biopsy-proven MN.
The critical amino-acids in the minimal epitope were identified further by alanine screening. Peptides with one amino-acid substituted by alanine (spacer sequence GSGS and biotin residue at the N-terminus, a-carboxamide at the C terminus), of sequences SEQ ID N°5 and SEQ ID N°22 to 26, were coated on NeutrAvidin plate. An ELISA with hybridoma fluids was performed according to the same protocols as previously described.
A.4. Selection of paraffin-embedded patient's kidney biopsy specimen Biopsies were obtained from a cohort of patients published in : Debiec H and Ronco P (2011), N Engl J Med 364 :689-690).
A.5. Western Blot on recombinant PLA2R Recombinant PLA2R (the extracellular domain of the human PLA2R isoform 1 (SEQ ID N°l, aminoacid residues 1-1397, 300 ng/track) was run on a 10% SDS-PAGE gel under non-reducing conditions, and the gel was electroblotted onto immobilion membrane using semi-dry conditions. After blocking, with SuperBlok blocking buffer, each track was cut out for incubation with: the monoclonal antibody (concentration 0.3 μg/ml), the monoclonal antibody pre-incubated with 20 μg of blocking peptide (EFRWR) or with a same concentration of control peptide (SWIGLQ). Bound antibodies were detected by incubation with goat anti-mouse Ig-HRP (abeam) conjugate diluted at 1 :5000 in TBS 1 : 1 SuperBlock blocking buffer. After washing with washing buffer, immunoglobulins were visualized with Super Signal West Pico Chemiluminescent Substrate (Pierce ref 34080)
A.6. Immunofluorescence with a labelled anti-PLA2R antibody
Patients biopsy was fixed in solution containing ethanol (75%): formol (3%): acetic acid (5%). Fixed patients biopsy specimens were embedded in paraffin according to standard techniques. Devaxed sections (4μπι thickness) were hydrated and antigens were retrieval by Heat Induced Epitope Retrieval (HIER) at pH 6 and temperature 95°C (Diagnostic BioSystem ref K035).
HIER at pH 6 was followed by 5-min incubation with HistoReveal (Abeam ref. ab 103720). The concentration of a monoclonal antibody of the invention is set at 0.3 μg/ml and the secondary antibody is a polyclonal goat Alexa488-conjugated anti- mouse IgG antibody at a dilution of 1/500 (Molecular Probes - ref.Al 1001)
Kidney biopsies were obtained from diagnosed MN patients; adjacent sections (4 μπι) were incubated with the monoclonal antibody only (A). Adjacent sections were also pre-incubated with 20 μg of blocking peptide (B) or with 20 μg of control peptide (C) prior to incubation with the monoclonal antibody of the invention.
Example 1 : Identification of a specific minimal binding epitope from a monoclonal hybridoma fluid
To identify the specific minimal epitope, the monoclonal 12D8 hybridoma fluid was tested by ELISA with overlapping peptides. The amino-acid sequences of pepC and overlapping 10-aa long peptides in double amino-acid steps were synthesized as shown in the Material & Methods section. The absorbance at 450 nm is indicative of binding of the secondary anti-mouse IgG HRP conjugate to the primary monoclonal anti-PLA2R antibody isolated from a mouse hybridoma. Thus, a high signal necessarily relates to the formation of a complex between the primary anti-PLA2R of the invention and the peptide to be tested.
Results
As shown in figures 1 and 2, peptides 4-7 show significant absorbance over the background, whereas peptide 3 shows a weak signal indicative of residual binding.
Thus, it can be inferred from the above that peptides 4-7 share the same minimal epitope which binds selectively to a monoclonal anti-PLA2R of the invention. All four peptides comprise the same FRWR minimal epitope. Thus, the ELISA screening establishes that the monoclonal anti-PLA2R antibody of the invention recognizes specifically the minimal epitope FRWR.
In addition, the mild signal obtained from peptide 3 suggests that the glutamic acid which is part of the EFRWR motif may contribute weakly to the overall affinity of the antibody to the pep C polypeptide.
Other ELISA screenings with peptides 1, 2, 8, 9 and 10 show no signal, which indicates that the minimal epitope is absent from those constructs. Thus, it is assumed from the above that the anti-PLA2R does not bind to any one of those regions, due to the lack of signal above the background.
Of note, patients' sera were not reactive with the tested peptides, which indicates that the monoclonal anti-PLA2R antibody of the invention is reactive against a different epitope of PLA2R than anti-PLA2R auto-antibodies isolated from patients.
Within the minimal (E)FRWR binding epitope, alanine scanning (see figure 3) was further performed in order to identify the critical amino-acids involved in this interaction.
These experiments provide evidence that F and W residues in the minimal epitope are critical for antibody binding, due to complete loss of signal when the peptide is of sequence SEQ ID N°23 or SEQ ID N° 25.
On the other hand, it is shown that other residues may be mutated into an Alanine without detectable loss of affinity in an ELISA test, and when the peptide is of sequence SEQ ID N°22, SEQ ID N°24 or SEQ ID N°26. Of note, an Alanine possesses distinct steric hindrance and charge properties in comparison with amino acids such as a glutamic acid or an arginine. This data provides evidence that other amino acids are optional for binding, and may thus be mutated by any amino acid.
Example 2 : Peptide C-specific antibodies as tools for targeting glomerular deposits within kidney biopsies
Antigen-affinity purified rabbit IgG against peptide C were tested on paraffin- embedded biopsy sample from patients with membranous nephropathy.
Results
In this test only IgG from rabbit immunized with peptide C stained PLA2R in subepithelial deposits along glomerular capillary loops in patients with MN whereas IgG antigen affinity purified from sera of rabbits immunized with peptide A or B did not react with PLA2R in glomerular immune deposits.
Thus, it is shown that the PLA2 receptor in glomerular immune deposits comprises epitopes which are not accessible within kidney biopsy specimens.
On the other hand, this result shows that the PLA2R-derived peptide C (or
"pepC") comprises an epitope which can be targeted for detection of PLA2R-enriched glomerular deposits directly from biopsies.
Example 3 ; Immunofluorescence staining of the paraffin embedded patients ' kidney biopsy specimen showing membranous nephropathy: relevance of the (E)FRWR motif for detection in situ
In addition to example 1 and example 2, this experiment shows that in situ targeting is abolished after competition with the EFRWR peptide.
Results
Specificity of monoclonal antibody binding (12D8 hybridoma fluid) to the MN patients' glomeruli was confirmed by extinction of fluorescence with an excess (20μg) of EFRWR peptide but not with a control peptide SWIGLQ (data not shown). Similarly, our monoclonal antibody recognized recombinant PLA2R protein (SEQ ID N°l, amino-acid residues 1-1397) in Western blot analysis and this immunoreactivity (Figure 4; lane 1) was suppressed when the antibody was pre-incubated with an excess of EFRWR peptide (Figure 4; lane 2) but not with the control peptide (Figure 4; lane 3). Thus the (E)FRWR motif is shown to be a biomarker of glomerular deposits within kidney biopsy specimen. Of note, the SWIGLQ control peptide mimics the N-terminal end of the peptide C fragment; thus this experiment establishes, as a secondary control, that the (E)FRWR motif is relevant for modulating in situ staining of glomerular deposits. Example 4 ; Immunofluorescence staining of the paraffin embedded patients ' kidney biopsy specimen showing membranous nephropathy: comparison of an anti-PLAiR antibody of the invention with previously reported anti-PLAjR antibodies
Along with example 3, this experiment shows that anti-PLA2R antibodies against the immunogenic epitope (E)FRWR provide superior specificity for glomerular deposits as compared to other commercial polyclonal antibodies.
Results
We tested our monoclonal antibody in parallel with the reference rabbit polyclonal antibody (Atlas antibody produced against aa 395-530) on thirty (30) biopsies from patients with MN. Those thirty biopsies were taken from patients with histologically- proven idiopathic MN. Both antibodies stained PLA2R in subepithelial immune deposits along glomerular capillary loops in all biopsies (data not shown). Thus this experiment shows that the targeted epitope on PLA2R is an excellent biomarker for membranous nephropathy diseases.
In addition we tested twenty (20) biopsies with histologically-proven lupus nephritis MN with both antibodies and all samples were negative.
Thus this experiment provides evidence that the PLA2R antibodies of the invention are particularly suitable for kidney biopsies.
There are also commercially distributed polyclonal antibodies raised against the internal or C-terminal parts of PLA2R. However these commercial antibodies target epitopes that do not stain PLA2R in immune deposits (Figure 5). Altogether, these results indicate that the target epitope of our monoclonal antibody and of Atlas polyclonal antibodies but not that for other antibodies is accessible for binding in glomerular immune deposits in MN patients and can be used for diagnosis.
In conclusion, our approach (i.e. screening of hybridomas against biopsies), allowed us to select clones reactive with a specific PLA2R epitope that is accessible and available on paraffin-embedded biopsies from MN patients. Thus, anti-PLA2R binding antibodies of the invention are the first very well characterized monoclonal antibody that can be made commercially available for histopathologic purposes.
SEQUENCE LISTING
SEQ ID N°l
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLK KCIQAGKSVLTLENCKQA KHMLWKWVS HGLFNIGGSGCLGL FSAPEQPLSL YECDSTLVSLRWRC RKMITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGD ICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATTSRYE RDEKWGFCPDPTSAEVGCDTIWEKDLNSHICYQF LLSSLSWSEAHSSCQMQGGT LLSITDETEE FIREHMSSKTVEVWMGLNQLDEHAGWQWSDGTPLNYLNWSPEV FEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYL HIDHEIVEKDAWKYYA THCEPGW PYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLG DENASETWIGLSSNKIPVSFEWS DSSVIFTNWHTLEPHIFP RSQLCVSAEQSEGH WKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQASS GYYCPPALVTITNRFEQAFITSLISS VVKMKDS YFWIALQDQ DTGEYTWKPVGQ KPEPVQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVE NQEKAEYEERWPFHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEF GAHLASFAHIEEE FV ELLHSKFNWTEERQFWIGF KR PLNAGSWEWSDRTPV VSSFLDNTYFGEDARNCAVYKA KTLLPLHCGSKREWICKIPRDVKPKIPFWYQY DVPWLFYQDAEYLFHTFASEWL FEFVCSWLHSDLLTIHSAHEQEFIHSKIKALSK YGASWWIGLOEERA DEFRWRDGTPVIYONWDTGRERTVNNOSORCGFISSITGL WGSEEC S VSMP SICKRKK VWLIEKKKDTPKQHGTCPKGWL YFNYKCLLLNIPKDP SSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTSVWIGLQ DDYET WLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSS P FHFTGKWYFEDCG KEG YGF VCEKMQDT S GHGVNT SDMYPMPNTLE YG RT YKIIN A MT W Y A AIKT CLMHKAQLVSITDQYHQSFLTVVL RLGYAHWIGLFTTDNGL FDWSDGTKSSF TFWKDEESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETS IPWIKFKSNCYSFSTVLDSMSFEAAHEFCKKEGS LLTIKDEAENAFLLEELFAFGS SVQMVWLNAQFDGN ETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEG LWQLSPCQEKKGFICKMEADIHTAEALPEKGPSHSIIPLAVVLTLIVIVAICTLSFCI YKHNGGFFRRLAGFR PYYPATNFSTVYLEENILISDLEKSDQ
SEQ ID N°2
FXWX
SEQ ID N°3
XFXWX
SEQ ID N°4
FRWR SEQ ID N°5
EFRWR
SEQ ID N°6
EERA DEFRWRD
SEQ ID N°7
EERANDEFRWRDGTPVIYQNWD SEQ ID N°8
WIGLOEERANDEFRWRDGTPVIYONWD SEQ ID N°9
TWIGLSSNKIPVSFEWSNDSSVIFTNWHT SEQ ID N°10
AEQSEGHWKVKNCEERLFYICKKAGHV
SEQ ID N°ll
SWIGLQ
SEQ ID N°12
WIGLQEERAN
SEQ ID N°13
GLQEERANDE
SEQ ID N°14
QEERANDEFR
SEQ ID N°15
ERANDEFRWR SEQ ID N°16
ANDEFRWRDG
SEQ ID N°17 DEFRWRDGTP
SEQ ID N°18 FRWRDGTPVI
SEQ ID N°19 WRDGTPVIYQ
SEQ ID N°20 DGTPVIYQNW
SEQ ID N°21
TPVIYQNWD
SEQ ID N°22 AFRWR
SEQ ID N°23
EARWR
SEQ ID N°24
EFAWR
SEQ ID N°25 EFRAR
SEQ ID N°26
EFRWA

Claims

1. A human Phospholipase A2 receptor (PLA2R) binding molecule directed against a PLA2R-derived peptide of formula (II) comprising the following amino sequence:
H2-[Nt]y - FRWR - [Ct]z - COOH (II)
wherein:
- y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length.
2. The PLA2R binding molecule according to claim 1, wherein the said binding molecule is an antibody, or an antibody- derived fragment selected in the group comprising Fab, Fab', F(ab')2, scFv Fd antibody fragments, Fv antibody fragments, isolated CDRs and diabodies, or an epitope-binding fragment thereof.
3. The PLA2R binding molecule according to claim 2, wherein the said PLA2R-derived peptide consists in the amino acid sequence WIGLQEERANDEFRWRD GTPVIYQNWD (SEQ ID N°8).
4. The PLA2R binding molecule according to any one of the preceding claims, which binds to glomerular deposits and immune glomerular deposits.
5. The PLA2R binding molecule according to any one of the preceding claims, wherein the binding molecule is directed against a PLA2R-derived peptide with a minimal size of at least 10 amino acids.
6. A complex between (i) a human PLA2R binding molecule according to claim 1 and (ii) human PLA2R.
7. An epitope of a human PLA2R bound by a PLA2R binding molecule as defined in any one of claims 1 to 5.
8. A method for detecting the presence of human phospholipase A2 receptor (PLA2R) in a sample comprising the steps of:
a) providing a sample to be tested,
b) bringing into contact the sample provided at step a) with a PLA2R binding molecule as defined in any one of claims 1 to 5, and c) detecting the binding of the said PLA2R binding molecule onto the said sample, whereby the presence of human PLA2R is detected.
9. A method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual to be tested comprising the steps of:
(i) performing the method according to claim 8 on a sample from the said individual and
(ii) diagnosing the occurrence of a membranous nephropathy disease if glomerular deposits comprising human PLA2R are detected in the said sample.
10. A method for diagnosing the occurrence of a membranous nephropathy (MN) disease in an individual as defined in claim 9, comprising the step of detecting the presence of anti-PLA2R autoantibodies in a sample from the said individual, wherein the sample is the same as in claim 9 or a different sample.
11. A method for discriminating between PLA2R-positive MN and lupus MN comprising the steps of:
a) providing a tissue sample from an individual to be tested,
b) bringing into contact the tissue sample provided at step a) with a PLA2R binding molecule as defined in any one of claims 1 to 5, and
c) detecting the binding of the said PLA2R binding molecule onto the said tissue sample, the presence of PL A2R being indicative of PLA2R-positive MN.
12. A composition comprising a PLA2R binding molecule according to any one of claims 1 to 5.
13. A kit for detecting human PLA2R, the said kit comprising a PLA2R binding molecule according to any one of claims 1 to 5 and one or more reagents necessary for detecting the extent of binding between the said PLA2R binding molecule and a sample to be tested.
14. A method for generating antibodies binding to immune complexes between auto-antibodies directed against human phospholipase A2 receptor (PLA2R) and human PLA2R comprising a step of providing an immunogenic compound containing a PLA2R-derived peptide of SEQ ID N°8.
15. A PLA2R-derived peptide of formula:
NH2-[Nt]y - ImEp - [Ct]z - COOH
wherein: - y is an integer consisting in 0 or 1,
- z is an integer consisting in 0 or 1,
- Nt is a peptide of 1 to 20 amino acids in length,
- Ct is a peptide of 1 to 20 amino acids in length,
- ImEp is an immunogenic epitope of PLA2R of SEQ ID N°8.
16. An immunogenic compound comprising the PLA2R-derived peptide according to claim 15, wherein the said peptide is covalently linked to a carrier molecule.
EP14761694.0A 2013-07-09 2014-07-08 Anti-pla2r antibody and uses thereof Withdrawn EP3027652A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP14761694.0A EP3027652A1 (en) 2013-07-09 2014-07-08 Anti-pla2r antibody and uses thereof

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP13290157 2013-07-09
EP14761694.0A EP3027652A1 (en) 2013-07-09 2014-07-08 Anti-pla2r antibody and uses thereof
PCT/IB2014/062950 WO2015004603A1 (en) 2013-07-09 2014-07-08 Anti-pla2r antibody and uses thereof

Publications (1)

Publication Number Publication Date
EP3027652A1 true EP3027652A1 (en) 2016-06-08

Family

ID=48874226

Family Applications (1)

Application Number Title Priority Date Filing Date
EP14761694.0A Withdrawn EP3027652A1 (en) 2013-07-09 2014-07-08 Anti-pla2r antibody and uses thereof

Country Status (2)

Country Link
EP (1) EP3027652A1 (en)
WO (1) WO2015004603A1 (en)

Families Citing this family (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104880560B (en) * 2015-05-14 2017-04-12 深圳市伯劳特生物制品有限公司 PLA2R (phospholipase A2 receptor) antibody detection strip and preparation method and detection method thereof
KR20180072662A (en) * 2015-07-10 2018-06-29 추 드 니스 Prognosis and monitoring of membranous nephropathy based on analysis of PLA2R1 epitope profile and proliferation
EP3263600A1 (en) * 2016-07-01 2018-01-03 Université Claude Bernard Lyon 1 Inhibition of pla2r1 for the prevention and/or the treatment of type 2-diabetes
EP3497452B1 (en) * 2016-08-12 2025-03-05 Immunowork, LLC Diagnosis, prevention, and/or treatment of autoimmune diseases
CN107663235B (en) * 2017-08-11 2018-05-22 南京诺唯赞医疗科技有限公司 The relevant PLA2R recombinant proteins of idiopathic membranous nephropathy and its application
GB201717345D0 (en) * 2017-10-23 2017-12-06 Univ Manchester Peptides, methods and apparatus
CN112147339A (en) * 2020-08-31 2020-12-29 浙江博实生物科技有限公司 An immunoassay kit for detecting M-type phospholipase A2 receptor-IgG and its preparation method and detection method
CN114441766B (en) * 2021-12-27 2023-12-29 迪亚莱博(张家港)生物科技有限公司 Fluorescent immunochromatography test strip for quantitatively detecting anti-PLA 2R antibody and preparation method thereof
EP4501965A1 (en) * 2022-03-29 2025-02-05 Chengdu Di'ao Pharmaceutical Group Co., Ltd. Antibody, fusion protein and use thereof
CN114516919B (en) * 2022-04-20 2022-07-05 苏州百道医疗科技有限公司 anti-PLA 2R recombinant rabbit monoclonal antibody and application thereof
CN116063392B (en) * 2022-09-26 2026-05-01 北京大学第一医院 Phospholipase A2 receptor polypeptides and uses thereof
CN120399030A (en) * 2022-10-27 2025-08-01 中国医学科学院北京协和医院 Membranous nephropathy PLA2R antigen epitope peptide and its application
CN116535510B (en) * 2023-06-30 2023-11-10 四川省医学科学院·四川省人民医院 Anti-human PLA2R antibody, kit and application thereof
CN116925230B (en) * 2023-09-19 2024-02-20 四川省医学科学院·四川省人民医院 An anti-human PLA2R antibody and its antigen-binding fragment and its application
WO2025181697A1 (en) 2024-02-26 2025-09-04 Biohaven Therapeutics Ltd. Bifunctional degraders of anti-pla2r antibody
EP4660204A1 (en) * 2024-06-07 2025-12-10 Chang Gung University Antagonist for use in treatment of membranous nephropathy
CN120647764B (en) * 2025-06-16 2025-12-26 南方医科大学南方医院 PLA2R IgG4 antibody and application thereof
CN121319191B (en) * 2025-12-12 2026-02-17 南京诺唯赞医疗科技有限公司 CTLD7 structural domain specific antibody of PLA2R and application thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
None *
See also references of WO2015004603A1 *

Also Published As

Publication number Publication date
WO2015004603A1 (en) 2015-01-15

Similar Documents

Publication Publication Date Title
WO2015004603A1 (en) Anti-pla2r antibody and uses thereof
US9823251B2 (en) Anti-Uroplakin II antibodies systems and methods
CN104530234B (en) Human VEGF detection combination reagent, reagent box and use method thereof
WO2015050107A1 (en) Method for detecting pancreatic tumor, antibody, and pancreatic tumor detection kit
JP2023065484A (en) New tau species
JP2022128212A (en) Monoclonal antibody, measurement reagent for cytokeratin 18 fragment, reagent kit, and measurement method
EA034364B1 (en) Immunoassay for the detection of chromogranin a
JP2024056971A (en) Antibody specifically recognizing the N-terminus of APP669-x and immunoassay method
JP5252339B2 (en) Method for measuring PAD4 and anti-PAD4 antibody and method for detecting rheumatoid arthritis
EP3742166B1 (en) Renal cancer detection method and test drug
WO2005102938A2 (en) Antibodies specific for bcr-abl fusion protein and uses thereof
JP5856956B2 (en) Blood test method
WO2015064348A1 (en) Monoclonal antibody that recognizes sugar chain-deficient human iga1 hinge region, and use therefor
JP7709703B2 (en) Method and reagent for detecting pancreatic cancer
CN102597772B (en) 5.9 kDa peptide immunoassay method
US10316103B1 (en) Systems and methods for anti-Uroplakin III antibodies
JP6099393B2 (en) Autotaxin isoform-specific antibody and detection method
JP7207517B2 (en) APP669-711 measurement method and measurement kit
WO2014167826A1 (en) ANTIBODY FOR SPECIFICALLY RECOGNIZING CLEAVAGE SURFACE OF C-TERMINAL FRAGMENT AFTER α-SECRETASE CLEAVAGE OF AMYLOID PRECURSOR PROTEIN AND USE THEREOF
JP6183920B2 (en) Method for examining lesions of nephritis and reagents therefor
CA3105726A1 (en) Bcl-2 antibodies and immunoassay for diagnosis of cancer
JP2013234156A (en) Monoclonal antibody that specifically recognizes Smad3 phosphorylated in the linker region

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20160203

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20161205

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20180227