EP2902035B1 - Cell-permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of inflammatory eye diseases. - Google Patents
Cell-permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of inflammatory eye diseases. Download PDFInfo
- Publication number
- EP2902035B1 EP2902035B1 EP14004427.2A EP14004427A EP2902035B1 EP 2902035 B1 EP2902035 B1 EP 2902035B1 EP 14004427 A EP14004427 A EP 14004427A EP 2902035 B1 EP2902035 B1 EP 2902035B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- peptide
- sequence
- poly
- chimeric
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/005—Enzyme inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/03—Peptides having up to 20 amino acids in an undefined or only partially defined sequence; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1205—Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
Definitions
- the present invention relates to the field of use of protein kinase inhibitors and more specifically to the use of inhibitors of the protein kinase c-Jun amino terminal kinase, JNK inhibitor (poly-)peptides, chimeric peptides, or of nucleic acids encoding same as well as pharmaceutical compositions containing same, for the treatment of non-chronic or chronic inflammatory eye diseases, such as hordeolum, chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, retinitis and/or myositis of the eye muscle, etc.
- non-chronic or chronic inflammatory eye diseases such as hordeolum, chalazion, conjunktivitis, keratitis, scleritis,
- Ophthalmological diseases are diseases that pertain to the eye.
- the present invention focuses on non-chronic or chronic inflammatory eye diseases. These include for example inflammatory diseases of the blephara, conjunctiva, cornea, sclera, the vitreous body, uvea, ciliary body, choroid, orbital bone, lacrimal gland, iris, etc.
- inflammatory diseases are hordeolum, chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, retinitis and/or myositis of the eye muscle.
- JNKs The c-Jun NH2-terminal kinases
- the JNK pathway is activated by certain cytokines, mitogens, osmotic stress and irradiation.
- the phosphorylation of the c-Jun component of the activator protein AP-1 transcription factor results in pro-inflammatory cytokines production.
- leukocytes infiltration and rolling result from the early activation of the vascular endothelium that releases important chemotactic factors such as RANTES, IL-8, ICAM and VCAM.
- Infiltrating cells in turn release distinct sets of pro- or anti- inflammatory products that contribute to tissue damages and inflammation.
- Many of the gene products involved in the inflammatory response are regulated by the transcription factor activator protein-1 (AP-1), and the c-Jun NH2-terminal kinase (JNK) pathway: COX-2, cyclooxygenase-2; IFN-g, interferon-gamma; iNOS, inducible nitric oxide synthase; TNF-a, tumor-necrosis factor-alpha; MCP-1, membrane cofactor protein-1; MIP-1, major intrinsic protein-1; IL-2, interleukin-2, ...
- LPS lipopolysaccharide
- WO 2009/143865 A1 discloses the use of cell-permeable JNK peptide inhibitors for the treatment of various diseases selected from autoimmune disorders, cardiovascular diseases, cancerous diseases, diabetes, including diabetes type 1 or type 2, inflammatory diseases, hair loss, including Alopecia areata, diseases of the lung, neuronal or neurodegenerative diseases, diseases of the liver, diseases of the spine, diseases of the uterus, viral infectious diseases and depressive disorders.
- WO 2010/113753 A1 discloses a prophylactic or therapeutic agent comprising, as an active ingredient, a JNK-inhibitory peptide of less than 150 amino acids in length, containing at least one D-amino acid, for retinal diseases including age-related macular degeneration, diabetic macular edema, diabetic retinopathy (excluding diabetic macular edema), central exudative chorioretinopathy, angioid streaks, retinal pigment epithelium detachment, multifocal choroiditis, neovascular maculopathy (limited only to case caused by high myopia, tilted disc syndrome, or choroidal osteoma), retinopathy from prematurity, retinitis pigmentosa, Leber's disease, retinal artery occlusion, retinal vein occlusion, central serous chorioretinopathy, retinal macroaneurysm, retinal detachment, proliferative vitreoretinopathy, Star
- JNK inhibitors have been therefore used in various models of inflammation and shown to exert anti-inflammatory and beneficial effects in inflammatory diseases such arthritis and asthma.
- the present invention provides a chimeric (poly-)peptide comprising a JNK inhibitor (poly-)peptide for use in the treatment of intraocular inflammation after eye surgery or eye trauma, wherein the chimeric (poly-)peptide consists or comprises the all D amino acid sequence of SEQ ID NO: 11, or a fragment, or variant thereof sharing a sequence identity of at least 90% with the all D amino acid sequence of SEQ ID NO: 11.
- the present invention also provides a pharmaceutical composition for use in the treatment of intraocular inflammation after eye surgery or eye trauma comprising a chimeric (poly-)peptide consisting or comprising the all D amino acid sequence according to SEQ ID NO: 11 or a fragment or variant sharing a sequence identity of at least 90% with the all D amino acid sequence of SEQ ID NO: 11.
- the object of the present invention is thus to provide alternative or improved therapies, which allow new and preferably improved cure of intraocular inflammation after eye surgery or eye trauma.
- the invention is defined by the claims.
- a JNK inhibitor poly-
- non-chronic or chronic inflammatory eye disease typically denotes non-chronic or chronic inflammatory diseases that pertain to the eye.
- the disease may be for example extraocular or intraocular. This includes diseases of the blephara, conjunctiva, cornea, sclera, the vitreous body, uvea, ciliary body, choroid, orbital bone, lacrimal gland, iris, etc..
- hordeolum chalazion, conjunktivitis, keratitis, scleritis, episcleritis, endophthalmitis, panophtalmitis, ulceritis, uveitis, cyclitis, chorioiditis, orbital phlegmon, retinitis, myositis of the eye muscle.
- a specific example is the treatment of uveitis, for example treatment of anterior uveitis, intermediate uveitis, posterior uveitis and panuveitis, most preferably anterior uveitis.
- JNK inhibitor (poly-)peptides are particularly suitable for treating such chronic or non-chronic inflammatory eye diseases in a subject.
- a JNK inhibitor (poly-)peptide may be typically derived from a human or rat IB1 sequence, preferably from an amino acid sequence as defined or encoded by any of sequences according to SEQ ID NO: 102 (depicts the IB1 cDNA sequence from rat and its predicted amino acid sequence), SEQ ID NO: 103 (depicts the IB1 protein sequence from rat encoded by the exon-intron boundary of the rIB1 gene - splice donor), SEQ ID NO: 104 (depicts the IB1 protein sequence from Homo sapiens), or SEQ ID NO: 105 (depicts the IB1 cDNA sequence from Homo sapiens), more preferably from an amino acid sequence as defined or encoded by any of sequences according to SEQ ID NO: 102 (depicts the IB1 cDNA sequence from
- the JNK inhibitor (poly-)peptide comprises a fragment, variant, or variant of such fragment of a human or rat IB1 sequence.
- Human or rat IB sequences are defined or encoded, respectively, by the sequences according to SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104 or SEQ ID NO: 105.
- such a JNK inhibitor (poly-)peptide as disclosed herein comprises a total length of less than 150 amino acid residues, preferably a range of 5 to 150 amino acid residues, more preferably 10 to 100 amino acid residues, even more preferably 10 to 75 amino acid residues and most preferably a range of 10 to 50 amino acid residues, e.g. 10 to 30, 10 to 20, or 10 to 15 amino acid residues.
- such a JNK inhibitor (poly-)peptide and the above ranges may be selected from any of the above mentioned sequences, even more preferably from an amino acid sequence as defined according to SEQ ID NO: 104 or as encoded by SEQ ID NO: 105, even more preferably in the region between nucleotides 420 and 980 of SEQ ID NO: 105 or amino acids 105 and 291 of SEQ ID NO: 104, and most preferably in the region between nucleotides 561 and 647 of SEQ ID NO: 105 or amino acids 152 and 180 of SEQ ID NO: 104.
- a JNK inhibitor (poly-)peptide as disclosed herein typically binds JNK and/or inhibits the activation of at least one JNK activated transcription factor, e.g. c-Jun or ATF2 (see e.g. SEQ ID NOs: 15 and 16, respectively) or Elk1.
- the JNK inhibitor (poly-)peptide as disclosed herein preferably comprises or consists of at least one amino acid sequence according to any one of SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or a fragment, derivative or variant thereof. More preferably, the JNK inhibitor (poly-)peptide as disclosed herein may contain 1, 2, 3, 4 or even more copies of an amino acid sequence according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or a variant, fragment or derivative thereof.
- these amino acid sequences according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or variants, fragments, or derivatives thereof as disclosed herein may be directly linked with each other without any linker sequence or via a linker sequence comprising 1 to 10, preferably 1 to 5 amino acids.
- Amino acids forming the linker sequence are preferably selected from glycine or proline as amino acid residues. More preferably, these amino acid sequences according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or fragments, variants or derivatives thereof, as disclosed herein, may be separated by each other by a hinge of two, three or more proline residues.
- the JNK inhibitor (poly-)peptides as disclosed herein may be composed of L-amino acids, D-amino acids, or a combination of both.
- the JNK inhibitor (poly-)peptides as disclosed herein comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the JNK inhibitor sequences as disclosed herein in a blockwise, a non-blockwise or in an alternate manner.
- the JNK inhibitor (poly-)peptides as disclosed herein may be exclusively composed of L-amino acids.
- the JNK inhibitor (poly-)peptides as disclosed herein may then comprise or consist of at least one "native JNK inhibitor sequence" according to SEQ ID NO: 1 or 3.
- the term "native” or “native JNK inhibitor sequence(s)” is referred to non-altered JNK inhibitor (poly-)peptide sequences according to any of SEQ ID NOs: 1 or 3, as disclosed herein, entirely composed of L-amino acids.
- the JNK inhibitor (poly-)peptide as disclosed herein may comprise or consist of at least one (native) amino acid sequence NH 2 -X n b -RPTTLXLXXXXXXQD- X n a -X n b -COOH (L-IB generic (s)) [SEQ ID NO: 3] and/or the JNK binding domain (JBDs) of IB1 XRPTTLXLXXXXXXXQDS/TX (L-IB (generic)) [SEQ ID NO: 19].
- each X typically represents an amino acid residue, preferably selected from any (native) amino acid residue.
- X n a typically represents one amino acid residue, preferably selected from any amino acid residue except serine or threonine, wherein n (the number of repetitions of X) is 0 or 1.
- each X n b may be selected from any amino acid residue, wherein n (the number of repetitions of X) is 0-5, 5-10, 10-15, 15-20, 20-30 or more, provided that if n (the number of repetitions of X) is 0 for X n a , X n b does preferably not comprise a serine or threonine at its N-terminus, in order to avoid a serine or threonine at this position.
- X n b represents a contiguous stretch of peptide residues derived from SEQ ID NO: 1 or 3.
- X n a and X n b may represent either D or L amino acids.
- the JNK inhibitor (poly-)peptide as disclosed herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the JNK binding domain of IB1 DTYRPKRPTTLNLFPQVPRSQDT (L-IB1) [SEQ ID NO: 17].
- the JNK inhibitor (poly-)peptide as disclosed herein further may comprise or consist of at least one (native) amino acid sequence NH2-RPKRPTTLNLFPQVPRSQD-COOH (L-IB1 (s)) [SEQ ID NO: 1].
- the JNK inhibitor (poly-)peptide as disclosed herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the JNK binding domain of IB1 L-IB1(s1) (NH 2 -TLNLFPQVPRSQD-COOH, SEQ ID NO: 33); LIB1 (s2) (NH 2 -TTLNLFPQVPRSQ-COOH, SEQ ID NO: 34); L-IB1(s3) (NH 2 -PTTLNLFPQVPRS-COOH, SEQ ID NO: 35); L-IB1 (s4) (NH 2 -RPTTLNLFPQVPR-COOH, SEQ ID NO: 36); L-IB1(s5) (NH2-KRPTTLNLFPQVP-COOH, SEQ ID NO: 37); L-IB1(s6) (NH 2 -PKRPTTLNLFPQV-COOH, SEQ ID NO: 38); L-IB1(s7) (NH 2 -RPKRPTTLNLFPQ
- the JNK inhibitor (poly-)peptide as disclosed herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the (long) JNK binding domain (JBDs) of IB1 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT (IB1-long) [SEQ ID NO: 13], the (long) JNK binding domain of IB2 IPSPSVEEPHKHRPTTLRLTTLGAQDS (IB2-long) [SEQ ID NO: 14], the JNK binding domain of c-Jun GAYGYSNPKILKQSMTLNLADPVGNLKPH (c-Jun) [SEQ ID NO: 15], the JNK binding domain of ATF2 TNEDHLAVHKHKHEMTLKFGPARNDSVIV (ATF2) [SEQ ID NO: 16] (see e.g.
- FIGS. 1A-1C an alignment revealed a partially conserved 8 amino acid sequence (see e.g. FIG.1A ) and a further comparison of the JBDs of IB1 and IB2 revealed two blocks of seven and three amino acids that are highly conserved between the two sequences.
- the JNK inhibitor (poly-)peptides according to the present invention as defined above are composed in part or exclusively of D-amino acids as defined above. More preferably, these JNK inhibitor (poly-)peptides composed of D-amino acids are non-native D retro-inverso sequences of the above (native) JNK inhibitor sequences.
- the term "retro-inverso (poly-)peptides” refers to an isomer of a linear peptide sequence in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see e.g. Jameson et al., Nature, 368,744-746 (1994 ); Brady et al., Nature, 368,692-693 (1994 )).
- any given L-amino acid sequence or peptide as used according to the present invention may be converted into an D retro-inverso sequence or peptide by synthesizing a reverse of the sequence or peptide for the corresponding native L-amino acid sequence or peptide.
- D retro-inverso (poly-)peptides as used herein and as defined above have a variety of useful properties.
- D retro-inverso (poly-)peptides as used herein enter cells as efficiently as L-amino acid sequences as used herein, whereas the D retro-inverso sequences as used herein are more stable than the corresponding L-amino acid sequences.
- the JNK inhibitor (poly-)peptides as disclosed herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence NH2-X n b -X n a -DQXXXXXXLXLTTPR- X n b -COOH (D-IB1 generic (s)) [SEQ ID NO: 4] and/or XS/TDQXXXXXXXLXLTTPRX (D-IB (generic)) [SEQ ID NO: 20].
- X, X n a and X n b are as defined above (preferably, representing D amino acids), wherein X n b preferably represents a contiguous stretch of residues derived from SEQ ID NO: 2 or 4. If n is 0 for X n a , X n b does preferably not comprise a serine or threonine at its C-terminus.
- the JNK inhibitor (poly-)peptides as disclosed herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence comprising the JNK binding domain (JBDs) of IB1 TDQSRPVQPFLNLTTPRKPRYTD (D-IB1) [SEQ ID NO: 18]. More preferably, the JNK inhibitor (poly-)peptides as disclosed herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence NH 2 -DQSRPVQPFLNLTTPRKPR-COOH (D-IB1(s)) [SEQ ID NO: 2].
- the JNK inhibitor (poly-)peptides as disclosed herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence comprising the JNK binding domain (JBDs) of IB1 D-IB1(s1) (NH2-QPFLNLTTPRKPR-COOH, SEQ ID NO: 67); D-IB1(s2) (NH 2 -VQPFLNLTTPRKP-COOH, SEQ ID NO: 68); D-IB1(s3) (NH 2 -PVQPFLNLTTPRK-COOH, SEQ ID NO: 69); D-IB1(s4) (NH 2 -RPVQPFLNLTTPR-COOH, SEQ ID NO: 70); D-IB1(s5) (NH 2 -SRPVQPFLNLTTP-COOH, SEQ ID NO: 71); D-IB1(s6) (NH 2 -QSRPVQPFLNLTT-COOH, SEQ ID NO: 72); D-
- the JNK inhibitor (poly-)peptides as disclosed herein are presented in Table 1 (SEQ ID NO:s 1-4, 13-20 and 33-100).
- the table presents the name of the JNK inhibitor (poly-)peptides/sequences as disclosed herein, as well as their sequence identifier number, their length, and amino acid sequence.
- Table 1 shows sequences as well as their generic formulas, e.g. for SEQ ID NO's: 1, 2, 5, 6, 9 and 11 and SEQ ID NO's: 3, 4, 7, 8, 10 and 12, respectively.
- Table 1 furthermore discloses the chimeric sequences SEQ ID NOs: 9-12 and 23-32 (see below), L-IB1 sequences SEQ ID NOs: 33 to 66 and D-IB1 sequences SEQ ID NOs: 67 to 100.
- D-name a sequence herein which is composed exclusively of D-amino acids
- SEQ ID NO:100 has the sequence/peptide name "D-IB1 (s34)".
- the given amino acid sequence is LNLTTPRKPR.
- all amino acids are here D-amino acids.
- L-TAT SEQ ID NO:5
- D-TAT SEQ ID NO:6
- the JNK inhibitor (poly-)peptide as disclosed herein comprises or consists of at least one variant, fragment and/or derivative of the above defined native or non-native amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100.
- these variants, fragments and/or derivatives retain biological activity of the above disclosed native or non-native JNK inhibitor (poly-)peptides as disclosed herein, particularly of native or non-native amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100, i.e. binding JNK and/or inhibiting the activation of at least one JNK activated transcription factor, e.g. c-Jun, ATF2 or Elk1.
- Functionality may be tested by various tests, e.g. binding tests of the peptide to its target molecule or by biophysical methods, e.g. spectroscopy, computer modeling, structural analysis, etc..
- an JNK inhibitor (poly-)peptide or variants, fragments and/or derivatives thereof as defined above may be analyzed by hydrophilicity analysis (see e.g. Hopp and Woods, 1981. Proc Natl Acad Sci USA 78: 3824-3828 ) that can be utilized to identify the hydrophobic and hydrophilic regions of the peptides, thus aiding in the design of substrates for experimental manipulation, such as in binding experiments, or for antibody synthesis.
- Secondary structural analysis may also be performed to identify regions of an JNK inhibitor (poly-)peptide or of variants, fragments and/or derivatives thereof as disclosed herein that assume specific structural motifs (see e.g. Chou and Fasman, 1974, Biochem 13: 222-223 ). Manipulation, translation, secondary structure prediction, hydrophilicity and hydrophobicity profiles, open reading frame prediction and plotting, and determination of sequence homologies can be accomplished using computer software programs available in the art. Other methods of structural analysis include, e.g. X-ray crystallography (see e.g. Engstrom, 1974. Biochem Exp Biol 11: 7-13 ), mass spectroscopy and gas chromatography (see e.g.
- the JNK inhibitor (poly-)peptide as disclosed herein may comprise or consist of at least one variant of (native or non-native) amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100.
- a "variant of a (native or non-native) amino acid sequence according to SEQ ID NOs: 1-4, 13-20 and 33-100" is preferably a sequence derived from any of the sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100, wherein the variant comprises amino acid alterations of the amino acid sequences according to SEQ ID NOs: 1 - 4, 13-20 and 33-100.
- Such alterations typically comprise 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions of amino acids according to SEQ ID NOs: 1-4, 13-20 and 33-100, wherein the variant exhibits a sequence identity with any of the sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100 of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98% or even at least about 99%.
- variants of (native or non-native) amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100 as defined above are obtained by substitution of specific amino acids, such substitutions preferably comprise conservative amino acid substitutions.
- Conservative amino acid substitutions may include synonymous amino acid residues within a group which have sufficiently similar physicochemical properties, so that a substitution between members of the group will preserve the biological activity of the molecule (see e.g. Grantham, R. (1974), Science 185, 862-864 ). It is evident to the skilled person that amino acids may also be inserted and/or deleted in the above-defined sequences without altering their function, particularly if the insertions and/or deletions only involve a few amino acids, e.g.
- substitutions shall be avoided in variants as disclosed herein, which lead to additional threonines at amino acid positions which are accessible for a phosphorylase, preferably a kinase, in order to avoid inactivation of the JNK-inhibitor (poly-)peptide as disclosed herein or of the chimeric peptide as disclosed herein in vivo or in vitro.
- a specific form of a variant of SEQ ID NOs: 1-4, 13-20 and 33-100 as disclosed herein is a fragment of the (native or non-native) amino acid sequences according to SEQ ID NOs: 1, 1-4, 13-20 and 33-100" as disclosed herein, which is typically altered by at least one deletion as compared to SEQ ID NOs 1-4, 13-20 and 33-100.
- a fragment comprises at least 4 contiguous amino acids of any of SEQ ID NOs: 1-4, 13-20 and 33-100, a length typically sufficient to allow for specific recognition of an epitope from any of these sequences.
- the fragment comprises 4 to 18, 4 to 15, or most preferably 4 to 10 contiguous amino acids of any of SEQ ID NOs: 1-4, 13-20 and 33-100, wherein the lower limit of the range may be 4, or 5, 6, 7, 8, 9, or 10. Deleted amino acids may occur at any position of SEQ ID NOs: 1-4, 13-20 and 33-100, preferably N- or C-terminally.
- a fragment of the (native or non-native) amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100, as described above, may be defined as a sequence sharing a sequence identity with any of the sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100 as disclosed herein of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98%, or even 99%.
- JNK inhibitor (poly-)peptides/sequences as disclosed herein may further comprise or consist of at least one derivative of (native or non-native) amino acid sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100 as defined above.
- a "derivative of an (native or non-native) amino acid sequence according to SEQ ID NOs: 1-4, 13-20 and 33-100” is preferably an amino acid sequence derived from any of the sequences according to SEQ ID NOs: 1-4, 13-20 and 33-100, wherein the derivative comprises at least one modified L- or D-amino acid (forming non-natural amino acid(s)), preferably 1 to 20, more preferably 1 to 10, and even more preferably 1 to 5 modified L- or D-amino acids.
- Derivatives of variants or fragments also fall under the scope of the present invention.
- a modified amino acid in this respect may be any amino acid which is altered e.g. by different glycosylation in various organisms, by phosphorylation or by labeling specific amino acids. Such a label is then typically selected from the group of labels comprising:
- an amino acid sequence having a sequence "sharing a sequence identity" of at least, for example, 95% to a query amino acid sequence of the present invention is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
- up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted or substituted with another amino acid or deleted.
- a "% identity" of a first sequence may be determined with respect to a second sequence.
- these two sequences to be compared are aligned to give a maximum correlation between the sequences. This may include inserting "gaps" in either one or both sequences, to enhance the degree of alignment.
- a % identity may then be determined over the whole length of each of the sequences being compared (so-called global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
- JNK-inhibitor (poly-)peptides /sequences as defined above may be obtained or produced by methods well-known in the art, e.g. by chemical synthesis or by genetic engineering methods as discussed below.
- a peptide corresponding to a portion of an JNK inhibitor sequence as disclosed herein including a desired region of said JNK inhibitor sequence, or that mediates the desired activity in vitro or in vivo may be synthesized by use of a peptide synthesizer.
- JNK inhibitor (poly-)peptide as defined above may be furthermore be modified by a trafficking (poly-)peptide, allowing the JNK inhibitor (poly-)peptide as defined above to be transported effectively into the cells.
- modified JNK inhibitor (poly-)peptides are preferably provided and used as chimeric (poly-)peptides.
- the present disclosure comprising the present invention therefore provides the use of a chimeric (poly-)peptide including at least one first domain and at least one second domain, for the preparation of a pharmaceutical composition for treating non-chronic or chronic inflammatory eye diseases in a subject, wherein the first domain of the chimeric peptide comprises a trafficking sequence, while the second domain of the chimeric (poly-)peptide comprises an JNK inhibitor sequence as defined above, preferably of any of sequences according to SEQ ID NO: 1-4, 13-20 and 33-100 or a derivative or a fragment thereof.
- chimeric (poly-)peptides as used according to the present disclosure comprising the present invention have a length of at least 25 amino acid residues, e.g. 25 to 250 amino acid residues, more preferably 25 to 200 amino acid residues, even more preferably 25 to 150 amino acid residues, 25 to 100 and most preferably amino acid 25 to 50 amino acid residues.
- the chimeric (poly-)peptide as disclosed herein preferably comprises a trafficking sequence, which is typically selected from any sequence of amino acids that directs a peptide (in which it is present) to a desired cellular destination.
- the trafficking sequence typically directs the peptide across the plasma membrane, e.g. from outside the cell, through the plasma membrane, and into the cytoplasm.
- the trafficking sequence may direct the peptide to a desired location within the cell, e.g. the nucleus, the ribosome, the endoplasmic reticulum (ER), a lysosome, or peroxisome, by e.g. combining two components (e.g.
- the trafficking sequence may additionally comprise another component, which is capable of binding a cytoplasmic component or any other component or compartment of the cell (e.g. endoplasmic reticulum, mitochondria, gloom apparatus, lysosomal vesicles). Accordingly, e.g. the trafficking sequence of the first domain and the JNK inhibitor sequence of the second domain may be localized in the cytoplasm or any other compartment of the cell. This allows to determine localization of the chimeric peptide in the cell upon uptake.
- the trafficking sequence (being included in the first domain of the chimeric peptide as disclosed herein) has a length of 5 to 150 amino acid sequences, more preferably a length of 5 to 100 and most preferably a length of from 5 to 50, 5 to 30 or even 5 to 15 amino acids.
- the trafficking sequence (contained in the first domain of the chimeric peptide as disclosed herein) may occur as a continuous amino acid sequence stretch in the first domain.
- the trafficking sequence in the first domain may be splitted into two or more fragments, wherein all of these fragments resemble the entire trafficking sequence and may be separated from each other by 1 to 10, preferably 1 to 5 amino acids, provided that the trafficking sequence as such retains its carrier properties as disclosed above.
- These amino acids separating the fragments of the trafficking sequence may e.g. be selected from amino acid sequences differing from the trafficking sequence.
- the first domain may contain a trafficking sequence composed of more than one component, each component with its own function for the transport of the cargo JNK inhibitor sequence of the second domain to e.g. a specific cell compartment.
- the trafficking sequence as defined above may be composed of L-amino acids, D-amino acids, or a combination of both.
- the trafficking sequences (being included in the first domain of the chimeric peptide as disclosed herein) may comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the JNK trafficking sequences in a blockwise, a non-blockwise or in an alternate manner.
- the trafficking sequence of the chimeric (poly-)peptide as disclosed herein may be exclusively composed of L-amino acids.
- the trafficking sequence of the non-claimed chimeric peptide as disclosed herein comprises or consists of at least one "native" trafficking sequence as defined above.
- the term "native" is referred to non-altered trafficking sequences, entirely composed of L-amino acids.
- the trafficking sequence of the chimeric (poly-)peptide as used herein may be exclusively composed of D-amino acids. More preferably, the trafficking sequence of the chimeric peptide as used herein may comprise a D retro-inverso peptide of the sequences as presented above.
- the trafficking sequence of the first domain of the chimeric (poly-)peptide as used herein may be obtained from naturally occurring sources or can be produced by using genetic engineering techniques or chemical synthesis (see e.g. Sambrook, J., Fritsch, E. F., Maniatis, T. (1989) Molecular cloning: A laboratory manual. 2nd edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y .).
- Sources for the trafficking sequence of the first domain may be employed including, e.g. native proteins such as e.g. the TAT protein (e.g. as described in U.S. Patent Nos. 5,804,604 and 5,674,980 , each of these references being incorporated herein by reference), VP22 (described in e.g. WO 97/05265 ; Elliott and O'Hare, Cell 88 : 223-233 (1997 )), non-viral proteins ( Jackson et al, Proc. Natl. Acad. Sci. USA 89 : 10691-10695 (1992 )), trafficking sequences derived from Antennapedia (e.g.
- the antennapedia carrier sequence or from basic peptides, e.g. peptides having a length of 5 to 15 amino acids, preferably 10 to 12 amino acids and comprising at least 80 %, more preferably 85 % or even 90 % basic amino acids, such as e.g. arginine, lysine and/or histidine.
- basic peptides e.g. peptides having a length of 5 to 15 amino acids, preferably 10 to 12 amino acids and comprising at least 80 %, more preferably 85 % or even 90 % basic amino acids, such as e.g. arginine, lysine and/or histidine.
- variants, fragments and derivatives of one of the native proteins used as trafficking sequences are disclosed herewith. With regard to variants, fragments and derivatives it is referred to the definition given above for JNK inhibitor sequences as disclosed herein. Variants, fragments as well as derivatives are correspondingly defined as set forth above for JNK inhibitor sequences as disclosed here
- a variant or fragment or derivative may be defined as a sequence sharing a sequence identity with one of the native proteins used as trafficking sequences as defined above of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98%, or even 99%.
- the trafficking sequence of the first domain comprises or consists of a sequence derived from the human immunodeficiency virus (HIV)1 TAT protein, particularly some or all of the 86 amino acids that make up the TAT protein.
- HIV human immunodeficiency virus
- partial sequences of the full-length TAT protein may be used forming a functionally effective fragment of a TAT protein, i.e. a TAT peptide that includes the region that mediates entry and uptake into cells.
- a functionally effective fragment of the TAT protein can be determined using known techniques (see e.g. Franked et al., Proc. Natl. Acad. Sci, USA 86 : 7397-7401 (1989 )).
- the trafficking sequence in the first domain of the chimeric peptide as disclosed herein may be derived from a functionally effective fragment or portion of a TAT protein sequence that comprises less than 86 amino acids, and which exhibits uptake into cells, and optionally the uptake into the cell nucleus. More preferably, partial sequences (fragments) of TAT to be used as carrier to mediate permeation of the chimeric peptide across the cell membrane, are intended to comprise the basic region (amino acids 48 to 57 or 49 to 57) of full-length TAT.
- the trafficking sequence (being included in the first domain of the chimeric peptide as disclosed herein) may comprise or consist of an amino acid sequence containing TAT residues 48-57 or 49 to 57, and most preferably a generic TAT sequence NH 2 -X n b -RKKRRQRRR-X n b -COOH (L-generic-TAT (s)) [SEQ ID NO: 7] and/or XXXXRKKRRQ RRRXXX (L-generic-TAT) [SEQ ID NO: 21], wherein X or X n b is as defined above.
- the number of "X n b " residues in SEQ ID NOs :8 is not limited to the one depicted, and may vary as described above.
- the trafficking sequence being included in the first domain of the chimeric peptide as disclosed herein may comprise or consist of a peptide containing e.g. the amino acid sequence NH 2 -GRKKRRQRRR-COOH (L-TAT) [SEQ ID NO: 5].
- the trafficking sequence (being included in the first domain of the chimeric peptide as disclosed herein) may comprise a D retro-inverso peptide of the sequences as presented above, i.e. the D retro-inverso sequence of the generic TAT sequence having the sequence NH 2 -X n b -RRRQRRKKR-X n b -COOH (D-generic-TAT (s)) [SEQ ID NO : 8] and/or XXXXRRRQRRKKRXXX (D-generic-TAT) [SEQ ID NO: 22].
- X n b is as defined above (preferably representing D amino acids).
- the number of "X n b " residues in SEQ ID NOs :8 is not limited to the one depicted, and may vary as described above.
- the trafficking sequence as disclosed herein may comprise the D retro-inverso sequence NH2-RRRQRRKKRG-COOH (D-TAT) [SEQ ID NO: 6].
- the trafficking sequence being included in the first domain of the chimeric peptide as disclosed herein may comprise or consist of variants of the trafficking sequences as defined above.
- a "variant of a trafficking sequence” is preferably a sequence derived from a trafficking sequence as defined above, wherein the variant comprises a modification, for example, addition, (internal) deletion (leading to fragments) and/or substitution of at least one amino acid present in the trafficking sequence as defined above.
- modification(s) typically comprise(s) 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions of amino acids.
- the variant preferably exhibits a sequence identity with the trafficking sequence as defined above, more preferably with any of SEQ ID NOs: 5 to 8 or 21-22, of at least about 30%, 50%, 70%, 80%,90%, 95%, 98% or even 99%.
- variants of the trafficking sequence can be designed to modulate intracellular localization of the chimeric peptide as disclosed herein.
- such variants as defined above are typically designed such that the ability of the trafficking sequence to enter cells is retained (i.e. the uptake of the variant of the trafficking sequence into the cell is substantially similar to that of the native protein used a trafficking sequence). For example, alteration of the basic region thought to be important for nuclear localization (see e.g. Dang and Lee, J. Biol. Chem.
- any of the above disclosed variants of the trafficking sequences being included in the first domain of the chimeric peptide as disclosed herein can be produced using techniques typically known to a skilled person (see e.g. Sambrook, J., Fritsch, E. F., Maniatis, T. (1989) Molecular cloning: A laboratory manual. 2nd edition. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y .)
- the chimeric peptide as disclosed herein typically comprises an JNK inhibitor sequence, selected from any of the JNK inhibitor sequences as defined above, including variants, fragments and/or derivatives of these JNK inhibitor sequences.
- Both domains i.e. the first and the second domain(s), of the chimeric peptide as disclosed herein, may be linked such as to form a functional unit. Any method for linking the first and second domain(s) as generally known in the art may be applied.
- the first and the second domain(s) of the chimeric peptide as used herein are linked by a covalent bond.
- a covalent bond as defined herein, may be e.g. a peptide bond, which may be obtained by expressing the chimeric peptide as defined above as a fusion protein. Fusion proteins, as described herein, can be formed and used in ways analogous to or readily adaptable from standard recombinant DNA techniques, as described below. However, both domains may also be linked via side chains or may be linked by a chemical linker moiety.
- the first and/or second domains of the chimeric peptide as disclosed herein may occur in one or more copies in said chimeric peptide. If both domains are present in a single copy, the first domain may be linked either to the N-terminal or the C-terminal end of the second domain. If present in multiple copies, the first and second domain(s) may be arranged in any possible order. E.g. the first domain can be present in the chimeric peptide as disclosed herein in a multiple copy number, e.g. in two, three or more copies, which are preferably arranged in consecutive order. Then, the second domain may be present in a single copy occurring at the N- or C-terminus of the sequence comprising the first domain.
- first and second domain(s) can take any place in a consecutive arrangement. Exemplary arrangements are shown in the following: e.g. first domain - first domain - first domain - second domain; first domain - first domain - second domain - first domain; first domain - second domain - first domain - first domain; or e.g. second domain - first domain - first domain - first domain. It is well understood for a skilled person that these examples are for illustration purposes only. Thus, the number of copies and the arrangement may be varied as defined initially.
- the first and second domain(s) may be directly linked with each other without any linker. Alternatively, they may be linked with each other via a linker sequence comprising 1 to 10, preferably 1 to 5 amino acids. Amino acids forming the linker sequence are preferably selected from glycine or proline as amino acid residues. More preferably, the first and second domain(s) may be separated by each other by a hinge of two, three or more proline residues between the first and second domain(s).
- the chimeric peptide as defined above and as disclosed herein, comprising at least one first and at least one second domain, may be composed of L-amino acids, D-amino acids, or a combination of both.
- each domain (as well as the linkers used) may be composed of L-amino acids, D-amino acids, or a combination of both (e.g. D-TAT and L-IB1(s) or L-TAT and D-IB1(s), etc.).
- the chimeric peptide as disclosed herein may comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the chimeric peptide as used herein in a blockwise, a non-blockwise or in an alternate manner.
- the chimeric peptide as disclosed herein comprises or consists of the L-amino acid chimeric peptides according to the generic L-TAT-IB peptide NH 2 -X n b -RKKRRQRRR-Xn b -RPTTLXLXXXXXXQD-X n a -X n b -COOH (L-TAT-IB (generic) (s)) [SEQ ID NO: 10], wherein X, X n a and X n b are preferably as defined above.
- the non-claimed chimeric peptide as disclosed herein comprises or consists of the L-amino acid chimeric peptide NH 2 -GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQD-COOH (L-TAT-IB1 (s)) [SEQ ID NO: 9].
- the non-claimed chimeric peptide as disclosed herein comprises or consists of the L-amino acid chimeric peptide sequence GRKKRRQRRR PPDTYRPKRP TTLNLFPQVP RSQDT (L-TAT-IB1) [SEQ ID NO: 23], or XXXXXXRKK RRQRRRXXX XXXRPTTLX LXXXXXXQD S/TX (L-TAT-IB generic) [SEQ ID NO: 24], wherein X is preferably also as defined above, or the chimeric peptide as disclosed herein comprises or consists of the non-claimed L-amino acid chimeric peptide sequence RKKRRQRRRPPRPKRPTTLNLFPQVPRSQD (L-TAT-IB1 (s1)) [SEQ ID NO: 27], GRKKRRQRRRX n c RPKRPTTLNLFPQVPRSQD (L-TAT-I
- each X typically represents an amino acid residue as defined above, more preferably X n c represents a contiguous stretch of peptide residues, each X independently selected from each other from glycine or proline, e.g. a monotonic glycine stretch or a monotonic proline stretch, wherein n (the number of repetitions of X n c ) is typically 0-5, 5-10, 10-15, 15-20, 20-30 or even more, preferably 0-5 or 5-10.
- X n c may represent either D or L amino acids.
- the chimeric peptide as disclosed herein comprises or consists of D-amino acid chimeric peptides of the above disclosed L-amino acid chimeric peptides.
- Exemplary D retro-inverso chimeric peptides according to the present disclosure comprising the present invention are e.g. the generic D-TAT-IB peptide NH 2 -X n b -X n a -DQXXXXXXXLXLTTPR- X n b -RRRQRRKKR-X n b -COOH (D-TAT-IB (generic) (s)) [SEQ ID NO: 12].
- X, X n a and X n b are preferably as defined above (preferably representing D amino acids). More preferably, the chimeric peptide according to the present invention as defined above comprises or consists of D-amino acid chimeric peptides according to the TAT-IB1 peptide NH 2 -DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-COOH (D-TAT-IB1(s)) [SEQ ID NO: 11].
- the chimeric peptide as used herein comprises or consists of the D-amino acid chimeric peptide sequence
- the chimeric peptide as disclosed herein comprises or consists of the D-amino acid chimeric peptide sequence TDQSRPVQPFLNLTTPRKPRYTDPPRRRQRRKKRG (D-TAT-IB1) [SEQ ID NO: 25].
- X n c may be as defined above.
- the first and second domain(s) of the chimeric peptide as defined above may be linked to each other by chemical or biochemical coupling carried out in any suitable manner known in the art, e.g. by establishing a peptide bond between the first and the second domain(s) e.g. by expressing the first and second domain(s) as a fusion protein, or e.g. by crosslinking the first and second domain(s) of the chimeric peptide as defined above.
- one way to increasing coupling specificity is a direct chemical coupling to a functional group present only once or a few times in one or both of the first and second domain(s) to be crosslinked.
- cysteine which is the only protein amino acid containing a thiol group, occurs in many proteins only a few times.
- a crosslinking reagent specific for primary amines will be selective for the amino terminus of that polypeptide.
- Successful utilization of this approach to increase coupling specificity requires that the polypeptide have the suitably rare and reactive residues in areas of the molecule that may be altered without loss of the molecule's biological activity.
- Cysteine residues may be replaced when they occur in parts of a polypeptide sequence where their participation in a crosslinking reaction would otherwise likely interfere with biological activity.
- a cysteine residue is replaced, it is typically desirable to minimize resulting changes in polypeptide folding. Changes in polypeptide folding are minimized when the replacement is chemically and sterically similar to cysteine. For these reasons, serine is preferred as a replacement for cysteine.
- a cysteine residue may be introduced into a polypeptide's amino acid sequence for crosslinking purposes. When a cysteine residue is introduced, introduction at or near the amino or carboxy terminus is preferred. Conventional methods are available for such amino acid sequence modifications, wherein the polypeptide of interest is produced by chemical synthesis or via expression of recombinant DNA.
- Coupling of the first and second domain(s) of the chimeric peptide as defined above and disclosed herein can also be accomplished via a coupling or conjugating agent.
- a coupling or conjugating agent There are several intermolecular crosslinking reagents which can be utilized (see for example, Means and Feeney, CHEMICAL MODIFICATION OF PROTEINS, Holden-Day, 1974, pp. 39-43 ).
- N-succinimidyl 3-(2-pyridyldithio) propionate SPDP
- N,N'-(1,3-phenylene) bismaleimide both of which are highly specific for sulfhydryl groups and form irreversible linkages
- N, N'-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 11 carbon methylene bridges which are relatively specific for sulfhydryl groups
- 1,5-difluoro-2,4-dinitrobenzene which forms irreversible linkages with amino and tyrosine groups).
- crosslinking reagents useful for this purpose include: p,p'-difluoro-m, m'-dinitrodiphenylsulfone which forms irreversible crosslinkages with amino and phenolic groups); dimethyl adipimidate (which is specific for amino groups); phenol-1,4 disulfonylchloride (which reacts principally with amino groups); hexamethylenediisocyanate or diisothiocyanate, or azophenyl-p-diisocyanate (which reacts principally with amino groups); glutaraldehyde (which reacts with several different side chains) and disdiazobenzidine (which reacts primarily with tyrosine and histidine).
- Crosslinking reagents used for crosslinking the first and second domain(s) of the chimeric peptide as defined above may be homobifunctional, i.e. having two functional groups that undergo the same reaction.
- a preferred homobifunctional crosslinking reagent is bismaleimidohexane ("BMH").
- BMH contains two maleimide functional groups, which react specifically with sulfhydryl-containing compounds under mild conditions (pH 6.5-7.7). The two maleimide groups are connected by a hydrocarbon chain. Therefore, BMH is useful for irreversible crosslinking of polypeptides that contain cysteine residues.
- Crosslinking reagents used for crosslinking the first and second domain(s) of the chimeric peptide as defined above may also be heterobifunctional.
- Heterobifunctional crosslinking agents have two different functional groups, for example an amine-reactive group and a thiol-reactive group, that will crosslink two proteins having free amines and thiols, respectively.
- heterobifunctional crosslinking agents are succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate (“SMCC”), m-maleimidobenzoyl-N-hydroxysuccinimide ester (“MBS”), and succinimide 4-(p-maleimidophenyl)butyrate (“SMPB”), an extended chain analog of MBS.
- SMCC succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate
- MBS m-maleimidobenzoyl-N-hydroxysuccinimide ester
- SMPB succinimide 4-(p-maleimidophenyl)butyrate
- Crosslinking reagents suitable for crosslinking the first and second domain(s) of the chimeric peptide as defined above often have low solubility in water.
- a hydrophilic moiety, such as a sulfonate group, may thus be added to the crosslinking reagent to improve its water solubility.
- Sulfo-MBS and Sulfo-SMCC are examples of crosslinking reagents modified for water solubility, which may be used according to the present invention.
- crosslinking reagents yield a conjugate that is essentially non-cleavable under cellular conditions.
- some crosslinking reagents particularly suitable for crosslinking the first and second domain(s) of the chimeric peptide as defined above contain a covalent bond, such as a disulfide, that is cleavable under cellular conditions.
- a covalent bond such as a disulfide
- DSP dithiobis(succinimidylpropionate)
- SPDP N-succinimidyl 3-(2-pyridyldithio)propionate
- the use of a cleavable crosslinking reagent permits the cargo moiety to separate from the transport polypeptide after delivery into the target cell. Direct disulfide linkage may also be useful.
- crosslinking reagents including the ones discussed above, are commercially available. Detailed instructions for their use are readily available from the commercial suppliers. A general reference on protein crosslinking and conjugate preparation is: Wong, CHEMISTRY OF PROTEIN CONJUGATION AND CROSSLINKING, CRC Press (1991 ).
- Chemical crosslinking of the first and second domain(s) of the chimeric peptide as defined above may include the use of spacer arms.
- Spacer arms provide intramolecular flexibility or adjust intramolecular distances between conjugated moieties and thereby may help preserve biological activity.
- a spacer arm may be in the form of a polypeptide moiety that includes spacer amino acids, e.g. proline.
- a spacer arm may be part of the crosslinking reagent, such as in "long-chain SPDP" (Pierce Chem. Co., Rockford, IL., cat. No. 21651 H).
- variants, fragments or derivatives of one of the above disclosed chimeric peptides may be used herein.
- fragments and variants it is generally referred to the definition given above for JNK inhibitor sequences.
- a "variant of a chimeric peptide” is preferably a sequence derived from any of the sequences according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the chimeric variant comprises amino acid alterations of the chimeric peptides according to SEQ ID NOs: 9 to 12 and 23 to 32 as used herein.
- Such alterations typically comprise 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions (leading to fragments) of amino acids according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the altered chimeric peptide as used herein exhibits a sequence identity with any of the sequences according to SEQ ID NOs: 9-12 and 23 to 32 of at least about 30%, 50%, 70%, 80%, or 95%, 98%, or even 99%.
- these variants retain the biological activity of the first and the second domain as contained in the chimeric peptide as used herein, i.e. the trafficking activity of the first domain as disclosed above and the activity of the second domain for binding JNK and/or inhibiting the activation of at least one JNK activated transcription factor.
- the chimeric peptide as disclosed herein also comprises fragments of the afore disclosed chimeric peptides, particularly of the chimeric peptide sequences according to any of SEQ ID NOs: 9 to 12 and 23 to 32.
- a "fragment of the chimeric peptide" is preferably a sequence derived any of the sequences according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the fragment comprises at least 4 contiguous amino acids of any of SEQ ID NOs: 9 to 12 and 23 to 32.
- This fragment preferably comprises a length which is sufficient to allow specific recognition of an epitope from any of these sequences and to transport the sequence into the cells, the nucleus or a further preferred location. Even more preferably, the fragment comprises 4 to 18, 4 to 15, or most preferably 4 to 10 contiguous amino acids of any of SEQ ID NOs: 9 to 12 and 23 to 32. Fragments of the chimeric peptide as used herein further may be defined as a sequence sharing a sequence identity with any of the sequences according to any of SEQ ID NOs: 99 to 12 and 23 to 32 of at least about 30%, 50%, 70%, 80%, or 95%, 98%, or even 99%.
- the chimeric peptide as disclosed herein also comprises derivatives of the afore disclosed chimeric peptides, particularly of the chimeric peptide sequences according to any of SEQ ID NOs: 9 to 12 and 23 to 32.
- JNK inhibitor poly-
- SEQ ID NO: 11 a JNK inhibitor (poly-)peptide consisting of or comprising the amino acid sequence of SEQ ID NO: 11, or consisting of or comprising an amino acid sequence sharing a sequence identity of at least about 30%, 50%, 70%, 80%, 90%, 92% or even 95% with SEQ ID NO: 11, for the treatment of inflammatory eye diseases, in particular for the treatment of uveitis, for example for the treatment of anterior uveitis, intermediate uveitis, posterior uveitis or panuveitis.
- the JNK inhibitor (poly-)peptide consisting of or comprising the amino acid sequence of SEQ ID NO: 11, or consisting of or comprising an amino acid sequence sharing a sequence identity of at least about 30%, 50%, 70%, 80%, 90%, 92% or even 95% with SEQ ID NO: 11 may be administered for example locally to the eye or systemically.
- the present application also clearly discloses the use of other JNK inhibitor chimeric (poly-)peptides, i.e.
- JNK inhibitor poly-)peptide used does not consist of or comprise the amino acid sequence of SEQ ID NO: 11 for the treatment of inflammatory eye diseases, in particular for the treatment of uveitis, for example for the treatment of anterior uveitis, intermediate uveitis, posterior uveitis or panuveitis.
- the inventors clearly contemplate the use of the JNK inhibitor (poly-)peptides of the present invention, in particular where the JNK inhibitor poly-)peptide used consists of or comprises the amino acid sequence of SEQ ID NO: 11 or consists of or comprises an amino acid sequence sharing a sequence identity of at least 90%, 92% or even 95% with SEQ ID NO: 11, for the treatment of intraocular inflammation after eye surgery or eye trauma.
- the present disclosure additionally refers to the use of nucleic acid sequences encoding JNK inhibitor sequences as defined above, chimeric peptides or their fragments, variants or derivatives, all as defined above, for the preparation of a pharmaceutical composition for treating non-chronic or chronic inflammatory eye diseases in a subject as defined herein.
- a preferable suitable nucleic acid encoding an JNK inhibitor sequence as used herein is typically chosen from human IB1 nucleic acid (GenBank Accession No. (AF074091), rat IB1 nucleic acid (GenBank Accession No. AF 108959), or human IB2 (GenBank Accession No AF218778) or from any nucleic acid sequence encoding any of the sequences as defined above, i.e. any sequence according to SEQ ID NO: 1-26.
- Nucleic acids encoding the JNK inhibitor sequences as used herein or chimeric peptides as used herein may be obtained by any method known in the art (e.g. by PCR amplification using synthetic primers hybridizable to the 3'- and 5'-termini of the sequence and/or by cloning from a cDNA or genomic library using an oligonucleotide sequence specific for the given gene sequence).
- nucleic acid sequences are disclosed herein as well, which hybridize under stringent conditions with the appropriate strand coding for a (native) JNK inhibitor sequence or chimeric peptide as defined above.
- nucleic acid sequences comprise at least 6 (contiguous) nucleic acids, which have a length sufficient to allow for specific hybridization. More preferably, such nucleic acid sequences comprise 6 to 38, even more preferably 6 to 30, and most preferably 6 to 20 or 6 to 10 (contiguous) nucleic acids.
- stringent conditions are sequence dependent and will be different under different circumstances. Generally, stringent conditions can be selected to be about 5°C lower than the thermal melting point (TM) for the specific sequence at a defined ionic strength and pH. The TM is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is at least about 0.02 molar at pH 7 and the temperature is at least about 60°C. As other factors may affect the stringency of hybridization (including, among others, base composition and size of the complementary strands), the presence of organic solvents and the extent of base mismatching, the combination of parameters is more important than the absolute measure of any one.
- High stringency conditions may comprise the following, e.g. Step 1: Filters containing DNA are pretreated for 8 hours to overnight at 65°C in buffer composed of 6*SSC, 50 mM Tris-HCI (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 ⁇ g/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 48 hours at 65°C. in the above prehybridization mixture to which is added 100 mg/ml denatured salmon sperm DNA and 5-20*10 6 cpm of 32 P-labeled probe.
- Step 3 Filters are washed for 1 hour at 37°C in a solution containing 2*SSC, 0.01% PVP, 0.01% Ficoll, and 0.01% BSA. This is followed by a wash in 0.1*SSC at 50°C for 45 minutes.
- Step 4 Filters are autoradiographed. Other conditions of high stringency that may be used are well known in the art (see e.g. Ausubel et al., (eds.), 1993, Current Protocols in Molecular Biology, John Wiley and Sons, NY ; and Kriegler, 1990, Gene Transfer and Expression, a Laboratory Manual, Stockton Press, NY ).
- Moderate stringency conditions can include the following: Step 1: Filters containing DNA are pretreated for 6 hours at 55°C. in a solution containing 6*SSC, 5*Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 18-20 hours at 55°C in the same solution with 5-20*10 6 cpm 32 P-labeled probe added. Step 3: Filters are washed at 37°C for 1 hour in a solution containing 2*SSC, 0.1% SDS, then washed twice for 30 minutes at 60°C in a solution containing 1*SSC and 0.1% SDS. Step 4: Filters are blotted dry and exposed for autoradiography.
- low stringency conditions can include: Step 1: Filters containing DNA are pretreated for 6 hours at 40°C in a solution containing 35% formamide, 5X SSC, 50 mM Tris-HCI (pH 7.5), 5 mM EDTA, 0.1% PVP, 0.1% Ficoll, 1% BSA, and 500 ⁇ g/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 18-20 hours at 40°C in the same solution with the addition of 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 ⁇ g/ml salmon sperm DNA, 10% (wt/vol) dextran sulfate, and 5-20 x 106 cpm 32 P-labeled probe.
- Step 3 Filters are washed for 1.5 hours at 55 C in a solution containing 2X SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS. The wash solution is replaced with fresh solution and incubated an additional 1.5 hours at 60°C.
- Step 4 Filters are blotted dry and exposed for autoradiography. If necessary, filters are washed for a third time at 65-68°C and reexposed to film.
- Other conditions of low stringency that may be used are well known in the art (e.g. as employed for cross-species hybridizations). See e.g.
- nucleic acid sequences as defined above can be used to express peptides, i.e. an JNK inhibitor sequence as used herein or an chimeric peptide as used herein for analysis, characterization or therapeutic use; as markers for tissues in which the corresponding peptides (as used herein) are preferentially expressed (either constitutively or at a particular stage of tissue differentiation or development or in disease states).
- Other uses for these nucleic acids include, e.g. molecular weight markers in gel electrophoresis-based analysis of nucleic acids.
- expression vectors may be used for the above purposes for recombinant expression of one or more JNK inhibitor sequences and/or chimeric peptides as defined above.
- expression vector is used herein to designate either circular or linear DNA or RNA, which is either double-stranded or single-stranded. It further comprises at least one nucleic acid as defined above to be transferred into a host cell or into a unicellular or multicellular host organism.
- the expression vector as disclosed herein preferably comprises a nucleic acid as defined above encoding the JNK inhibitor sequence as disclosed herein or a fragment or a variant thereof, or the chimeric peptide as disclosed herein, or a fragment or a variant thereof.
- an expression vector as disclosed herein preferably comprises appropriate elements for supporting expression including various regulatory elements, such as enhancers/promoters from viral, bacterial, plant, mammalian, and other eukaryotic sources that drive expression of the inserted polynucleotide in host cells, such as insulators, boundary elements, LCRs (e.g. described by Blackwood and Kadonaga (1998), Science 281, 61-63 ) or matrix/scaffold attachment regions (e.g. described by Li, Harju and Peterson, (1999), Trends Genet. 15, 403-408 ).
- the regulatory elements are heterologous (i.e. not the native gene promoter).
- the necessary transcriptional and translational signals may also be supplied by the native promoter for the genes and/or their flanking regions.
- promoter refers to a region of DNA that functions to control the transcription of one or more nucleic acid sequences as defined above, and that is structurally identified by the presence of a binding site for DNA-dependent RNA-polymerase and of other DNA sequences, which interact to regulate promoter function.
- a functional expression promoting fragment of a promoter is a shortened or truncated promoter sequence retaining the activity as a promoter.
- Promoter activity may be measured by any assay known in the art (see e.g. Wood, de Wet, Dewji, and DeLuca, (1984), Biochem Biophys. Res. Commun. 124, 592-596 ; Seliger and McElroy, (1960), Arch. Biochem. Biophys. 88, 136-141 ) or commercially available from Promega®).
- an “enhancer region” to be used in the expression vector as defined herein typically refers to a region of DNA that functions to increase the transcription of one or more genes. More specifically, the term “enhancer”, as used herein, is a DNA regulatory element that enhances, augments, improves, or ameliorates expression of a gene irrespective of its location and orientation vis-à-vis the gene to be expressed, and may be enhancing, augmenting, improving, or ameliorating expression of more than one promoter.
- promoter/enhancer sequences to be used in the expression vector as defined herein may utilize plant, animal, insect, or fungus regulatory sequences.
- promoter/enhancer elements can be used from yeast and other fungi (e.g. the GAL4 promoter, the alcohol dehydrogenase promoter, the phosphoglycerol kinase promoter, the alkaline phosphatase promoter).
- yeast and other fungi e.g. the GAL4 promoter, the alcohol dehydrogenase promoter, the phosphoglycerol kinase promoter, the alkaline phosphatase promoter.
- they may include animal transcriptional control regions, e.g. (i) the insulin gene control region active within pancreatic beta-cells (see e.g. Hanahan, et al., 1985.
- the expression vector as defined herein may comprise an amplification marker.
- This amplification marker may be selected from the group consisting of, e.g. adenosine deaminase (ADA), dihydrofolate reductase (DHFR), multiple drug resistance gene (MDR), ornithine decarboxylase (ODC) and N-(phosphonacetyl)-L-aspartate resistance (CAD).
- Exemplary expression vectors or their derivatives suitable in the context of the present disclosure particularly include, e.g. human or animal viruses (e.g. vaccinia virus or adenovirus); insect viruses (e.g. baculovirus); yeast vectors; bacteriophage vectors (e.g. lambda phage); plasmid vectors and cosmid vectors.
- human or animal viruses e.g. vaccinia virus or adenovirus
- insect viruses e.g. baculovirus
- yeast vectors e.g. bacteriophage vectors (e.g. lambda phage); plasmid vectors and cosmid vectors.
- the present application additionally discloses a variety of non-claimed host-vector systems, which are capable of expressing the peptide coding sequence(s) of nucleic acids as defined above.
- host-vector systems which are capable of expressing the peptide coding sequence(s) of nucleic acids as defined above.
- These include, but are not limited to: (i) mammalian cell systems that are infected with vaccinia virus, adenovirus, and the like; (ii) insect cell systems infected with baculovirus and the like; (iii) yeast containing yeast vectors or (iv) bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA.
- any one of a number of suitable transcription and translation elements may be used.
- a host cell strain suitable for such a host-vector system, may be selected that modulates the expression of inserted sequences of interest, or modifies or processes expressed peptides encoded by the sequences in the specific manner desired.
- expression from certain promoters may be enhanced in the presence of certain inducers in a selected host strain; thus facilitating control of the expression of a genetically-engineered peptide.
- different host cells possess characteristic and specific mechanisms for the translational and post-translational processing and modification (e.g. glycosylation, phosphorylation, and the like) of expressed peptides. Appropriate cell lines or host systems may thus be chosen to ensure the desired modification and processing of the foreign peptide is achieved. For example, peptide expression within a bacterial system can be used to produce an non-glycosylated core peptide; whereas expression within mammalian cells ensures "native" glycosylation of a heterologous peptide.
- the present application further discloses the non-claimeduse of antibodies directed against the JNK inhibitor sequences and/or chimeric peptides as described above, for preparing a pharmaceutical composition for the treatment of non-chronic or chronic inflammatory eye diseases as defined herein. Furthermore, efficient means for production of antibodies specific for JNK inhibitor sequences as disclosed herein, or for chimeric peptides containing such an inhibitor sequence, are described and may be utilized for this purpose.
- JNK inhibitor sequences and/or chimeric peptides as defined herein, as well as, fragments, variants or derivatives thereof, may be utilized as immunogens to generate antibodies that immunospecifically bind these peptide components.
- Such antibodies include, e.g. polyclonal, monoclonal, chimeric, single chain, Fab fragments and a Fab expression library.
- the present application discloses antibodies to chimeric peptides or to JNK inhibitor sequences as defined above. Various procedures known within the art may be used for the production of these antibodies.
- various host animals may be immunized for production of polyclonal antibodies by injection with any chimeric peptide or JNK inhibitor sequence as defined above.
- Various adjuvants may be used thereby to increase the immunological response which include, but are not limited to, Freund's (complete and incomplete) adjuvant, mineral gels (e.g. aluminum hydroxide), surface active substances (e.g. lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), CpG, polymers, Pluronics, and human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum.
- any technique may be utilized that provides for the production of antibody molecules by continuous cell line culture.
- Such techniques include, but are not limited to, the hybridoma technique (see Kohler and Milstein, 1975. Nature 256: 495-497 ); the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al., 1983, Immunol Today 4: 72 ) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985. In: Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96 ).
- Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by the use of human hybridomas (see Cote, et al., 1983. Proc Natl Acad Sci USA 80: 2026-2030 ) or by transforming human B-cells with Epstein Barr Virus in vitro (see Cole, et al., 1985. In: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., pp. 77-96 ).
- techniques can be adapted for the production of single-chain antibodies specific to the JNK inhibitor sequences and/or chimeric peptides (see e.g. U. S. Patent No. 4,946,778 ) as defined herein.
- methods can be adapted for the construction of Fab expression libraries (see e.g. Huse et al., 1989. Science 246: 1275-1281 ) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for these JNK inhibitor sequences and/or chimeric peptides.
- Non-human antibodies can be "humanized" by techniques well known in the art (see e.g. U. S. Patent No. 5,225,539 ).
- Antibody fragments that contain the idiotypes to a JNK inhibitor sequences and/or chimeric peptide as defined herein may be produced by techniques known in the art including, e.g. (i) a F(ab') 2 fragment produced by pepsin digestion of an antibody molecule; (ii) a Fab fragment generated by reducing the disulfide bridges of an F(ab') 2 fragment ; (iii) a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent and (iv) Fv fragments.
- ELISA enzyme-linked immunosorbent assay
- selection of antibodies that are specific to a particular epitope of an JNK inhibitor sequence and/or an chimeric peptide as defined herein may be facilitated by generation of hybridomas that bind to the fragment of an JNK inhibitor sequence and/or an chimeric peptide, as defined herein, possessing such an epitope.
- ELISA enzyme-linked immunosorbent assay
- the antibodies as defined herein may be used in methods known within the art referring to the localization and/or quantification of an JNK inhibitor sequence (and/or correspondingly to a chimeric peptide as defined above), e.g. for use in measuring levels of the peptide within appropriate physiological samples, for use in diagnostic methods, or for use in imaging the peptide, and the like.
- JNK inhibitor sequences, chimeric peptides, nucleic acids, vectors, host cells and/or antibodies as defined according to the present disclosure comprising the present invention can be formulated in a pharmaceutical composition, which may be applied in the prevention or treatment of any of the diseases as defined herein, particularly in the prevention or treatment of non-chronic or chronic inflammatory eye diseases as defined herein.
- such a pharmaceutical composition used according to the present disclosure comprising the present invention includes as an active component, e.g.: (i) any one or more of the JNK inhibitor sequences and/or chimeric peptides as defined above, and/or variants, fragments or derivatives thereof, particularly JNK inhibitor sequences according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or chimeric peptides according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or JNK inhibitor sequences according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions; and/or (ii) nucleic acids encoding an JNK inhibitor sequence and/or an chimeric peptide as defined above and/or variants or fragments thereof, and/or (iii) cells comprising
- such a pharmaceutical composition as used according to the present disclosure comprising the present invention typically comprises a safe and effective amount of a component as defined above, preferably of at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5-8 and 21 to 22, or variants or fragments thereof within the above definitions, or at least one nucleic acids encoding same, or at least one vector, host cell or antibody as defined above.
- a component as defined above preferably of at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any
- the amount of a JNK-inhibitor sequence and chimeric peptide, respectively, in the pharmaceutical composition to be administered to a subject may -without being limited thereto - have a very low dose.
- the dose may be much lower than for peptide drugs known in the art, such as DTS-108 ( Florence Meyer-Losic et al., Clin Cancer Res., 2008, 2145-53 ). This has several positive aspects, for example a reduction of potential side reactions and a reduction in costs.
- the dose (per kg bodyweight) is in the range of up to 10 mmol/kg, preferably up to 1 mmol/kg, more preferably up to 100 ⁇ mol/kg, even more preferably up to 10 ⁇ mol/kg, even more preferably up to 1 ⁇ mol/kg, even more preferably up to 100 nmol/kg, most preferably up to 50 nmol/kg.
- the dose range may preferably be from about 1 pmol/kg to about 1 mmol/kg, from about 10 pmol/kg to about 0,1 mmol/kg, from about 10 pmol/kg to about 0,01 mmol/kg, from about 50 pmol/kg to about 1 ⁇ mol/kg, from about 100 pmol/kg to about 500 nmol/kg, from about 200 pmol/kg to about 300 nmol/kg, from about 300 pmol/kg to about 100 nmol/kg, from about 500 pmol/kg to about 50 nmol/kg, from about 750 pmol/kg to about 30 nmol/kg, from about 250 pmol/kg to about 5 nmol/kg, from about 1 nmol/kg to about 10 nmol/kg, or a combination of any two of said values.
- Exemplary doses of a JNK-inhibitor according to SEQ ID NO: 30 may be for example about 10, 50 or 100 ⁇ g/kg.
- a "safe and effective amount" as defined above for components of the pharmaceutical compositions as used according to the present disclosure comprising the present invention means an amount of each or all of these components, that is sufficient to significantly induce a positive modification of a non-chronic or chronic inflammatory eye diseases as defined herein.
- a "safe and effective amount” is small enough to avoid serious side-effects, that is to say to permit a sensible relationship between advantage and risk. The determination of these limits typically lies within the scope of sensible medical judgment.
- a "safe and effective amount” of such a component will vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
- the pharmaceutical compositions according to the invention can be used according to the invention for human and also for veterinary medical purposes.
- composition as used according to the present invention may furthermore comprise, in addition to one of these substances, a (compatible) pharmaceutically acceptable carrier, excipient, buffer, stabilizer or other materials well known to those skilled in the art.
- the expression "(compatible) pharmaceutically acceptable carrier” preferably includes the liquid or non-liquid basis of the composition.
- compatible means that the constituents of the pharmaceutical composition as used herein are capable of being mixed with the pharmaceutically active component as defined above and with one another component in such a manner that no interaction occurs which would substantially reduce the pharmaceutical effectiveness of the composition under usual use conditions.
- Pharmaceutically acceptable carriers must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a person to be treated.
- the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable liquid carriers.
- the composition may comprise as (compatible) pharmaceutically acceptable liquid carriers e.g. pyrogen-free water; isotonic saline or buffered (aqueous) solutions, e.g. phosphate, citrate etc. buffered solutions, vegetable oils, such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma; polyols, such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid, etc.
- a buffer preferably an aqueous buffer, may be used.
- the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable solid carriers.
- the composition may comprise as (compatible) pharmaceutically acceptable solid carriers e.g. one or more compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well, which are suitable for administration to a person.
- suitable pharmaceutically acceptable solid carriers are e.g.
- sugars such as, for example, lactose, glucose and sucrose
- starches such as, for example, corn starch or potato starch
- cellulose and its derivatives such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate
- powdered tragacanth malt
- gelatin gelatin
- tallow solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulphate, etc.
- the precise nature of the (compatible) pharmaceutically acceptable carrier or other material may depend on the route of administration.
- the choice of a (compatible) pharmaceutically acceptable carrier may thus be determined in principle by the manner in which the pharmaceutical composition as used according to the invention is administered.
- the pharmaceutical composition as used according to the invention can be administered, for example, systemically.
- Routes for administration include, for example, parenteral routes (e.g. via injection), such as intravenous, intramuscular, subcutaneous, intradermal, or transdermal routes, etc., enteral routes, such as oral, or rectal routes, etc., topical routes, such as nasal, or intranasal routes, etc., or other routes, such as epidermal routes or patch delivery.
- parenteral routes e.g. via injection
- enteral routes such as oral, or rectal routes, etc.
- topical routes such as nasal, or intranasal routes, etc.
- epidermal routes or patch delivery Partiularly preferred is also the local administration at/in the eye, e
- the compounds for use in the present invention are used for the treatment of intraocular inflammation after eye surgery or trauma and in particular of inflamed wounds and wound edges.
- intraocular inflammation but not limited thereto - subconjuntival administration and/or a single intravenous infusion administration is particularly contemplated by the inventors.
- the standard treatment of ocular inflammation is, at present, administration of (cortico-)steroids in the form of drops or eye ointments.
- the administration of corticosteroids should be repeated often and is not without side effects.
- intravenous or subconjunctival administration of corticosteroids is sometimes necessary. Therefore, the present disclosure comprising the present invention also relates to the use of the JNK inhibitor sequences, chimeric peptides, nucleic acid sequences or antibodies to JNK inhibitor sequences or to chimeric peptides as defined herein, e.g.
- an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, in a method of treatment of non-chronic or chronic inflammatory eye diseases, wherein the method comprises the combined administration of the JNK inhibitor sequences, chimeric peptides, nucleic acid sequences or antibodies to JNK inhibitor sequences or to chimeric peptides as defined herein together with steroids (e.g.
- Combined administration comprises the parallel administration and/or subsequent administration (either first the JNK inhibitor described herein and then the (cortico)steroids or vice versa).
- subsequent and parallel administration may also be combined, e.g. the treatment is started with JNK inhibitors described herein and at a later point in time in the course of the treatment (cortico)steroids are given in parallel.
- the suitable amount of the pharmaceutical composition to be used can be determined by routine experiments with animal models. Such models include, without implying any limitation, rabbit, sheep, mouse, rat, dog and non-human primate models.
- Preferred unit dose forms for injection include sterile solutions of water, physiological saline or mixtures thereof. The pH of such solutions should be adjusted to about 7.4.
- Suitable carriers for injection include hydrogels, devices for controlled or delayed release, polylactic acid and collagen matrices.
- Suitable pharmaceutically acceptable carriers for topical application include those, which are suitable for use in lotions, creams, gels and the like. If the compound is to be administered perorally, tablets, capsules and the like are the preferred unit dose form.
- the pharmaceutically acceptable carriers for the preparation of unit dose forms which can be used for oral administration are well known in the prior art. The choice thereof will depend on secondary considerations such as taste, costs and storability, which are not critical for the purposes of the present invention, and can be made without difficulty by a person skilled in the art.
- compositions for oral administration may be in tablet, capsule, powder or liquid form.
- a tablet may include a solid carrier as defined above, such as gelatin, and optionally an adjuvant.
- Liquid pharmaceutical compositions for oral administration generally may include a liquid carrier as defined above, such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
- the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a "prophylactically effective amount or a "therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a proliferatively effective amount or a "therapeutically effective amount” (as the case may be)
- the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated.
- Prevention and/or treatment of a disease as defined herein typically includes administration of a pharmaceutical composition as defined above.
- the term "modulate” includes the suppression of expression of JNK when it is over-expressed in any of the above diseases. It also includes, without being limited thereto, suppression of phosphorylation of c-jun, ATF2 or NFAT4 in any of the above diseases, for example, by using at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, as a competitive inhibitor of the natural c-jun, ATF2 and NFAT4 binding
- modulate also includes suppression of hetero- and homomeric complexes of transcription factors made up of, without being limited thereto, c-jun, ATF2, or NFAT4 and their related partners, such as for example the AP-1 complex that is made up of c-jun, AFT2 and c-fos.
- suppressive JNK inhibitor sequences can be introduced to a cell.
- modulate may then include the increase of JNK expression, for example by use of an IB peptide-specific antibody that blocks the binding of an IB-peptide to JNK, thus preventing JNK inhibition by the IB-related peptide.
- Prevention and/or treatment of a subject with the pharmaceutical composition as disclosed above may be typically accomplished by administering ( in vivo ) an ("therapeutically effective") amount of said pharmaceutical composition to a subject, wherein the subject may be e.g. any mammal, e.g. a human, a primate, mouse, rat, dog, cat, cow, horse or pig.
- therapeutically effective means that the active component of the pharmaceutical composition is of sufficient quantity to ameliorate the non-chronic or chronic inflammatory eye disease.
- peptides as defined above e.g. at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, may be utilized to treat non-chronic or chronic inflammatory eye diseases.
- Peptides as defined above and as contained in the inventive pharmaceutical composition may be also encoded by nucleic acids. This is particularly advantageous, if the above peptides are administered for the purpose of gene therapy.
- gene therapy refers to therapy that is performed by administration of a specific nucleic acid as defined above to a subject, e.g. by way of a pharmaceutical composition as defined above, wherein the nucleic acid(s) exclusively comprise(s) L-amino acids.
- the nucleic acid produces its encoded peptide(s), which then serve(s) to exert a therapeutic effect by modulating function of the disease or disorder.
- Any of the methods relating to gene therapy available within the art may be used in the practice of the present invention (see e.g. Goldspiel, et al., 1993. Clin Pharm 12: 488-505 ).
- the nucleic acid as defined above and as used for gene therapy is part of an expression vector encoding and expressing any one or more of the IB-related peptides as defined above within a suitable host, i.e. an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions.
- a suitable host i.e. an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to
- such an expression vector possesses a promoter that is operably-linked to coding region(s) of a JNK inhibitor sequence.
- the promoter may be defined as above, e.g. inducible or constitutive, and, optionally, tissue-specific.
- a nucleic acid molecule as defined above is used for gene therapy, in which the coding sequences of the nucleic acid molecule (and any other desired sequences thereof) as defined above are flanked by regions that promote homologous recombination at a desired site within the genome, thus providing for intra-chromosomal expression of these nucleic acids (see e.g. Koller and Smithies, 1989. Proc Natl Acad Sci USA 86: 8932-8935 ).
- nucleic acid as defined above into a patient for the purpose of gene therapy may be either direct (i.e. the patient is directly exposed to the nucleic acid or nucleic acid-containing vector) or indirect (i.e. cells are first transformed with the nucleic acid in vitro, then transplanted into the patient). These two approaches are known, respectively, as in vivo or ex vivo gene therapy.
- a nucleic acid is directly administered in vivo, where it is expressed to produce the encoded product. This may be accomplished by any of numerous methods known in the art including, e.g.
- nucleic acid as part of an appropriate nucleic acid expression vector and administering the same in a manner such that it becomes intracellular (e.g. by infection using a defective or attenuated retroviral or other viral vector; see U. S. Patent No. 4,980,286 ); directly injecting naked DNA; using microparticle bombardment (e.g.
- a "GeneGun” Biolistic, DuPont
- coating the nucleic acids with lipids using associated cell-surface receptors/transfecting agents; encapsulating in liposomes, microparticles, or microcapsules; administering it in linkage to a peptide that is known to enter the nucleus; or by administering it in linkage to a ligand predisposed to receptor-mediated endocytosis (see e.g. Wu and Wu, 1987.J Biol Chem 262: 4429-4432 ), which can be used to "target" cell types that specifically express the receptors of interest, etc.
- An additional approach to gene therapy in the practice of the present disclosure involves transferring a nucleic acid as defined above into cells in in vitro tissue culture by such methods as electroporation, lipofection, calcium phosphate-mediated transfection, viral infection, or the like.
- the method of transfer includes the concomitant transfer of a selectable marker to the cells.
- the cells are then placed under selection pressure (e.g. antibiotic resistance) so as to facilitate the isolation of those cells that have taken up, and are expressing, the transferred gene.
- selection pressure e.g. antibiotic resistance
- Those cells are then delivered to a patient.
- the nucleic acid prior to the in vivo administration of the resulting recombinant cell, the nucleic acid is introduced into a cell by any method known within the art including e.g.
- transfection electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences of interest, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, and similar methods that ensure that the necessary developmental and physiological functions of the recipient cells are not disrupted by the transfer. See e.g. Loeffler and Behr, 1993. Meth Enzymol 217 : 599-618 .
- the chosen technique should provide for the stable transfer of the nucleic acid to the cell, such that the nucleic acid is expressible by the cell.
- the transferred nucleic acid is heritable and expressible by the cell progeny.
- the resulting recombinant cells may be delivered to a patient by various methods known within the art including, e.g. injection of epithelial cells (e.g. subcutaneously), application of recombinant skin cells as a skin graft onto the patient, and intravenous injection of recombinant blood cells (e.g. hematopoietic stem or progenitor cells).
- epithelial cells e.g. subcutaneously
- recombinant skin cells as a skin graft onto the patient
- recombinant blood cells e.g. hematopoietic stem or progenitor cells.
- the total amount of cells that are envisioned for use depend upon the desired effect, patient state, and the like, and may be determined by one skilled within the art.
- Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and may be xenogeneic, heterogeneic, syngeneic, or autogeneic.
- Cell types include, but are not limited to, differentiated cells such as epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes and blood cells, or various stem or progenitor cells, in particular embryonic heart muscle cells, liver stem cells (International Patent Publication WO 94/08598 ), neural stem cells ( Stemple and Anderson, 1992,Cell 71 : 973-985 ), hematopoietic stem or progenitor cells, e.g. as obtained from bone marrow, umbilical cord blood, peripheral blood, fetal liver, and the like.
- the cells utilized for gene therapy are autologous to the patient.
- targeting therapies may be used to deliver the JNK inhibitor sequences, chimeric peptides, and/or nucleic acids as defined above more specifically to certain types of cell, by the use of targeting systems such as (a targeting) antibody or cell specific ligands.
- targeting systems such as (a targeting) antibody or cell specific ligands.
- Antibodies used for targeting are typically specific for cell surface proteins of cells associated with any of the diseases as defined below.
- these antibodies may be directed to cell surface antibodies such as e.g. B cell-associated surface proteins such as MHC class II DR protein, CD18 (LFA-1 beta chain), CD45RO, CD40 or Bgp95, or cell surface proteins selected from e.g.
- Targeting constructs may be typically prepared by covalently binding the JNK inhibitor sequences, chimeric peptides, and nucleic acids as defined herein according to the present disclosure comprising the present invention to an antibody specific for a cell surface protein or by binding to a cell specific ligand.
- Proteins may e.g. be bound to such an antibody or may be attached thereto by a peptide bond or by chemical coupling, crosslinking, etc..
- the targeting therapy may then be carried out by administering the targeting construct in a pharmaceutically efficient amount to a patient by any of the administration routes as defined below, e.g. intraperitoneal, nasal, intravenous, oral and patch delivery routes.
- the JNK inhibitor sequences, chimeric peptides, or nucleic acids as defined herein according to the present disclosure comprising the present invention, being attached to the targeting antibodies or cell specific ligands as defined above may be released in vitro or in vivo, e.g. by hydrolysis of the covalent bond, by peptidases or by any other suitable method.
- the JNK inhibitor sequences, chimeric peptides, or nucleic acids as defined herein according to the present disclosure comprising the present invention are attached to a small cell specific ligand, release of the ligand may not be carried out. If present at the cell surface, the chimeric peptides may enter the cell upon the activity of its trafficking sequence. Targeting may be desirable for a variety of reasons; for example if the JNK inhibitor sequences, chimeric peptides, and nucleic acids as defined herein according to the present disclosure comprising the present invention are unacceptably toxic or if it would otherwise require a too high dosage.
- the JNK inhibitor sequences and/or chimeric peptides as defined herein according to the present disclosure could be produced in the target cells by expression from an encoding gene introduced into the cells, e.g. from a viral vector to be administered.
- the viral vector typically encodes the JNK inhibitor sequences and/or chimeric peptides as defined herein according to the present disclosure comprising the present invention.
- the vector could be targeted to the specific cells to be treated.
- the vector could contain regulatory elements, which are switched on more or less selectively by the target cells upon defined regulation.
- This technique represents a variant of the VDEPT technique (virus-directed enzyme prodrug therapy), which utilizes mature proteins instead of their precursor forms.
- the JNK inhibitor sequences and/or chimeric peptides as defined herein could be administered in a precursor form by use of an antibody or a virus. These JNK inhibitor sequences and/or chimeric peptides may then be converted into the active form by an activating agent produced in, or targeted to, the cells to be treated.
- an activating agent produced in, or targeted to, the cells to be treated.
- This type of approach is sometimes known as ADEPT (antibody-directed enzyme prodrug therapy) or VDEPT (virus-directed enzyme prodrug therapy); the former involving targeting the activating agent to the cells by conjugation to a cell-specific antibody, while the latter involves producing the activating agent, e.g. a JNK inhibitor sequence or the chimeric peptide, in a vector by expression from encoding DNA in a viral vector (see for example, EP-A-415731 and WO 90/07936 ).
- immunoassays to detect, prognose, diagnose, or monitor various conditions and disease states selected from non-chronic or chronic inflammatory eye diseases as defined above, or monitor the treatment thereof.
- the immunoassay may be performed by a method comprising contacting a sample derived from a patient with an antibody to an JNK inhibitor sequence, a chimeric peptide, or a nucleic acid sequence, as defined above, under conditions such that immunospecific-binding may occur, and subsequently detecting or measuring the amount of any immunospecific-binding by the antibody.
- an antibody specific for an JNK inhibitor sequence, a chimeric peptide or a nucleic acid sequence may be used to analyze a tissue or serum sample from a patient for the presence of JNK or a JNK inhibitor sequence; wherein an aberrant level of JNK is indicative of a diseased condition.
- the immunoassays include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western Blots, radioimmunoassays (RIA), enzyme linked immunosorbent assay (ELISA), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, fluorescent immunoassays, complement-fixation assays, immunoradiometric assays, and protein-A immunoassays, etc..
- ( in vitro ) assays may be performed by delivering the JNK inhibitor sequences, chimeric peptides, nucleic acid sequences or antibodies to JNK inhibitor sequences or to chimeric peptides, as defined above, to target cells typically selected from e.g. cultured animal cells, human cells or micro-organisms, and to monitor the cell response by biophysical methods typically known to a skilled person.
- the target cells typically used therein may be cultured cells ( in vitro ) or in vivo cells, i.e. cells composing the organs or tissues of living animals or humans, or microorganisms found in living animals or humans.
- kits for diagnostic or therapeutic purposes particular for the treatment, prevention or monitoring of non-chronic or chronic inflammatory eye diseases as defined above
- the kit includes one or more containers containing JNK inhibitor sequences, chimeric peptides, nucleic acid sequences and/or antibodies to these JNK inhibitor sequences or to chimeric peptides as defined above, e.g.
- an anti-JNK inhibitor sequence antibody to an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100, to a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, to an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or to or variants or fragments thereof within the above definitions, or such an anti-JNK inhibitor sequence antibody and, optionally, a labeled binding partner to the antibody.
- kits for diagnostic use in the treatment, prevention or monitoring of non-chronic or chronic inflammatory eye diseases as defined above comprise one or more containers containing nucleic acids that encode, or alternatively, that are the complement to, an JNK inhibitor sequence and/or a chimeric peptide as defined above, optionally, a labeled binding partner to these nucleic acids, are also provided.
- the kit may be used for the above purposes as a kit, comprising one or more containers, a pair of oligonucleotide primers (e.g. each 6-30 nucleotides in length) that are capable of acting as amplification primers for polymerase chain reaction (PCR; see e.g. Innis, et a/., 1990. PCR PROTOCOLS, Academic Press, Inc., San Diego, CA ), ligase chain reaction, cyclic probe reaction, and the like, or other methods known within the art used in context with the nucleic acids as defined above.
- PCR polymerase chain reaction
- the kit may, optionally, further comprise a predetermined amount of a purified JNK inhibitor sequence as defined above, a chimeric peptide as defined above, or nucleic acids encoding these, for use as a diagnostic, standard, or control in the assays for the above purposes.
- the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 powder was dissolved under sterile conditions at the concentration of 10 ⁇ M in saline (NaCl 0.9%, Versol®, Aguettant) in a National Scientific (NSC) deactivated glass vial (NSC-C4015-S1) and stored at 4°C until use.
- NSC National Scientific
- NSC-C4015-S1 National Scientific
- Rats 7 weeks old female Lewis rats weighing 175 g (Elevage Janvier, Le Genest Saint Isle, France) were used and handled in accordance with the ARVO Statement for the Use of Animals in Ophthalmic and Vision Research. Rats were anesthetized with intramuscular injection of Ketamine (88 mg/kg) (Virbac, France) and Largactil (0.6 mg/kg) (Sanofi-Aventis, France) before intravenous or ocular injection.
- Ketamine 88 mg/kg
- Largactil 0.6 mg/kg
- saline NaCl 0.9%) or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 (20 ⁇ g/kg in saline) were injected in a tail vein using a 25G-needle connected on a 1 mL syringe (Becton Dickinson, France).
- IVTT intravitreous
- 5 ⁇ L of saline or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 were injected in both eyes using a 30G disposable needle (BD-microfine syringe, nm Médical, Asbeck, France).
- the IV dose of 20 ⁇ g/kg i.e. 3.5 ⁇ g/rat in rats weighing 175g was chosen according to studies showing that the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 is active at very low doses in other models.
- the inventors used the minimal dose used in direct ear application after acute noise trauma in patients.
- EIU Endotoxin-Induced Uveitis
- Aqueous humor and vitreous were collected and pooled from each enucleated eye. Ocular fluids were immediately centrifuged and the cell-free fractions were collected and frozen at -20°C before analysis by Multiplex assay. Blood samples were first clotted at room temperature for 2 hours and then at 4°C overnight. Serum was collected, centrifuged and the clear supernatant was collected and frozen at -20°C before Multiplex analysis.
- Retinas and RPE/choroid/sclera complexes were carefully dissected out on enucleated eyes, snap frozen and stored at -80°C until being used for RT-PCR and Western-Blot analyses.
- mice were randomized into 14 experimental groups with 5 rats per group. Uveitis was induced in each group and rats were killed 6 hours (4 groups), 24 hours (6 groups) and 48 hours (4 groups) after LPS challenge.
- rats treated by intravenous or intravitreous injections of vehicle (NaCl 0.9%) or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 were compared to untreated control uveitic rats.
- Two additional groups, treated by intravenous injection of vehicle and intravitreal injection of dexamethasone were used at 24 hours.
- Retinas and RPE/choroid/sclera complexes were also collected at 24 hours to analyze iNOS mRNA levels by RT-PCR and c-Jun phosphorylation state by Western-Blot.
- Eyes were selected so that their EIU clinical score was representative of the mean of the experimental group they belong to, i.e 3 for eyes treated by IV and IVT injection of vehicle and 2 for eyes treated by IV or IVT injection of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11.
- a second set of experiment was designed to evaluate the anti-inflammatory effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 at the cellular and tissue level as well as the biodistribution of this molecule 24 hours after administration.
- Rats were randomized into 11 experimental groups. 6 groups of rats with uveitis: untreated uveitic rats, rats injected intravenously with NaCl or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 and rats injected intravitreously with the vehicle, the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 or dexamethasone.
- the 5 additional groups without uveitis were: untreated healthy rats, rats treated by NaCl IV or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 IV and rats injected IVT with NaCl or the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11. Three eyes from separate rats were collected per group and used for immunohistochemistry.
- dexamethasone was used as a reference treatment.
- grade (0) indicates no inflammation
- grade (1) indicates the presence of a minimal iris and conjunctival vasodilation but without the observation of flare or cells in the anterior chamber (AC)
- grade (2) indicates the presence of moderate iris and conjunctival vessel dilation but without evident flare or cells in the AC
- grade (3) indicates the presence of intense iris vessels dilation, flare and less than 10 cells per slit lamp field in the AC
- grade (4) indicates the presence of more severe clinical signs than grade 3, with more than 10 cells in the AC with or without the formation of a hypopion
- grade (5) indicates the presence of intense inflammatory reaction, fibrin formation in the AC and total seclusion of the pupil.
- Clinical evaluation was performed in a masked manner.
- RPE/choroid/sclera complexes and neuroretinas (2 per experimental group) were snap frozen immediately after dissection and stored at -80°C until use.
- Tissues were homogenized in 500 ⁇ L of lysis buffer (MOPS SDS Running Buffer, Invitrogen, Cergy-Pontoise, France) supplemented with protease inhibitor cocktail (Roche Diagnostics, Meylan, France) (one tablet for 50 mL).
- LDS Sample Buffer Invitrogen
- heating for 5 min at 100°C equal amounts of proteins were subjected to electrophoresis in a NuPAGE 4-12% Bis-Tris gel (Invitrogen) using MOPS SDS Running Buffer.
- the bands obtained were then electrotransferred onto nitrocellulose membranes (Schleicher & Schuell BioScience, Dassel, Germany).
- blots were sequentially incubated with a rabbit phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (4370) primary antibody (or rabbit phospho-p38 MAPK (Thr180/Tyr182) (9215) antibody) and a horseradish peroxidase-conjugated goat anti-rabbit IgG (H+L) (PI-1000 - Vector Laboratories, Clinisciences, Montrouge, France) secondary antibody at dilution 1:5000.
- a rabbit phospho-p44/42 MAPK Erk1/2
- Thr202/Tyr204 (4370) primary antibody
- rabbit phospho-p38 MAPK Thr180/Tyr182
- H+L horseradish peroxidase-conjugated goat anti-rabbit IgG
- Blots were then dehybridized and rehybridized successively with a rabbit p44/42 MAPK (Erk1/2) (4695) (or rabbit p38 MAP Kinase (9212) antibody) and the same secondary antibody as above.
- Primary antibodies were purchased from Cell Signaling Technology (Ozyme, St Quentin Yvelines, France) and all steps performed following the manufacturer's instruction.
- Immunostaining of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 was performed on healthy and uveitic eyes to study its ocular biodistribution after systemic or local administration. Briefly, sections were permeabilized as described above before being sequentially incubated with an anti- SEQ ID NO: 11 purified rabbit IgG and a secondary Alexa 594 (red)-conjugated goat anti-rabbit IgG (Invitrogen, Cergy Pontoise, France) diluted 1:100 and 1:250 in PBS respectively. Immunostaining of untreated healthy and uveitic eyes were used as negative controls. Nuclei were stained with DAPI before mounting and observation.
- Immunostaining of p-Erk1/2 was performed to evaluate the effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 on the ERK pathway after IV or IVT administration. Sections were permeabilized as described above and incubated in blocking solution containing 0.1% Triton X-100 and 10% FCS (fetal calf serum) in PBS for 1 hour at room temperature. Sections were incubated overnight at 4°C with a rabbit anti-phospho-p44/42 MAPK (Erk1/2) primary antibody (4370) purchased from Cell Signaling Technology (Ozyme, St Quentin Yvelines, France) diluted 1:400 in blocking solution.
- a rabbit anti-phospho-p44/42 MAPK (Erk1/2) primary antibody (4370) purchased from Cell Signaling Technology (Ozyme, St Quentin Yvelines, France) diluted 1:400 in blocking solution.
- PCR Polymerase-Chain Reaction
- Intraocular fluids (diluted to obtain a final volume of 25 ⁇ L) and sera (25 ⁇ L of 1:5 dilution) were subjected to multiplex bead analysis.
- This method uses microspheres as the solid support for immunoassays 12 and allows the titration of a greater number of cytokines with increased sensitivity than occurs with ELISA.13
- seventeen analytes were quantified simultaneously using the rat Cytokine/Chemokine-17plex kit (Milliplex Map Kit, Millipore, Saint-Quentin-en-Yvelines, France) according to the manufacturer's instructions: Chemokines MCP-1/CCL2, MIP-1 ⁇ /CCL3, RANTES/CCL5, IP-10/CXCL10 (IFN-inducible protein-10) and GRO/KC ; proinflammatory mediators IL-1, IL-18 and TNF- ; Th1/Th2/Th17 cytokines IL-2 and IFN- / IL-4, IL-5, IL-6
- the assay was performed in a 96-well filter plate and standard curves for each cytokine were generated with a Rat Cytokine Standard provided in the kit. All incubation steps were performed under medium orbital agitation and in the dark to protect the beads from light. Data acquisition and analysis were performed with the manager software version 4.1 (Bioplex; Bio-Rad) with four or five logistic parameters for standard curves. Detection thresholds for all the analytes were estimated around 1 to 10 pg/mL.
- the all-D-retro-inverso JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 significantly reduced endotoxins induced uveitis (EIU).
- the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 significantly reduced EIU clinical scores after 20 ⁇ g/kg intravenous (IV) injection (2.0 ⁇ 0.1) compared to untreated uveitic eyes (3.2 ⁇ 0.1, p ⁇ 0.001) and vehicle IV (3.2 ⁇ 0.1, p ⁇ 0.001) ( Figure 1A ).
- JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 could have any effect on the other MAPK pathways.
- the phosphorylation state of Erk1/2 and p38 was evaluated. Whereas Erk1/2 and p38 were detected in RPE/choroid complexes at similar levels among all groups, the phosphorylation form of these two MAPK could not be detected by western-blot analysis (data not shown).
- the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 was mostly found in ocular tissues like in healthy eyes and in resident cells that are mobilized and participate actively to the inflammatory processes in pathological conditions such as microglial cells (panels S-T).
- IVT of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 significantly reduced ED1 positive infiltrating cells (93 ⁇ 8) as compared to vehicle IVT injected eyes (175 ⁇ 15, p ⁇ 0.009) and untreated uveitic eyes (p ⁇ 0.005) ( Figure 5A ).
- the reducing effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 on ED1 positive cell infiltration (93 ⁇ 8) did not differ from that induced by dexamethasone (79 ⁇ 15), suggesting that both treatments have a similar efficacy on this parameter.
- the number of polymorphonuclear cells (PMN) ( Figure 5B ) was also significantly reduced at 24 hours after IV administration of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 (60 ⁇ 6) as compared to control eyes (237 ⁇ 15, p ⁇ 0.005), and after IVT injection of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 (40 ⁇ 5) as compared to IVT injection of the vehicle (152 ⁇ 31, p ⁇ 0.009) and control uveitic eyes (p ⁇ 0.005).
- the effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 on PMN ocular tissue infiltration did not significantly differ from that of dexamethasone (42 ⁇ 11).
- the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 down regulates iNOS expression Since iNOS (inducible nitric oxide synthase) has been described as a key mediator in the pathogenesis of uveitis, 14, 15 the effect of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 on its expression was investigated at both the protein and mRNA levels.
- chemokines and cytokines were dosed by multiplex analysis on ocular media ( Figures 8 and 9 ) and sera .
- chemokines/ cytokines their profile was different in ocular fluids from eyes treated with IV administration of the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 as compared to the IVT administration. Indeed, when the JNK-inhibitor (poly-)peptide of SEQ ID NO: 11 was injected systemically at the time of LPS challenge, it induced a significant reduction of MCP-1, MIP-1 ⁇ and RANTES at 6 and 24 hours ( Figure 8A ). GRO/KC was also significantly reduced at 6 hours.
- Th1 cytokines such as TNF- ⁇ , IL-6 and INF- ⁇ were significantly reduced at different time points while IL-10 tended to increase at 6 hours in treated eye (but not significantly), suggesting a switch towards a Th2 profile ( Figure 8B ). No statistical differences were noticed between eyes from vehicle IV injected rats and untreated uveitic control eyes.
- SEQ ID NO: 11 The effects of SEQ ID NO: 11 on the inflammatory response in a rat Endotoxin-Induced Uveitis (EIU) model after sub-conjunctival (1.8 and 22 ⁇ g) administrations was assessed. The effects were first evaluated after an ocular examination clinically scored. The inflammatory cells (PMNs) infiltrated in ocular tissues were quantified, iNOS expression was investigated at the mRNA levels and c-Jun phosphorylation state was evaluated by Western Blot (for methodology see above).
- Rats were anesthetized with intramuscular injection of ketamine (Ketamine Virbac® 88 mg/kg, Virbac, France) and chlorpromazine (Largactil® 0.6 mg/kg, Sanofi-Aventis, France) before injections. Administrations were performed immediately before EIU induction in all groups. For sub-conjunctival injections, 5 ⁇ L of SEQ ID NO:11 and dexamethasone were administered in the right eye and saline in both eyes using a 30G disposable needle connected to a BD-microfine syringe (NM Médical, France).
- Neuroretinas and RPE/choroid complexes were carefully dissected out on enucleated eyes of 1-3 animals per selected groups, snap frozen and stored at -80°C until being used for RT-PCR and Western-Blot analyses.
- eyeballs of 2-3 animal of selected groups were collected and fixed for 1 h at room temperature in phosphate buffered saline (PBS) containing 4% paraformaldehyde before being rinsed overnight in PBS.
- PBS phosphate buffered saline
- OCT optimal cutting temperature
- Frozen antero-posterior sections of eyes (10 ⁇ m thick) were performed at the optic nerve level using a cryostat (Leica CM 3050S, Rueil-Malmaison, France) and mounted on super-frost slides for histology analysis.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Marine Sciences & Fisheries (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- Ophthalmology & Optometry (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PL14004427T PL2902035T3 (pl) | 2010-10-14 | 2011-10-14 | Przechodzące przez komórkę peptydowe inhibitory szlaku przekazywania sygnałów przez JNK do zastosowania w leczeniu chorób zapalnych oka |
| EP14004427.2A EP2902035B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of inflammatory eye diseases. |
| CY181100963T CY1120936T1 (el) | 2010-10-14 | 2018-09-18 | Αναστολεις πεπτιδιου toy μονοπατιου μεταγωγης σηματος jnk οι οποιοι διαπερνουν το κυτταρο για χρηση εις την αγωγη της ραγοειδιτιδας |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2010/006284 WO2012048721A1 (en) | 2010-10-14 | 2010-10-14 | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
| EP2011000307 | 2011-01-25 | ||
| EP11775734.4A EP2627346B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis |
| EP14004427.2A EP2902035B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of inflammatory eye diseases. |
Related Parent Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP11775734.4A Division EP2627346B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis |
| EP11775734.4A Division-Into EP2627346B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP2902035A1 EP2902035A1 (en) | 2015-08-05 |
| EP2902035B1 true EP2902035B1 (en) | 2018-06-20 |
Family
ID=44862926
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP14004427.2A Active EP2902035B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the JNK signal transduction pathway for use in the treatment of inflammatory eye diseases. |
| EP11775734.4A Active EP2627346B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP11775734.4A Active EP2627346B1 (en) | 2010-10-14 | 2011-10-14 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis |
Country Status (7)
| Country | Link |
|---|---|
| EP (2) | EP2902035B1 (pl) |
| CY (1) | CY1120936T1 (pl) |
| DK (2) | DK2627346T3 (pl) |
| ES (2) | ES2575226T3 (pl) |
| HK (1) | HK1210056A1 (pl) |
| PL (2) | PL2627346T3 (pl) |
| WO (1) | WO2012048893A1 (pl) |
Families Citing this family (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040082509A1 (en) | 1999-10-12 | 2004-04-29 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| WO2007031098A1 (en) | 2005-09-12 | 2007-03-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the jnk signal transduction pathway |
| WO2009143865A1 (en) | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2009143864A1 (en) | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases |
| WO2010072228A1 (en) | 2008-12-22 | 2010-07-01 | Xigen S.A. | Novel transporter constructs and transporter cargo conjugate molecules |
| WO2011160653A1 (en) | 2010-06-21 | 2011-12-29 | Xigen S.A. | Novel jnk inhibitor molecules |
| US9150618B2 (en) | 2010-10-14 | 2015-10-06 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
| WO2013091670A1 (en) * | 2011-12-21 | 2013-06-27 | Xigen S.A. | Novel jnk inhibitor molecules for treatment of various diseases |
| WO2015197098A1 (en) * | 2014-06-26 | 2015-12-30 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2014206427A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2014206563A2 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2015197097A1 (en) | 2014-06-26 | 2015-12-30 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
| AU2015281361A1 (en) * | 2014-06-26 | 2016-11-17 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
| DE102016111708A1 (de) | 2016-06-27 | 2017-12-28 | Heiko Schmidt | Gelenkanordnung, vorgefertigte Baugruppe sowie Verfahren zur Herstellung einer vorgefertigten Baugruppe einer Gelenkanordnung |
| CN108060223A (zh) * | 2017-12-29 | 2018-05-22 | 北京泱深生物信息技术有限公司 | Atf2基因的新应用 |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4980286A (en) | 1985-07-05 | 1990-12-25 | Whitehead Institute For Biomedical Research | In vivo introduction and expression of foreign genetic material in epithelial cells |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
| GB8919607D0 (en) | 1989-08-30 | 1989-10-11 | Wellcome Found | Novel entities for cancer therapy |
| US5804604A (en) | 1989-12-21 | 1998-09-08 | Biogen, Inc. | Tat-derived transport polypeptides and fusion proteins |
| US5674980A (en) | 1989-12-21 | 1997-10-07 | Biogen Inc | Fusion protein comprising tat-derived transport moiety |
| PT671923E (pt) | 1992-10-09 | 2001-10-30 | Advanced Tissue Sciences Inc | Celulas de reserva do figado |
| DE69637147T2 (de) | 1995-07-28 | 2008-03-06 | Marie Curie Cancer Care | Transportproteine und deren verwendungen |
| AU2003294312A1 (en) * | 2002-11-18 | 2004-07-09 | Celgene Corporation | Methods of usig and compositions comprising (-)-3-(3,4-dimethoxy-phenyl)-3-(1-oxo-1,3-dihydro-isoindol-2-yl)-propionamide |
| WO2008006046A1 (en) * | 2006-07-06 | 2008-01-10 | Case Western Reserve University | Ceramide composition and use thereof in treatment of ocular diseases |
| WO2009143864A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases |
| WO2009143865A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| EA201171188A1 (ru) * | 2009-03-30 | 2012-05-30 | Сантен Фармасьютикал Ко., Лтд. | Профилактическое или терапевтическое средство против болезни сетчатки и способ профилактики или лечения болезни сетчатки с использованием jnk (c-jun-аминоконцевая киназа)-ингибиторного пептида, а также применение указанного пептида |
-
2011
- 2011-10-14 ES ES11775734.4T patent/ES2575226T3/es active Active
- 2011-10-14 PL PL11775734.4T patent/PL2627346T3/pl unknown
- 2011-10-14 EP EP14004427.2A patent/EP2902035B1/en active Active
- 2011-10-14 DK DK11775734.4T patent/DK2627346T3/en active
- 2011-10-14 EP EP11775734.4A patent/EP2627346B1/en active Active
- 2011-10-14 WO PCT/EP2011/005172 patent/WO2012048893A1/en not_active Ceased
- 2011-10-14 PL PL14004427T patent/PL2902035T3/pl unknown
- 2011-10-14 ES ES14004427T patent/ES2688030T3/es active Active
- 2011-10-14 DK DK14004427.2T patent/DK2902035T3/en active
-
2015
- 2015-11-09 HK HK15111042.8A patent/HK1210056A1/en unknown
-
2018
- 2018-09-18 CY CY181100963T patent/CY1120936T1/el unknown
Non-Patent Citations (1)
| Title |
|---|
| None * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2012048893A1 (en) | 2012-04-19 |
| ES2575226T3 (es) | 2016-06-27 |
| DK2627346T3 (en) | 2016-06-13 |
| EP2627346A1 (en) | 2013-08-21 |
| EP2902035A1 (en) | 2015-08-05 |
| CY1120936T1 (el) | 2019-12-11 |
| PL2627346T3 (pl) | 2016-11-30 |
| HK1210056A1 (en) | 2016-04-15 |
| PL2902035T3 (pl) | 2019-04-30 |
| HK1187266A1 (zh) | 2014-04-04 |
| EP2627346B1 (en) | 2016-03-23 |
| DK2902035T3 (en) | 2018-09-24 |
| ES2688030T3 (es) | 2018-10-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10967038B2 (en) | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases | |
| EP2627346B1 (en) | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis | |
| US20140309400A1 (en) | Use of Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway for the Treatment of Dry Eye Syndrome | |
| JP5547719B2 (ja) | Jnkシグナル伝達経路の細胞透過性のペプチド性阻害剤の、慢性または非慢性の炎症性消化器疾患の治療のための、使用 | |
| JP2023040155A (ja) | 組換え神経成長因子のための組成物及び方法 | |
| JP2018525337A (ja) | 軽度認知障害の処置のためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の新規使用 | |
| WO2021228052A1 (zh) | 生物大分子靶向特异性补体抑制剂及其制备方法与应用 | |
| CA2987365A1 (en) | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of mild cognitive impairment | |
| HK1187266B (en) | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for use in the treatment of uveitis | |
| US20070185020A1 (en) | Methods and compositions for treating disorders of the extracellular matrix | |
| EP2785363A1 (en) | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of dry eye syndrome | |
| AU2004253185A1 (en) | Methods and compositions for treating disorders of the extracellular matrix | |
| HK1153937A (en) | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20141224 |
|
| AC | Divisional application: reference to earlier application |
Ref document number: 2627346 Country of ref document: EP Kind code of ref document: P |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 1210056 Country of ref document: HK |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: GRANT OF PATENT IS INTENDED |
|
| INTG | Intention to grant announced |
Effective date: 20170503 |
|
| GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
| GRAJ | Information related to disapproval of communication of intention to grant by the applicant or resumption of examination proceedings by the epo deleted |
Free format text: ORIGINAL CODE: EPIDOSDIGR1 |
|
| GRAL | Information related to payment of fee for publishing/printing deleted |
Free format text: ORIGINAL CODE: EPIDOSDIGR3 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: DELOCHE, CATHERINE Inventor name: COMBETTE, JEAN-MARC Inventor name: ABADIE, CLAIRE |
|
| INTC | Intention to grant announced (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20170928 |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: GRANT OF PATENT IS INTENDED |
|
| INTG | Intention to grant announced |
Effective date: 20180103 |
|
| GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE PATENT HAS BEEN GRANTED |
|
| AC | Divisional application: reference to earlier application |
Ref document number: 2627346 Country of ref document: EP Kind code of ref document: P |
|
| AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: AT Ref legal event code: REF Ref document number: 1010084 Country of ref document: AT Kind code of ref document: T Effective date: 20180715 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R096 Ref document number: 602011049491 Country of ref document: DE |
|
| REG | Reference to a national code |
Ref country code: FR Ref legal event code: PLFP Year of fee payment: 8 |
|
| REG | Reference to a national code |
Ref country code: DK Ref legal event code: T3 Effective date: 20180919 |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: NV Representative=s name: RIEDERER HASLER AND PARTNER PATENTANWAELTE AG, CH |
|
| REG | Reference to a national code |
Ref country code: SE Ref legal event code: TRGR |
|
| REG | Reference to a national code |
Ref country code: NL Ref legal event code: FP |
|
| REG | Reference to a national code |
Ref country code: ES Ref legal event code: FG2A Ref document number: 2688030 Country of ref document: ES Kind code of ref document: T3 Effective date: 20181030 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: FI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 Ref country code: NO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180920 Ref country code: BG Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180920 Ref country code: LT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: RO Payment date: 20180926 Year of fee payment: 6 |
|
| REG | Reference to a national code |
Ref country code: LT Ref legal event code: MG4D |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LV Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 Ref country code: HR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 Ref country code: RS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: SE Payment date: 20180904 Year of fee payment: 8 Ref country code: DK Payment date: 20180918 Year of fee payment: 8 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20181020 Ref country code: EE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 Ref country code: RO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 Ref country code: CZ Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 Ref country code: SK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: AT Payment date: 20181025 Year of fee payment: 8 |
|
| REG | Reference to a national code |
Ref country code: GR Ref legal event code: EP Ref document number: 20180402602 Country of ref document: GR Effective date: 20190125 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SM Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R097 Ref document number: 602011049491 Country of ref document: DE |
|
| PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: CY Payment date: 20180921 Year of fee payment: 8 |
|
| 26N | No opposition filed |
Effective date: 20190321 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LU Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20181014 Ref country code: MC Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: AL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: MT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20181014 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: NL Payment date: 20191022 Year of fee payment: 9 |
|
| REG | Reference to a national code |
Ref country code: DK Ref legal event code: EBP Effective date: 20191031 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: PT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20180620 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: HU Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT; INVALID AB INITIO Effective date: 20111014 Ref country code: MK Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20180620 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: GR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20200506 Ref country code: CY Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20191014 |
|
| REG | Reference to a national code |
Ref country code: AT Ref legal event code: MM01 Ref document number: 1010084 Country of ref document: AT Kind code of ref document: T Effective date: 20191014 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20191015 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R082 Ref document number: 602011049491 Country of ref document: DE Representative=s name: WEICKMANN & WEICKMANN PATENT- UND RECHTSANWAEL, DE |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20191014 Ref country code: DK Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20191031 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: AT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20191014 |
|
| REG | Reference to a national code |
Ref country code: NL Ref legal event code: MM Effective date: 20201101 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: NL Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20201101 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: WD Ref document number: 1210056 Country of ref document: HK |
|
| REG | Reference to a national code |
Ref country code: AT Ref legal event code: UEP Ref document number: 1010084 Country of ref document: AT Kind code of ref document: T Effective date: 20180620 |
|
| P01 | Opt-out of the competence of the unified patent court (upc) registered |
Effective date: 20230510 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: GB Payment date: 20231030 Year of fee payment: 13 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: ES Payment date: 20231227 Year of fee payment: 13 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: TR Payment date: 20231103 Year of fee payment: 13 Ref country code: IT Payment date: 20231030 Year of fee payment: 13 Ref country code: FR Payment date: 20231030 Year of fee payment: 13 Ref country code: DE Payment date: 20231031 Year of fee payment: 13 Ref country code: CH Payment date: 20231113 Year of fee payment: 13 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: PL Payment date: 20231102 Year of fee payment: 13 Ref country code: BE Payment date: 20231030 Year of fee payment: 13 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R119 Ref document number: 602011049491 Country of ref document: DE |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: PL |
|
| GBPC | Gb: european patent ceased through non-payment of renewal fee |
Effective date: 20241014 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20250501 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: GB Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20241014 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: BE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20241031 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: FR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20241031 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: CH Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20241031 |
|
| REG | Reference to a national code |
Ref country code: BE Ref legal event code: MM Effective date: 20241031 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20241014 |
|
| REG | Reference to a national code |
Ref country code: ES Ref legal event code: FD2A Effective date: 20251128 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: ES Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20241015 |