EP2751237A1 - Verfahren zur umwandlung von fett mit hohem gehalt an freien fettsäuren in fettsäureester und katalysatoren zur verwendung in diesem verfahren - Google Patents
Verfahren zur umwandlung von fett mit hohem gehalt an freien fettsäuren in fettsäureester und katalysatoren zur verwendung in diesem verfahrenInfo
- Publication number
- EP2751237A1 EP2751237A1 EP12835766.2A EP12835766A EP2751237A1 EP 2751237 A1 EP2751237 A1 EP 2751237A1 EP 12835766 A EP12835766 A EP 12835766A EP 2751237 A1 EP2751237 A1 EP 2751237A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- micro
- ffa
- catalysing
- nano
- fatty acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C67/00—Preparation of carboxylic acid esters
- C07C67/02—Preparation of carboxylic acid esters by interreacting ester groups, i.e. transesterification
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J35/00—Catalysts, in general, characterised by their form or physical properties
- B01J35/40—Catalysts, in general, characterised by their form or physical properties characterised by dimensions, e.g. grain size
- B01J35/45—Nanoparticles
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J35/00—Catalysts, in general, characterised by their form or physical properties
- B01J35/30—Catalysts, in general, characterised by their form or physical properties characterised by their physical properties
- B01J35/33—Electric or magnetic properties
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J37/00—Processes, in general, for preparing catalysts; Processes, in general, for activation of catalysts
- B01J37/02—Impregnation, coating or precipitation
- B01J37/0201—Impregnation
- B01J37/0209—Impregnation involving a reaction between the support and a fluid
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J37/00—Processes, in general, for preparing catalysts; Processes, in general, for activation of catalysts
- B01J37/02—Impregnation, coating or precipitation
- B01J37/03—Precipitation; Co-precipitation
- B01J37/031—Precipitation
-
- C—CHEMISTRY; METALLURGY
- C10—PETROLEUM, GAS OR COKE INDUSTRIES; TECHNICAL GASES CONTAINING CARBON MONOXIDE; FUELS; LUBRICANTS; PEAT
- C10L—FUELS NOT OTHERWISE PROVIDED FOR; NATURAL GAS; SYNTHETIC NATURAL GAS OBTAINED BY PROCESSES NOT COVERED BY SUBCLASSES C10G OR C10K; LIQUIFIED PETROLEUM GAS; USE OF ADDITIVES TO FUELS OR FIRES; FIRE-LIGHTERS
- C10L1/00—Liquid carbonaceous fuels
- C10L1/02—Liquid carbonaceous fuels essentially based on components consisting of carbon, hydrogen, and oxygen only
- C10L1/026—Liquid carbonaceous fuels essentially based on components consisting of carbon, hydrogen, and oxygen only for compression ignition
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11C—FATTY ACIDS FROM FATS, OILS OR WAXES; CANDLES; FATS, OILS OR FATTY ACIDS BY CHEMICAL MODIFICATION OF FATS, OILS, OR FATTY ACIDS OBTAINED THEREFROM
- C11C3/00—Fats, oils, or fatty acids by chemical modification of fats, oils, or fatty acids obtained therefrom
- C11C3/003—Fats, oils, or fatty acids by chemical modification of fats, oils, or fatty acids obtained therefrom by esterification of fatty acids with alcohols
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J2235/00—Indexing scheme associated with group B01J35/00, related to the analysis techniques used to determine the catalysts form or properties
- B01J2235/30—Scanning electron microscopy; Transmission electron microscopy
-
- C—CHEMISTRY; METALLURGY
- C10—PETROLEUM, GAS OR COKE INDUSTRIES; TECHNICAL GASES CONTAINING CARBON MONOXIDE; FUELS; LUBRICANTS; PEAT
- C10G—CRACKING HYDROCARBON OILS; PRODUCTION OF LIQUID HYDROCARBON MIXTURES, e.g. BY DESTRUCTIVE HYDROGENATION, OLIGOMERISATION, POLYMERISATION; RECOVERY OF HYDROCARBON OILS FROM OIL-SHALE, OIL-SAND, OR GASES; REFINING MIXTURES MAINLY CONSISTING OF HYDROCARBONS; REFORMING OF NAPHTHA; MINERAL WAXES
- C10G2300/00—Aspects relating to hydrocarbon processing covered by groups C10G1/00 - C10G99/00
- C10G2300/10—Feedstock materials
- C10G2300/1011—Biomass
- C10G2300/1014—Biomass of vegetal origin
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P30/00—Technologies relating to oil refining and petrochemical industry
- Y02P30/20—Technologies relating to oil refining and petrochemical industry using bio-feedstock
Definitions
- the present disclosure relates broadly to a method of converting free fatty acids to fatty acid esters.
- the disclosure includes a method of converting grease containing high content of free fatty acids to fatty acid esters.
- the disclosure also relates to catalysts for use in such methods.
- Biodiesel comprises of long chain fatty acid alkyl ester derived from triglycerides such as vegetable oil and animal fats and is considered as a renewable and cleaner alternative to petroleum-based diesel.
- One of the more common biodiesels comprises fatty acid methyl esters (FAME).
- FAME are commonly produced by methanolysis of vegetable oils (refined rapeseed oil, sunflower oil and soybean oil) and animal fats (beef, tallow, lard) using base catalysts.
- the current price of FAME is still too high to replace the traditional fossil fuels.
- the high price of FAME is mainly due to the high cost of the feedstock which is used as the starting material to produce FAME.
- rapeseed oil and soybean oil cost about 1.28 USD/L and about 0.70 USD/L respectively, which constitutes almost 80% of the typical biodiesel production cost.
- the grease trap oil (GTO) such as brown grease (having 15-40 wt% of free fatty acid (FFA)) is a cheap (costs less than about 0.3USD/L, and in some reports as low as about 0.19USD/L) and non-edible resource. It is discharged in large amounts without any use (about 800-1000 tons/year in Singapore and about 1.69 million ton/year in US).
- GTO is seen to be an attractive alternative feedstock for biodiesel production.
- Prospective advantages that can be gleaned from using GTO as a starting material for biodiesel production include (i) reduction in the production cost of biodiesel and (ii) avoidance of the disposal problem of waste oil such as brown grease. In view thereof, attempts have been made to utilize waste grease such as brown grease to produce useful biodiesel.
- Homogeneous acid catalysts such as sulfuric acid have been used for the esterification of FFA and methanol, but suffer from several problems such as complex neutralization of the remaining acid with base which produces large quantity of salts for subsequent disposal, corrosion of equipment used, and environment issues relating to the use of highly concentrated acids. While the use of heterogeneous acid catalysts may avoid some of the above problems of homogeneous acid catalysts, reported heterogeneous acid catalysts such as acidic ion-exchange resins, zeolites, sulfated zirconia, and niobic acids were found to be unsatisfactory for the pretreatment of grease via esterification.
- zeolites and niobic acid have low densities of effective acid sites and thus give unsatisfactory performance in the esterification; acidic ion-exchange resins such as Amberlyst 15 and Nafion suffer from the high cost, low thermal stability, and lower catalytic activity; sulfated zirconia is extremely expensive due to zirconium being a rare and expensive metal; a series of diarrylammonium catalyst incorporated into insoluble porous polymer and porous silica structure can give improved biodiesel conversion, but they require the use of expensive triflic acid in the catalyst synthesis and regeneration step, as well as the use of high reaction temperature (95-125°C) and high pressure equipment for accommodating pressures that are higher than atmospheric pressure.
- acidic ion-exchange resins such as Amberlyst 15 and Nafion suffer from the high cost, low thermal stability, and lower catalytic activity
- sulfated zirconia is extremely expensive due to zirconium being a rare and expensive metal
- Candida antartica Lipase B (CALB) and Thermomyces lanuginose Lipase (TLL) immobilized on the granulated silica (Grant-CA and Gran-TL) and the commercially available immobilized enzyme Novozyme SP435 afforded only 30%, 5% and 60% conversion of grease (containing 6.8 wt% of FFA) to FAME after 48 hour reaction time, respectively.
- CALB Candida antartica Lipase B
- TLL Thermomyces lanuginose Lipase
- Novozyme SP435 afforded only 30%, 5% and 60% conversion of grease (containing 6.8 wt% of FFA) to FAME after 48 hour reaction time, respectively.
- the incubation step is carried out in the presence of an alcohol.
- the micro- or nano-sized catalysing particles have an average particle size or diameter of no more than 800 ⁇ .
- the micro- or nano-sized catalysing particles is capable of additionally catalysing the conversion of the glycerides to fatty acid esters.
- the micro- or nano-sized catalysing particles are selected from a group consisting of polymer particles, silica particles, microorganism cells and mixtures thereof.
- At least one of the polymer particles and silica particles are magnetic particles, the magnetic particle comprising an outer shell; a magnetic core at least partially encapsulated by the outer shell; and a catalyzing entity selected from at least one of an inorganic acid group or an enzyme, the catalyzing entity being immobilized on the outer shell, for catalyzing the conversion of FFA to fatty acid esters, optionally for additionally catalysing the conversion of glycerides to fatty acid esters.
- the micro-organism is a wild type strain of microorganism expressing hydrolase or a recombinant micro-organism expressing hydrolase.
- FFA free fatty acids
- the particle is a magnetic particle and the body comprises an outer shell; and a magnetic core at least partially encapsulated by the outer, shell, wherein the catalytic means associated with the body is a catalyzing entity immobilized on the outer shell, for catalyzing the conversion of FFA to fatty acid esters, and optionally for additionally catalysing the conversion of glycerides to fatty acid esters.
- the magnetic core comprises a plurality of magnetic nano-sized particles having an average size or diameter of from 5 to 20 nm.
- the outer shell is at least one of a silica shell or polymer shell made from the group of polymers consisting of poly(glycidyl methacrylate) (PGMA), polystyrene (PS) and poly(methyl methacrylae) (PMMA).
- PGMA poly(glycidyl methacrylate)
- PS polystyrene
- PMMA poly(methyl methacrylae)
- the catalyzing entity is selected from at least one of an inorganic acid group or an enzyme.
- the catalyzing entity is immobilized on the polymer shell via a linker selected from the group comprising epoxide functional group containing linker, amine functional group containing linker, aldehyde functional group containing linker, benzene functional group containing linker, ester functional group containing linker and mixtures thereof.
- the particle has a specific loading of from 10 to 500 mg enzyme per particle.
- the particle has a specific loading of from 0.1 to 3 mmol H + per gram of particle.
- the micro- or nano-sized catalysing particle is a cell of a micro-organism
- the body of the particle is the body of the cell
- the catalytic means associated with the body is an enzyme produced in or from the body of the cell for catalyzing the conversion of FFA to fatty acid esters and optionally for additionally catalysing the conversion of glycerides to fatty acid esters.
- the recombinant micro-organism comprises a nucleic acid sequence that encodes for the enzyme, the nucleic acid sequence having at least 80% homology/identity to at least one of SEQ ID No. 1 or SEQ ID No. 3 or SEQ ID No. 5.
- a method of producing a micro- or nano-sized catalysing particle comprising forming a magnetic core; encapsulating at least part of the magnetic core with an outer shell; and immobilizing a catalyzing entity on the outer shell, wherein the catalysing entity is adapted to catalyse the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters, and optionally for additionally catalysing the conversion of glycerides to fatty acid esters.
- the step of forming a magnetic core comprises forming a plurality of magnetic nano-sized particles having an average size or diameter of from 5 to 20 nm.
- the step of forming a plurality of magnetic nano-sized particles comprises co-precipitation to obtain the magnetic nano-sized particles.
- the outer shell comprises a polymer shell and the step of encapsulating at least part of the magnetic core with the polymer shell comprises mixing the magnetic core with one or more monomer precursor of the polymer shell; and polymerizing the monomer precursors to form a polymer shell that encapsulates at least part of the magnetic core.
- the polymer shell encapsulates substantially the whole magnetic core.
- the step of mixing the magnetic core with one or more monomer precursor of the polymer shell is carried out in the presence of an initiator. In one embodiment, the step of mixing the magnetic core with one or more monomer precursor of the polymer shell and the initiator is carried out in the presence of water.
- the outer shell comprises a silica shell and the step of encapsulating at least part of the magnetic core with the silica shell comprises mixing the magnetic core with an alkyl silicate, an alkali and an alcohol to obtain a mixture; and form a silica shell that encapsulates at least part of the magnetic core from precipitation of the mixture.
- the alkali is ammonia.
- the outer shell comprises a silica shell and the step of encapsulating at least part of the magnetic core with the silica shell comprises mixing the magnetic core with tetraethyl orthosilicate in water containing an alcohol and ammonia to obtain a mixture; and precipitating silica from the mixture to form a silica shell that encapsulates the magnetic core
- the step of immobilizing a catalyzing entity to the outer shell comprising: covalently coupling the catalyzing entity with the functional group of the outer shell which is chemically reactive to the catalyzing entity, to immobilize the catalyzing entity to the outer shell; or functionalizing the surface of the outer shell with a functional group chemically reactive to the catalyzing entity; and covalently or non covalently coupling the catalyzing entity with the functional group to immobilize the catalyzing entity to the outer shell.
- identifying a strain of micro-organism from a repertoire of hydrolase producing micro-organisms the identified strain of micro-organism capable of catalysing the conversion of more FFA to fatty acid esters than at least 50% of the other strains of micro-organisms in the repertoire, and optionally capable of additionally catalysing the conversion of glycerides to fatty acid esters;
- step a identifying a gene sequence of the hydrolase that is capable of catalysing the conversion of FFA to fatty acid esters and optionally capable of additionally catalysing the conversion of glycerides to fatty acid esters, from the identified strain in step a);
- step a) introducing the gene sequence in a host cell to obtain a recombinant host cell that is capable of expressing the hydrolase in an amount that is more than the strain of micro-organism identified in step a) under substantially similar conditions
- the recombinant host cell is capable of catalysing the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters, and optionally capable of additionally catalysing the conversion of glycerides to fatty acid esters.
- a method of separating a plurality of micro- or nano-sized catalysing particles disclosed above from a mixture comprising applying an external magnetic field or a centrifugal force to consolidate the catalysing particles together; and removing the rest of the mixture from the consolidated catalysing particles.
- FFA free fatty acids
- micro as used herein is to be interpreted broadly to include dimensions from about 1 micron to about 1000 microns.
- nano as used herein is to be interpreted broadly to include dimensions less than about 1000 nm.
- the term "particle” as used herein broadly refers to a discrete entity or a discrete body.
- the particle described herein can include an organic, an inorganic or a biological particle.
- Biological particles can include biological particle mammalian cell, blood cell, bacterial cell, cell organelle and virus.
- the particle used described herein may also be a macro-particle that is formed by an aggregate of a plurality of sub-particles or a fragment of a small object.
- the particle of the present disclosure may be spherical, substantially spherical, or non-spherical, such as irregularly shaped particles or eilipsoidally shaped particles.
- size when used to refer to the particle broadly refers to the largest dimension of the particle. For example, when the particle is substantially spherical, the term “size” can refer to the diameter of the particle; or when the particle is substantially non-spherical, the term “size” can refer to the largest length of the particle.
- fatty acid as used herein, broadly refers to a non-esterified carboxylic acid having an aliphatic tail that is saturated or unsaturated, or its corresponding carboxylate anion, and can be denoted as RCOOH or RCOO " respectively, where R is an aliphatic tail.
- the aliphatic tail may for example contain 3 to 25 carbon atoms.
- free fatty acids or "FFA” used herein are intended to include any fatty acid which is substantially not associated with other molecules.
- a free fatty acid includes a fatty acid whose carboxyl group is not covalently bonded to another compound.
- fatty acid esters used herein broadly refers to esters of fatty acids and includes monoesters, diesters or triesters of fatty acids.
- fatty acid esters is also intended to include fatty acid alkyl esters such as fatty acid methyl esters (FAME).
- alkyl includes straight chain or branched chain saturated aliphatic groups having from 1 to 50 carbon atoms, eg, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20 or 50 carbon atoms.
- alkyl includes, but is not limited to, methyl, ethyl, 1 -propyl, isopropyl, 1 -butyl, 2-butyl, isobutyl, ferf-butyl, amyl, 1 ,2-dimethylpropyl, 1 ,1-dimethylpropyl, pentyl, isopentyl, hexyl, 4-methylpentyl, 1-methylpentyl, 2-methylpentyl, 3-methylpentyl, 2,2- dimethylbutyl, 3,3-dimethylbutyl, 1 ,2-dimethylbutyl, 1 ,3-dimethylbutyl, 1 ,2,2- trimethylpropyl, 1 ,1 ,2-trimethylpropyl, 2-ethylpentyl, 3-ethylpentyl, heptyl, 1- methylhexyl, 2,2-dimethylpentyl, 3,3-dimethylpentyl,
- microorganism used herein broadly refer to prokaryotic and eukaryotic microscopic organism such as a bacterium or protozoa, a virus or any kind of higher organism, such as a fungus, algae, a plant, or an animal, which can be maintained in the form of a cell suspension or cell culture.
- bacteria refers to a domain of prokaryotic organisms. Bacteria can include, but are not limited to at least 11 distinct groups, as follows: (1) Gram-positive (gram+) bacteria, of which there are two major subdivisions: (1) high G+C group (Actinomycetes, Mycobacteria, Micrococcus, others) (2) low G+C group (Bacillus, Clostridia, Lactobacillus, Staphylococci, Streptococci, Mycoplasmas); (2) Proteobacteria, e.g., Purple photosynthetic+non-photosynthetic Gram-negative bacteria (includes most "common” Gram-negative bacteria); (3) Cyanobacteria, e.g., oxygenic phototrophs; (4) Spirochetes and related species; (5) Planctomyces; (6) Bacteroides, Flavobacteria; (7) Chlamydia; (8) Green sulfur bacteria; (9) Green non- sulfur bacteria (
- Gram-negative bacteria can include but are not limited to cocci, nonenteric rods, and enteric rods.
- the genera of Gram-negative bacteria include, for example, Neisseria, Spirillum, Pasteurella, Brucella, Yersinia, Francisella, Haemophilus, Bordetella, Escherichia, Salmonella, Shigella, Klebsiella, Proteus, Vibrio, Pseudomonas, Bacteroides, Acetobacter, Aerobacter, Agrobacterium, Azotobacter, Spirilla, Serratia, Vibrio, Rhizobium, Chlamydia, Rickettsia, Treponema, and Fusobacterium.
- Gram positive bacteria can include but are not limited to cocci, nonsporulating rods, and sporulating rods.
- the genera of gram positive bacteria include, for example, Actinomyces, Bacillus, Clostridium, Corynebacterium, Erysipelothrix, Lactobacillus, Listeria, Mycobacterium, Myxococcus, Nocardia, Staphylococcus, Streptococcus, and Streptomyces.
- recombinant microorganism and "recombinant host cell” used herein are interchangeable and includes microorganisms that have been genetically modified to express or over-express endogenous polynucleotides, or to express non- endogenous sequences, such as those included in a vector, or which have a reduction in expression of an endogenous gene.
- the polynucleotide generally encodes a target enzyme involved in a metabolic pathway for producing a desired metabolite as described above.
- recombinant microorganisms described herein include those that have been genetically engineered to express or over- express target enzymes not previously expressed or over-expressed by a parental microorganism.
- recombinant microorganism and “recombinant host cell” refer not only to the particular recombinant microorganism but to the progeny or potential progeny of such a microorganism.
- parental microorganism used above refers to a cell used to generate a recombinant microorganism.
- parental microorganism includes both a cell that has not been genetically modified and a cell that has been genetically modified but which does not express or over-express a target enzyme.
- wild-type when referring to a micro-organism, refers broadly to a cell that occurs in nature, i.e. a cell that has not been genetically modified.
- enzyme when used herein refers broadly to any substance, composed wholly or largely of protein or polypepetides, that catalyzes or promotes one or more chemical or biochemical reactions.
- gene when used herein refers to a polynucleotide that codes for a particular sequence of amino acids, which comprise all or part of one or more proteins or enzymes, and may include regulatory (non-transcribed) DNA sequences, such as promoter sequences, which determine for example the conditions under which the gene is expressed.
- the transcribed region of the gene may include untranslated regions, including introns, 5'-untranslated region (UTR), and 3 -UTR, as well as the coding sequence.
- nucleic acid or “recombinant nucleic acid” refers to polynucleotides such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA).
- expression and the like when used in relation to a gene sequence refers to transcription of the gene and, as appropriate, translation of the resulting mRNA transcript to a protein.
- vector refers broadly to any means by which a nucleic acid can be propagated and/or transferred between organisms, cells, or cellular components.
- Vectors can include, but is not limited to, viruses, bacteriophage, pro- viruses, plasmids, phagemids, transposons, and artificial chromosomes such as YACs (yeast artificial chromosomes), BACs (bacterial artificial chromosomes), and PLACs (plant artificial chromosomes), and the like, and can be "episomes," that is, that replicate autonomously or can integrate into a chromosome of a host cell.
- a vector can also be a naked RNA polynucleotide, a naked DNA polynucleotide, a polynucleotide composed of both DNA and RNA within the same strand, a poly- lysine-conjugated DNA or RNA, a peptide-conjugated DNA or RNA, a liposome- conjugated DNA, or the like, that are not episomal in nature, or it can be an organism which comprises one or more of the above polynucleotide constructs such as an agrobacterium or a bacterium.
- transformation when used in the context of genetic engineering refers to the process by which a vector is introduced into a host cell.
- Transformation or transduction, or transfection
- transformation can be achieved by any one of a number of means including electroporation, microinjection, biolistics (or particle bombardment-mediated delivery), or agrobacterium mediated transformation.
- optionally substituted as used herein means the group to which this term refers may be unsubstituted, or may be substituted with one or more groups.
- substituent groups include alkyls, alkenyl, alkynyl, thioalkyl, cycloalkyl, cycloalkenyl, heterocycloalkyl, halo, carboxyl, haloalkyl, haloalkynyl, hydroxyl, alkoxy, thioalkoxy, alkenyloxy, haloalkoxy, haloalkenyloxy, nitro, amino, nitroalkyl, nitroalkenyl, nitroalkynyl, nitroheterocyclyl, alkylamino, dialkylamino, alkenylamine, alkynylamino, acyl, alkenoyl, alkynoyl, acylamino, diacylamino, acyloxy, alkylsulfonyloxy, heterocycloxy, heterocycloamino, haloheterocycloalkyl, alkylsulfenyl, alkylcarbon
- homology refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
- association with refers to a broad relationship between the two elements.
- the relationship includes, but is not limited to a physical, a chemical or a biological relationship.
- elements A and B may be directly or indirectly attached to each other or element A may be produced by element B or vice versa.
- the word “substantially” whenever used is understood to include, but not restricted to, “entirely” or “completely” and the like.
- terms such as “comprising”, “comprise”, and the like whenever used are intended to be non-restricting descriptive language in that they broadly include elements/components recited after such terms, in addition to other components not explicitly recited.
- terms such as “about”, “approximately” and the like whenever used typically means a reasonable variation, for example a variation of +/- 5% of the disclosed value, or a variance of 4% of the disclosed value, or a variance of 3% of the disclosed value, a variance of 2% of the disclosed value or a variance of 1% of the disclosed value.
- the method of producing fatty acid esters from a composition comprising at least about 10% by weight of free fatty acids (FFA) may comprise incubating a plurality of micro- or nano-sized catalysing particles with the composition, to catalyse the conversion of at least about 80% of the FFA to fatty acid esters.
- the method may be carried out in the presence of an alcohol.
- the fatty acid esters comprise fatty acid alkyl esters.
- the fatty acid alkyl esters can be straight or branched chain fatty acid alkyl esters.
- the alkyl esters may be selected from a group comprising methyl esters, ethyl esters, propyl esters, butyl esters, pentyl esters, hexyl esters and mixtures thereof.
- the fatty acid alkyl esters comprise fatty acid methyl esters (FAME).
- the fatty acids disclosed herein may be selected from the group consisting of octanoic acid; decanoic acid; dodecanoic acid; tetradecanoic acid; hexadecanoic acid; heptadecanoic acid; cis, c/s-9,12-octadecadienoic acid; c/s-9-octadecenoic acid; and octadecanoic acid.
- composition disclosed herein may comprise at least about 10% by weight of free fatty acids, at least about 11% by weight of free fatty acids, at least about 12% by weight of free fatty acids, at least about 13% by weight of free fatty acids, at least about 14% by weight of free fatty acids, at least about 15% by weight of free fatty acids, at least about 20% by weight of free fatty acids, at least about 21% by weight of free fatty acids, at least about 22% by weight of free fatty acids, at least about 23% by weight of free fatty acids, at least about 24% by weight of free fatty acids, at least about 25% by weight of free fatty acids, at least about 30% of weight by free fatty acids, at least about 35% of weight by free fatty acids, at least about 40% by weight of free fatty acids, at least about 45% by weight of free fatty acids, at least about 50% by weight of free fatty acids, at least about 60% by weight of free fatty acids, at least about 70% by weight of free fatty acids or at least about 80% by weight of free
- the composition disclosed herein further comprises glycerides.
- the micro- or nano-sized catalysing particles is capable of additionally catalysing the conversion of the glycerides to fatty acid esters.
- the glycerides may be selected from the group consisting of triglycerides, diglycerides, and monoglycerides
- the composition disclosed herein may be grease.
- the grease may also be brown grease or waste oil that comprises animal and/or vegetable oil.
- the grease may be obtained as a by-product from industrial or manufacturing processes, such as from food industries (for e.g. restaurants).
- the alcohol disclosed herein may be an alcohol selected from the group consisting of methanol, ethanol, propanol, butanol, amyl alcohol and glycerol.
- the alcohol comprises a monoalcohol.
- the alcohol has the general formula R— OH wherein R represents C n (H 2n +i) and n is an integer ranging from 1 to 10.
- Examples of monoalcohols suitable for use include methanol, ethanol, n-propanoloxy (1 -propanol), isopropanol (2-propanol), n-butanol (1-butanol), sec-butantol (2-butanol), isobutanol (2-methyl-1 -propanol), ferf-butanol (2-methyl-2-propanol), n-pentanol (1-pentanol), 2-pentanol, 3-pentanol, 2-methyl-1- butanol, terf-pentanol (2-methyl-2-butanol), 3-methyl-1-butanol, 3-methyl-2-butanol, neo-pentanol (2,2-dimethyl-l-propanol), 1-hexanol, 1-heptanol, 1-octanol, or combinations thereof.
- the alcohol can be methanol, ethanol, propanol
- the alcohol comprises a polyol such as a diol, triol and the like. In one embodiment, the alcohol comprises at least one of a methanol, a glycerol and mixtures thereof.
- the molar ratio of the alcohol to the FFA may be from about 2:1 to about 50:1 , from about 3:1 to about 40:1 , from about 4:1 to about 30:1 , from about 5:1 to about 20:1 , from about 6:1 to about 15:1 , from about 7:1 to about 10:1 , from about 7:1 to about 9:1 , or from about 2:1 to about 8:1.
- the molar ratio of the alcohol to the GTO may be from about 2:1 to about 50:1 , from about 3:1 to about 40:1 , from about 4:1 to about 30:1 , from about 5:1 to about 20:1 , from about 6:1 to about 15:1 , from about 7:1 to about 10:1 , from about 7:1 to about 9:1 , or from about 2:1 to about 8:1.
- the alcohol is used in an excess amount that is more than the theoretical amount required to complete the reaction.
- the incubation step may be carried out under conditions suitable for the conversion of at least 80% of the FFA to fatty acid esters.
- the conditions may also be pre-determined before the start of the method or determined ad-hoc during the reaction process.
- Such conditions may comprise at least one of an incubation time, incubation temperature and incubation pressure.
- the incubation temperature may be a temperature of less than about 150°C, less than about 140°C, less than about 130°C, less than about 125°C, less than about 120°C, less than about 100°C, less than about 90°C, less than about 80°C, less than about 70°C, less than about 60°C, less than about 50°C or less than about 40°C.
- the incubation temperature is no more than about 100°C or no more than about 70°C.
- the incubation temperature is no more than about 40°C or no more than about 30°C.
- the incubation temperature when the alcohol used is methanol, the incubation temperature is no more than 70°C, no more than 80°C or no more than 90°C.
- the incubation temperature is no more than 100°C, no more than 10°C, no more than 120°C, no more than 125°C or no more than 130°C.
- the incubation pressure may be a pressure of no more than about 150 KPa, no more than about 140 KPa, no more than about 130 KPa, no more than about 125 KPa, no more than about 121 KPa, no more than about 120 KPa, no more than about 115 KPa, no more than about 110 KPa, or no more than about 105 KPa.
- the incubation pressure is substantially at standard atmospheric pressure, that is 1 atm (101.325 KPa).
- the incubation pressure is less than about 7.2 atm (729.54 KPa), 7.0 atm (709.275 KPa), 6.0 atm (607.95 KPa), 5.0 atm (506.625 KPa), 4.0 atm (405.3 KPa), 3.0 atm (303.975 KPa).
- the incubation time may be from about 0.5 hours to about 100 hours. In one embodiment, the incubation time is from about 0.5 hours to about 12 hours. In one embodiment, the incubation time is from about 0.5 hours to about 26 hours In one embodiment, the incubation time is from about 84 hours to about 96 hours.
- the incubation step is carried out under conditions suitable for the conversion of at least 80% of the FFA to alky esters, wherein said conditions comprise at least one of an incubation temperature of no more than about 50°C, an incubation temperature of no more than 121 KPa or an incubation time of from about 0.5 hours to about 8 hours.
- the amount of micro- or nano-sized catalysing particles added to the composition for incubation may be from about 0.01 % to about 20%, from about 0.01 % to about 15%, from about 0.01% to about 10%, from about 0.05% to about 10%, from about 0.1% to about 5%, from about 0.15% to about 4.5%, from about 0.2% to about 4.4%, from about 0.25% to about 4.3%, from about 0.3% to about 4.2%, from about 0.35% to about 4.1%, from about 0.4% to about 4.0%, from about 0.45% to about 3.9%, from about 0.5% to about 3.8%, from about 1% to about 3.7%, from about 1% to about 3.5%, from about 1% to about 3%, or from about 1 % to about 2% by weight of the composition.
- the amount of enzyme immobilized on micro- or nano-sized catalysing particles added to the composition for incubation is from about 0.01% to about 1% by weight of the composition. In one embodiment, the amount of micro- or nano-sized catalysing particles added to the composition for incubation is from about 3.5% to about 10% by weight of the composition. In one embodiment, the amount of micro- or nano-sized catalysing particles added to the composition for incubation is from about 0.1% to about 20% by weight of the composition.
- the incubation step may further comprise a step of stirring the mixture of the composition comprising the free fatty acids (FFA), the micro- or nano-sized catalysing particles and the alcohol.
- FFA free fatty acids
- the stirring step may be carried out at about 20 rpm to about 1200 rpm. In one embodiment, the stirring step may be carried out at about 30 rpm. In one embodiment, the stirring step may be carried out at about 1000 rpm. In one embodiment, the stirring step may be carried out at from about 250 rpm to about 500 rpm.
- the method disclosed herein is a "one-pot" reaction, wherein the composition comprising the free fatty acids (FFA), the micro- or nano- sized catalysing particles and the alcohol are incubated altogether in one reaction chamber to produce fatty acid esters from the composition.
- FFA free fatty acids
- the production of fatty acid esters may be carried out in one single step. Therefore in one embodiment, when the composition comprises glycerides, the conversion of FFA to fatty acid esters and the conversion of glycerides to said fatty acid esters are carried out simultaneously.
- the method disclosed herein is substantially free from solvent such as terf-butanol or /7-hexane.
- the method may further comprise exposing the glyceride to a base to catalyse the conversion of the glycerides to the fatty acid esters.
- the base may be added to the composition after at least about 80% of the FFA to have been converted to fatty acid esters, to further convert glycerides to the fatty acid esters.
- the base catalyst may be an alkali containing OH " groups.
- the base catalyst may be a metal hydroxide.
- the metal hydroxide may be selected from the group consisting of NaOH, KOH and the like.
- the base catalyst may also be selected from the group consisting of CH 3 ONa, CH 3 OK, Na 2 CO3, K 2 CO 3 and the like.
- the chemical reaction to convert FFA to fatty acid esters may comprise an esterification process.
- the chemical reaction to convert glycerides to fatty acid esters may comprise a transesterification process.
- the method disclosed herein may be capable of catalysing the conversion of at least about 80% of the FFA to fatty acid esters, at least about 85% of the FFA to fatty acid esters, at least about 90% of the FFA to fatty acid esters, at least about 95% of the FFA to fatty acid esters, at least about 96% of the FFA to fatty acid esters, at least about 97% of the FFA to fatty acid esters, at least about 98% of the FFA to fatty acid esters, at least about 99% of the FFA to fatty acid esters, or at least about 99.5% of the FFA to fatty acid esters.
- the method disclosed herein may have a fatty acid ester, for example a fatty acid methyl ester (FAME) production yield of at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.5%.
- the FAME standard may be the FAME yield obtained by the two-step reaction catalysed by Novozyme 435 and KOH. In certain embodiments, such FAME standards may be obtained by third party calibration curves that use the two-step reaction catalysed by Novozyme 435 and KOH.
- the micro- or nano-sized catalysing particles may have an average size or diameter of no more than about 800 ⁇ , no more than about 700 pm, no more than about 600 pm, no more than about 500 pm, no more than about 400 pm, no more than about 300 pm, no more than about 200 pm, no more than about 100 pm, no more than about 50 pm, no more than about 20 pm, no more than about 10 pm, no more than about 1 pm, no more than about 800 nm, no more than about 700 nm, no more than about 600 nm, no more than about 500 nm, no more than about 400 nm, no more than about 300 nm, no more than about 200 nm, no more than about 100 nm, no more than about 50 nm or no more than about 40 pm.
- the micro- or nano-sized catalysing particles have an average size or diameter of from about 40 nm to about 100 pm. In one embodiment, the micro- or nano-sized catalysing particles have an average size or diameter of from about 80 nm to about 500 pm. In one embodiment, the micro- or nano-sized catalysing particles have an average size or diameter of from about 500 nm to about 10 pm. In some embodiments, the micro-sized catalysing particles are comprised of clusters of nano- sized catalysing particles.
- the high surface area to volume ratio of the nano- and micro-sized catalysts allows for high catalyst loading on the particle surface, and the small size reduces the mass transfer limitations leading to high conversion and yield.
- the micro- or nano-sized catalysing particles can be substantially spherical, substantially elongate or substantially irregularly shaped. Accordingly, when the micro- or nano-sized catalysing particles are substantially spherical, the average size may be provided by the average diameter. When the micro- or nano-sized catalysing particles are substantially elongate or substantially irregularly shaped, the average size of the particles may be provided by the average length.
- the micro- or nano-sized catalysing particle may comprise a body having dimensions in the micrometer or nanometer range; and catalytic means associated with the body for catalysing the conversion of free fatty acids (FFA) to fatty acid esters, wherein the catalysing particle is adapted to catalyse the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters.
- the micro- or nano-sized catalysing particles are selected from a group consisting of polymer particles, silica particles, microorganism cells and mixtures thereof.
- the catalytic means may comprise at least one of an enzyme and an acid group.
- the catalytic means may comprise more than one enzyme.
- the enzymes may be lipases.
- the enzyme comprises a hydrolase.
- the hydrolase may be a lipase selected from the group consisting of, Thermomyces lanuginosus lipase (TLL), Candida antarctica lipase B (CALB), Candida antarctica lipase A (CALA), Serratia marcescens lipase (SML), Pseudomonas cepacia lipase, Candida rugosa lipase, Burkholderia lipase, Rhizomucor miehei lipase, Aspergillus niger lipase, Penicillium roqueforti lipase, Rhizopus niveus lipase, Rhizopus oryzae lipase, Alcaligenes sp.
- the acid group may be an inorganic acid group.
- the acid group may be selected from a group consisting of sulfonic acid, heteropoly acid and mixtures thereof.
- the sulfonic acid is derived from at least one of methanesulfonic acid, benzenesulfonic acid, or propanesulfonic acid.
- the acid group comprises a sulfonic acid group.
- the sulfonic acid group is derived from methanesulfonic acid. In one embodiment when the micro- or nano-sized catalysing particles comprises polystyrene (PS) particles, the sulfonic acid group is derived from benzenesulfonic acid. In one embodiment when the micro or nano-sized catalysing particles comprise silica particles, the sulfonic acid group is derived from propanesulfonic acid.
- PGMA poly(glycidyl methacrylate)
- PS polystyrene
- the sulfonic acid group is derived from benzenesulfonic acid. In one embodiment when the micro or nano-sized catalysing particles comprise silica particles, the sulfonic acid group is derived from propanesulfonic acid.
- the micro- or nano- sized catalysing particle may have a specific H + loading of about 0.1 to about 3 mmol H + per gram of particle.
- the specific H + loading may be about 0.1 mmol H + , about 0.2 mmol H + , about 0.3 mmol H + , about 0.4 mmol H + , about 0.5 mmol H + , about 0.6 mmol H + , about 0.7 mmol H + , about 0.8 mmol H + , about 0.9 mmol H + , about 1.10 mmol H + , about 1.20 mmol H + , about 1.30 mmol H + , about 1.40 mmol H ⁇ about 1.50 mmol H + , about 1.60 mmol H + , about 1.70 mmol H + , about 1.80 mmol H + , about 1.90 mmol H + , about 2.0 mmol H + , about 2.10 mmol H + ,
- the micro- or nano-sized catalyzing particle has a specific H + loading of about 0.5 to about 2.3 mmol H + per gram of particles. In one embodiment, the micro- or nano-sized catalyzing particle has a specific H + loading of about 2.3 mmol H + per gram of particles. In one embodiment, the micro- or nano-sized catalyzing particle has a specific H + loading of about 2.25 mmol H + per gram of particles. In one embodiment, the micro- or nano-sized catalyzing particle has a specific H + loading of about 0.54 mmol H + per gram of particles. In one embodiment, the micro- or nano-sized catalyzing particle has a specific H + loading of about 1.11 mmol H + per gram of particles.
- the micro- or nano-sized catalysing particles may be magnetic particles.
- the magnetic particles may be paramagnetic particles.
- the body of the magnetic particle may comprise an outer shell; and a magnetic core at least partially encapsulated by the outer shell, wherein the catalytic means associated with the body is a catalyzing entity immobilized on the outer shell, for catalyzing the conversion of FFA to fatty acid esters.
- the polymer shell encapsulates substantially the whole magnetic core.
- the magnetic core comprises a plurality of magnetic nano-sized particles.
- the magnetic core may be formed by clusters of magnetic nano-sized particles that are non-crosslinked and can be reversibly separated from one another.
- the magnetic nano-sized particles may have a substantially uniform size distribution with diameter from about 40 nm to about 800 nm.
- the magnetic nano-sized particles may have an average size or diameter of from about 5 nm to about 30 nm, from about 5 nm to about 20 nm, from about 5 nm to about 15 nm or from about 8 nm to about 20 nm.
- the magnetic nano-sized particles may be coated with a capping agent.
- the capping agent may be an acid. Without being bound by theory, it is believed that the capping agent may provide steric hindrance among the magnetic particle to improve stability.
- the capping agent may be selected from a group consisting of oleic acid, polyvinylpyrrolidone (PVP), trisodium citrate, cetyltrimethylammonium bromide (CTAB), and oleylamine.
- the magnetic property of the magnetic core may be provided by a metal oxide.
- the metal of the metal oxide may be selected from transition metals. In one embodiment, the metal of the metal oxide is selected from the metals of Group 6, Group 7 or Group 8 of the periodic table of elements.
- the metal oxide may be selected from a group consisting of Fe 3 0 4 , y-Fe 2 0 3 , FeCo, MnFe 2 0 4 and CoFe 2 0 4 . In one embodiment, the metal oxide comprises iron oxide (Fe 3 0 4 ). Accordingly, in one embodiment, the magnetic nano-sized particle is an iron oxide nano-sized particle coated with oleic acid.
- the outer shell is at least one of a polymer shell or a silica shell.
- the polymer may be selected from a group consisting of poly(glycidyl methacrylate) (PGMA), polystyrene (PS), poly(methyl methacrylate) (PMMA), polyvinyl acetate) (PVAc), polyvinyl alcohol) (PVA) and poly(ethylene glycol) (PEG).
- the outer shell comprises a material selected from the group consisting of poly(glycidyl methacrylate) (PGMA), polystyrene (PS), poly(methyl methacrylate) (PMMA), Silica and mixtures thereof.
- the enzyme may be immobilized on the outer shell via a linker selected from the group comprising epoxide functional group containing linker, amine functional group containing linker, aldehyde functional group containing linker, bezene functional group containing linker, ester functional group containing linker, anhydride functional group containing linker, carbonate functional group containing linker, acylazide functional group containing linker, isocyanate functional group containing linker, carboxylic acid phenyl ester functional group containing linker and mixtures thereof .
- the linker is 4, 7, 10-trioxa-1 ,13-tridecanediamine.
- the linker is obtained by reacting the outer shell of the particles with at least one of an amine and an aldehyde.
- the amine may be ethylene diamine (EDA) and the aldehyde may be glutaraldehyde (GA).
- EDA ethylene diamine
- GA glutaraldehyde
- the aldehyde group on the surface of the outer shell is introduced via the reaction of an amine surface group with glutaraldehyde.
- the micro- or nano-sized catalysing particle may have a specific loading of about 5mg to about 500 mg enzyme per gram of particle
- the specific loading may be about 10mg, about 20mg, about 30mg, about 40mg, about 50mg, about 60mg, about 70mg, about 80mg, about 90mg, about 100mg, about 110mg, about 120mg, about 130mg, about 140mg, about 150mg, about 160mg, about 170mg, about 180mg, about 190mg, about 200mg, about 210mg, about 220mg, about 230mg, about 240mg, about 250mg, about 260mg, about 270mg, about 280mg, about 290mg, about 300mg enzyme, about 310mg, about 320mg, about 330mg, about 340mg, about 350mg, about 360mg, about 370mg, about 380mg, about 390mg,
- the micro-sized catalyzing particle has a specific loading of about 10 to about 100 mg enzyme per gram of particles.
- the nano-sized catalyzing particle has a specific loading of about 0 to about 300 mg enzyme per gram of particles.
- the method may comprise forming a magnetic core; encapsulating at least part of the magnetic core with an outer shell; and immobilizing a catalyzing entity on the outer shell, wherein the catalysing entity is adapted to catalyse the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters.
- the step of forming a magnetic core may comprise forming a plurality of magnetic naho-sized particles.
- the step of forming a plurality of magnetic nano-sized particles can comprises co-precipitation to obtain the magnetic nano-sized particles.
- the step of encapsulating at least part of the magnetic core with the polymer shell comprises mixing the magnetic core with monomer precursors of the polymer shell; and polymerizing the monomer precursors to form a polymer shell that encapsulates at least part of the magnetic core.
- the polymerization reaction may be a free radical polymerization reaction.
- the polymerization reaction may be carried out by adding an initiator such as ammonium persulfate (APS) with the relevant monomers in the presence of the magnetic core to obtain magnetic micro or nano particles.
- the step of encapsulating the magnetic core with the silica shell comprises mixing the magnetic core with tetraethyl orthosilicate in water containing an alcohol and ammonia to obtain a mixture; and precipitating silica from the mixture to form a silica shell that encapsulates the magnetic core.
- the step of encapsulating the magnetic core with the silica shell comprises the use of the Stober method.
- the step of immobilizing a catalyzing entity to the outer shell may comprise at least one of chemically coupling the catalyzing entity to the outer shell or physically adsorbing the catalyzing entity to the outer shell.
- the step of chemical coupling the catalyzing entity to the outer shell may comprise adding polymer or silica particles to an acid solution to immobilize the catalyzing entity derived from the acid solution to the outer shell.
- the step of adding polymer or silica particles to an acid solution may be carried out under ambient conditions.
- the chemical coupling the catalyzing entity to the outer shell may comprise covalently coupling the catalyzing entity with the functional group of the outer shell which is chemically reactive to the catalyzing entity, to immobilize the catalyzing entity to the outer shell; or functionalizing the surface of the outer shell with a functional group chemically reactive to the catalyzing entity; and covalently or non covalently coupling the catalyzing entity with the functional group to immobilize the catalyzing entity to the outer shell.
- the step of functionalizing the surface of the outer shell may comprise (i) adding an organic amine group containing solution to the polymer particles; (ii) incubating the mixture under a first incubation temperature ; (iii) adding an aldehyde to the mixture after step (ii); and (iv) incubating the mixture of step (iii) under a second incubation temperature .
- the first incubation temperature may be higher than room temperature and may be more than about 50°C.
- the first incubation temperature may be at about room temperature and may be less than about 50°C.
- the step of chemically coupling the catalyzing entity with the functional group to immobilize the catalyzing entity to the outer shell may comprise adding an enzyme to the outer shell comprising the functional group that is chemically reactive to the catalyzing entity, in the presence of a suitable buffer and incubating the mixture at about 40°C or less.
- the micro- or nano-sized catalysing magnetic particles is adapted for being used repeatedly for a plurality of cycles, wherein at least about 80% of the FFA in a composition comprising about 10% by weight of (FFA), is converted to fatty acid in each cycle.
- the plurality of cycles may be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 cycles.
- the micro- or nano-sized catalysing magnetic particles may be collected for recycling or reusing by applying a magnetic field for collection.
- a method of separating the magnetic catalysing particles disclosed herein from a mixture comprising applying an external magnetic field to consolidate the magnetic catalysing particles together; and removing the rest of the mixture from the consolidated particles magnetic catalysing particles.
- a method of producing fatty acid esters from a composition comprising at least 10% by weight of free fatty acids (FFA) comprising incubating a plurality of recycled micro- or nano- sized catalysing particles obtained from the above separation method with the composition, to catalyse the conversion of FFA to fatty acid esters, such that at least 80% of the FFA are converted to fatty acid esters.
- FFA free fatty acids
- the micro-sized particles are MNA TL particles which comprises a non-crosslinked cluster of CHO- magnetic nanoparticles (CHO- MNPs) having Thermbmyces Lanuginosus Lipase (TLL) immobilized on the surface of the nanoparticles, the nanoparticles comprising an iron oxide core, poly(glycidyl methacrylate) shell, and an aldehyde surface group.
- CHO- MNPs CHO- MNPs
- TLL Thermbmyces Lanuginosus Lipase
- the MNA TL Magnetic nanobiocatalyst Aggregates immobilized with Thermomyces Lanuginosus Lipase particles may be prepared by shaking of TLL and CHO- MNPs in a phosphate buffer at a concentration of 7mM and at a pH of 5-8 at 4- 30°C for 0.5-12h.
- the micro-sized particles are poly(glycidyl methacrylate) microparticles which comprise non-crosslinked clusters of CHO functionalized magnetic nanoparticles (CHO-MNPs) having Candida Antarctica Lipase B (CALB) immobilized on the surface of the nanoparticles, the nanoparticles comprising an iron oxide core, poly(glycidyl methacrylate) shell, and an aldehyde surface group.
- the MNA CA Magnetic nanobiocatalyst Aggregates immobilized with CALB particles may be prepared by shaking CALB and CHO-MNPs in phosphate buffer at a concentration of 7mM and at a pH of 5- 8 at 4-30°C for 0.5-12h.
- the nano-sized particles comprises poly(glycidyl methacrylate) magnetic nanoparticles (GA-MNPs) having Candida Antarctica Lipase B (CALB) immobilized on the surface of the nanoparticles, the nanoparticles comprising an iron oxide core, poly(glycidyl methacrylate) shell, and an aldehyde surface group.
- GAP CA particles may be prepared by shaking CALB and GA-MNPs in phosphate buffer at pH of 7 and 4-30°C for 4- 12h.
- the nano-sized particles comprises ethylene diamine functionalized magnetic nanoparticles (EDA-MNPs) having Candida Antarctica Lipase B (CALB) immobilized on the surface of the nanoparticles,' the nanoparticles comprising an iron oxide core, poly(glycidyl methacrylate) shell, and an amine surface group.
- EDA-MNPs ethylene diamine functionalized magnetic nanoparticles
- the EDAP CA particles may be prepared by shaking CALB, glutaraldehyde, and EDA-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the nano-sized particles comprises polystyrene magnetic nanoparticles (PS-MNPs ) having Candida Antarctica Lipase B (CALB) immobilized on the surface of the nanoparticles, the nanoparticles comprising an iron oxide core, a polystyrene shell, and a benzene surface group.
- PS-MNPs polystyrene magnetic nanoparticles
- CALB Candida Antarctica Lipase B
- the PSP CA particles may be prepared via physical adsorption of CALB on the nanoparticles by shaking CALB and PS-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the nano-sized particles comprises poly(methyl methacrylate) magnetic nanoparticles (PMMA-MNPs) having Candida Antarctica Lipase B (CALB) immobilized on the surface of the nanoparticles, the nanoparticles comprising an iron oxide core, a poly(methyl methacrylate) shell, and ester surface group.
- PMMA-MNPs poly(methyl methacrylate) magnetic nanoparticles
- CALB Candida Antarctica Lipase B
- the PSP CA particles may be prepared via physical adsorption of CALB on the nanoparticles by shaking CALB and PMMA-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the method may be carried out in presence of silica gel microbeads in addition to the micro- or nano-sized catalysing particles.
- the micro- or nano-sized catalysing particle is a cell of a micro-organism, wherein the body of the particle is the body of the cell, and the catalytic means associated with the body is an enzyme produced in or from the body of the cell for catalyzing the conversion of FFA to fatty acid esters.
- the catalytic means associated with the body may be a plurality of enzymes that may be the same or different.
- the enzymes may be lipases such as triacylglycerol lipase (EC 3.1.1 .3).
- the enzyme comprises a hydrolase.
- the hydrolase may be a lipase that is from or derived from the group consisting of Serratia marcescens lipase (SML), Thermomyces lanuginosus lipase (TLL), Candida antarctica lipase A (CALA), Candida antarctica lipase B (CALB), Rhizomucor miehei lipase, Aspergillus niger lipase, Candida rugosa lipase, Penicillium roqueforti lipase, Rhizopus niveus lipase, Rhizopus oryzae lipase, Alcaligenes sp. lipase, Achromo-bacter sp.
- lipase Burkholderia cepacia lipase, Pseudomonas stutzeri lipase, Mucor miehei lipase, Pseudomonas cepacia lipase and Aspergillus oryzae lipase, and any variant which has an amino sequence with at least about 70% homology/identity, at least about 80% homology/identity, at least about 90% homology/identity, at least about 95% homology/identity, at least about 96% homology/identity, at least about 97% homology/identity, at least about 98% homology/identity, at least about 99% homology/identity or about 100% homology/identity to one of these.
- the variant can have up to 10, up to 9, up to 8, up to 7, up to 6, or up to 5 amino acid alterations to one of the lipases listed above, wherein each amino acid alteration is an amino acid substitution, deletion or addition, in any combination.
- the amino acid substitutions are conservative substitutions.
- the micro-organism may be a wild type strain of micro-organism expressing the hydrolase.
- the wild type strain of micro-organism is or is derived from Serratia marcescens, Thermomyces lanuginosus, Candida antarctica, Rhizomucor miehei, Aspergillus niger, Aspergillus oryzae, Mucor miehei, Candida rugosa, Penicillium roqueforti, Rhizopus niveus, Rhizopus oryzae, Rhizomucor miehei, Alcaligenes sp., Achromo-bacter sp., Burkholderia cepacia, Pseudomonas stutzeri Pseudomonas aeruginosa, Pseudomonas fluorescens, Pseudomonas cepacia, Bacillus pumilus, B.
- thermocatenulatus B. subtilis, B. licheniformis, B. coagulans, B. Cereus, Burkholderia cepacia and B. halodurans.
- Other genera like Acinetobacter, Staphylococcus, Streptococcus, Burkholderia, Serratia, Achromobacter, Arthrobacter, Alcaligenes and Chromobacterium.
- the microorganism may also be a recombinant micro-organism expressing one or more hydrolases that is/are derived from one or more wild type strain(s).
- the recombinant microorganism may comprise one or more exogenous nucleic acid sequence(s) encoding one or more lipases derived from the list of micro-organisms provided above.
- the recombinant micro-organism is or is derived from at least one of Escherichia coli (E. coli), Rhizopus oryzae, Pichia pastoris or Saccharomyces cerevisiae.
- a hydrolase derived from a wild type strain (which gene sequences are already reported) is cloned and expressed in E. coli.
- the hydrolase is derived from the lipase CALB from Candida antarctica (Genbank accession number Z30645.1 ).
- the gene sequence from a wild type strain may also be cloned and expressed in recombinant E. coli.
- the nucleotide sequence encoding the lipase CALB from Candida antarctica (Genbank accession number Z30645. 1) ⁇ s shown in SEQ ID No 1 below.
- Candida antarctica nucleic acid sequence for lipase B (Genbank accession number Z30645.1 ) atgaagctac tctctctgac cggtgtggct ggtgtgcttg cgacttgcgt tgcagccact cctttggtga agcgtctacc ttccggttcg gaccctgcct tttcgcagcc caagtcggtg ctcgatgcgg gtctgacctg ccagggtgct tcgccatcct ct cggtctccaa acccatcctt ctcgtcccg gaaccggcac cacaggtcca cagtcgttcg actcgaactg gatccccctctg tcaacgcagt tgggt
- polypeptide sequence for the lipase CALB from Candida antarctica (Genbank accession number Z30645.1) is shown in SEQ ID No 2 below.
- SEQ ID No 2 Candida antarctica amino acid sequence for lipase B (Genbank accession number Z30645.1 )
- the nucleotide sequence encoding the lipase TLL from Thermomyces lanuginosus is shown in SEQ ID No 3 below.
- SEQ ID No 3 Thermomyces lanuginosus nucleic acid sequence for lipase TLL (Genbank accession number EU022703.1 ) agcgacgata tgaggagctc ccttgtgctg ttctttgtct ctgcgtggac ggccttggcc agtcctattc gtcgaggtat gtggccacgc aatactctca tgcattgcct ttcgacctgc tgtactaaga ctgcacatac agaggtctcg caggatctgt taaccagtt caatctctttt gcacagtatt ctgc atactgcgga aaaaacaatg atgccccagc tggtacaac attacgtg
- the polypeptide sequence for the lipase TLL from Thermomyces lanuginosus is shown in SEQ ID No 4 below.
- SEQ ID No 4 Thermomyces lanupinosus amino acid sequence for lipase TLL (Genbank accession number EU022703.1 )
- the method comprises a) identifying a strain of micro-organism from a repertoire of hydrolase producing micro-organisms, the identified strain of micro-organism capable of catalysing the conversion of more FFA to fatty acid esters than at least about 50% of the other strains of micro-organisms in the repertoire; b) identifying a gene sequence of the hydrolase that is capable of catalysing the conversion of FFA to fatty acid esters from the identified strain in step a); and c) introducing the gene sequence in a host cell to obtain a recombinant host cell that is capable of expressing the hydrolase in an amount that is more than the strain of micro-organism identified in step a) under substantially similar conditions, wherein the recombinant host cell is capable of catalysing the conversion of at least 80% of the FFA in a composition comprising at least 10% by
- the hydrolase may be a lipase selected from those described above.
- the identified strain of micro-organism may be one that is capable of catalysing the conversion of more FFA to fatty acid esters than at least about 50%, than at least about 60%, than at least about 70%, than at least about 80%, than at least about 90%, than at least about 95% of the other strains of micro-organisms of the repertoire.
- the identified strain of micro-organism may be one that is capable of catalysing the conversion of more FFA to fatty acid than all the other strains of micro-organisms of the repertoire.
- the disclosed method provides a simple and efficient way to find new strain with high lipase activity, for example, by applying a selection pressure.
- the method can also be used to diversify the enzyme sources for biodiesel production. By using the developed whole cell biocatalysts, the production cost of biodiesel can potentially be greatly reduced due to their ready availability in large quantity at low cost.
- the recombinant host cell obtained in step c) is capable of converting more FFA to fatty acid esters than the strain of micro-organism identified in step a) under substantially similar conditions.
- the percentage conversion of FFA to fatty acid esters by the recombinant microorganism obtained in step c) may be at least 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 3- fold, 4-fold, 5-fold or 10-fold of the strain of micro-organism identified in step a).
- the amount of hydrolase produced for converting of FFA to fatty acid esters by the recombinant microorganism obtained in step c) may be at least 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 3-fold, 4-fold, 5-fold or 10-fold of the strain of micro-organism identified in step a).
- the conversion activity of FFA to fatty acid esters by the recombinant microorganism obtained in step c) may be at least 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2- fold, 3-fold, 4-fold, 5-fold or 0-fold of the strain of micro-organism identified in step a).
- the step c) of introducing may comprise the use of vectors.
- the identified exogenous gene may be prepared and inserted into an expression vector, which may be then transfected into a host cell, which may be then grown under culture conditions suitable for expressing the exogenous gene.
- Appropriate culture conditions are conditions of culture medium pH, ionic strength, nutritive content, etc.; temperature; oxygen/C0 2 /nitrogen content; humidity; and other culture conditions that permit production of the compound by the host microorganism, i.e., by the metabolic action of the microorganism.
- the recombinant microorganisms can be cultured in a bioreactor.
- the bioreactor can be used to culture microorganism cells through the various phases of their physiological cycle. Bioreactors may also allow for the control of one or more culture conditions such as temperature, pH, oxygen tension, carbon dioxide levels, and the like, as well as combinations thereof. Cells may also be cultured in shake flasks, test tubes, vials, microtiter dishes, petri dishes, or the like, or combinations thereof.
- the step a) of identifying a strain of micro-organism that is capable of catalysing the conversion of FFA to fatty acid esters comprises a1) obtaining a sample of soil; a2) screening the soil for micro-organisms exhibiting hydrolase activity; and a3) screening from a repertoire of micro-organisms identified to exhibit hydrolase activity in step a2), a strain of micro-organism that is capable of catalysing the conversion of more FFA to fatty acid esters than at least about 50% of the other strains of micro-organisms of the repertoire.
- nucleotide sequence of the identified gene is represented by SEQ ID No. 5
- SEQ ID No 5 Serratia marcescens nucleic acid sequence for lipase TLL (Genbank accession number DQ841349) ccaagcgccg cataccaata acgtttcatc aatcagtctc cttaatgtct atgcagagct atcagtatag gagagccagc gccggcactg ttaaccaacg cacaatctcg ccaatttgat tcgcacgcct aatatttagg gctaatacta tttctaccga tgttggtcct ctgaccagct gtcgttcggc taacgttgtttttccctgtttc caccgccgac gcatgagagt tcactccccg gccaggcggc ataattcata aggaact
- the identified gene encodes for a polypeptide comprising an amino acid sequence represented by SEQ ID No. 6
- SEQ ID No 6 Serratia marcescens amino acid sequence for lipase (Genbank accession number DQ841349)
- DNA compounds differing in their nucleotide sequences can be used to encode a given amino acid sequence of the disclosure.
- the native DNA sequence encoding the biosynthetic enzymes described herein merely illustrates an embodiment of the disclosure, and the disclosure includes DNA compounds of any sequence that encode the amino acid sequences of the polypeptides and proteins of the enzymes utilized in the methods of the disclosure.
- an isolated nucleic acid molecule encoding a polypeptide homologous to the polypeptides/enzymes described herein can also be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence encoding the particular polypeptide, such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein, without loss or significant loss of a desired activity. Mutations can be introduced into the polynucleotide by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- some embodiments of the micro-organism disclosed herein may comprise a DNA sequence for encoding a hydrolase that is capable of catalysing the conversion of FFA to fatty acid esters, the DNA sequence having at least about 70% homology/identity, at least about 80% homology/identity, at least about 90% homology/identity, at least about 95% homology/identity, at least about 96% homology/identity, at least about 97% homology/identity, at least about 98% homology/identity, at least about 99% homology/identity or about 100% homology/identity to at least one of SEQ ID No. 1 , SEQ ID No. 3 or SEQ ID No. 5.
- the micro-organism is a recombinant micro-organism comprising a DNA sequence having at least 80% homology/identity to SEQ ID 1 and a DNA sequence having at least 80% homology/identity to SEQ ID 3.
- the micro-organism is a recombinant micro-organism comprising a DNA sequence having at least 80% homology/identity to SEQ ID 5.
- a polypeptide can typically tolerate one or more amino acid substitutions, deletions, and insertions in its amino acid sequence without loss or significant loss of a desired activity.
- some embodiments of the micro- organism disclosed herein may also express a polypeptide that is capable of catalysing the conversion of FFA to fatty acid esters, the polypeptide comprising an amino acid sequence that has at least about 70% homology/identity, at least about 80% homology/identity, at least about 90% homology/identity, at least about 95% homology/identity, at least about 96% homology/identity, at least about 97% homology/identity, at least about 98% homology/identity, at least about 99% homology/identity or about 100% homology/identity to SEQ ID No. 2 and/or SEQ ID No. 4 and/or SEQ ID No. 6.
- the polypeptide can have up to 10, up to 9, up to 8, up to 7, up to 6, or up to 5 amino acid alterations to SEQ ID No. 2 or SEQ ID No. 4 or SEQ ID No. 6, wherein each amino acid alteration is an amino acid substitution, deletion or addition, in any combination.
- the amino acid substitutions are conservative substitutions.
- the micro-organism is a recombinant micro-organism expressing a hydrolase having at least 80% homology/identity to SEQ ID No. 2 and a hydrolase having at least 80% homology/identity to SEQ ID No. 4.
- the micro-organism is a recombinant micro-organism expressing a hydrolase having at least 80% homology/identity to SEQ ID No. 6.
- the catalytic activity of the modified/altered polypeptide or enzyme may be reduced by no more than about 5%, no more than about 10%, no more than about 15%, or no more than about 20% with respect to the catalytic activity unmodified polypeptide or enzyme.
- the disclosure includes such polypeptides with alternate amino acid sequences, and the amino acid sequences encoded by the DNA described herein merely illustrate embodiments of the disclosure.
- the present disclosure also provides, in some embodiments, for recombinant microorganisms transformed with an isolated nucleic acid molecule including a nucleic acid sequence that is codon-optimized for expression in the recombinant microorganism.
- the present disclosure also provides recombinant microorganisms transformed with an isolated nucleic acid molecule including a nucleic acid sequence that is operably linked to one or more expression control elements.
- the recombinant microorganisms of the present disclosure are transformed with exogenous genes by the introduction of appropriate expression vectors.
- the expression vector may be a plasmid, a part of a plasmid, a viral construct, a nucleic acid fragment, or the like, or a combination thereof.
- Vectors may be introduced into prokaryotic and eukaryotic cells via transformation and/or transfection techniques within the capabilities of a person skilled in the art reading the present disclosure.
- Methods for the introduction of foreign nucleic acid into a host cell may include calcium phosphate and/or calcium chloride coprecipitation, DEAE-dextran-mediated transfection, lipofection, natural competence, chemically mediated transfer, electroporation, particle bombardment, or the like, or combinations thereof.
- the vector may also include sequences that promote expression of the transgene of interest (e.g., an exogenous lipase gene), such as a promoter, and may optionally include, for expression in eukaryotic cells, an intron sequence, a sequence having a polyadenylation signal, or the like, or combinations thereof.
- a promoter e.g., an exogenous lipase gene
- the gene can be transformed into the cells such that it becomes operably linked to an endogenous promoter by homologous recombination, site specific integration, and/or vector integration.
- the disclosure provides methods for the heterologous expression of one or more genes involved in hydrolase expression, included within the scope of the disclosure are recombinant expression vectors that include such nucleic acids.
- the polynucleotide of the disclosure may be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to PCR amplification techniques within the capabilities of a person skilled in the art and those procedures described in the Examples section below.
- the nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis.
- oligonucleotides corresponding to nucleotide sequences can be prepared by synthetic techniques within the capabilities of a person skilled in the art, e.g., using an automated DNA synthesizer.
- the micro- or nano-sized catalysing particle described herein is a lyophilized cell of a micro-organism. The lyophilisation of the cell of the micro-organism may be carried out by vacuum freeze drying for about 24 hours to about 72 hours.
- the micro- or nano-sized catalysing particle described herein is a lyophilized cell of a micro-organism and is adapted for being used repeatedly for a plurality of cycles, wherein at least about 80% of the FFA in a composition comprising about 10% by weight of (FFA), is converted to fatty acid in each cycle.
- the plurality of cycles may be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 cycles.
- the lyophilized cells may be collected for recycling or reusing by applying a centrifugal force for collection.
- a method of separating the catalysing particles disclosed herein from a mixture comprising applying a centrifugal force to consolidate the catalysing particles together; and removing the rest of the mixture from the consolidated catalysing particles.
- a method of producing fatty acid esters from a composition comprising at least 10% by weight of free fatty acids (FFA) comprising incubating a plurality of recycled micro- or nano-sized catalysing particles obtained from the above separation method with the composition, to catalyse the conversion of FFA to fatty acid esters, such that at least 80% of the FFA are converted to fatty acid esters.
- FFA free fatty acids
- Fig. 1 is a schematic showing a chemical reaction occurring in the production of fatty acid methyl ester (FAME) from grease trap oil (GTO) using nano- and micro- biocatalysts with esterification and transesterfication being carried out simultaneously in one pot, in accordance with one embodiment disclosed herein.
- R x , Ri, R 2 , and R 3 in Fig. 1 represent aliphatic groups which can be the same or different from each other.
- FIG. 2 is a schematic showing a chemical reaction flowchart occurring in the production of fatty acid methyl ester (FAME) from grease trap oil (GTO) via two steps: a) Esterification of free fatty acids (FFA) with methanol using nano- and micro- biocatalysts; b) Transesterfication of triglyceride (TG) with methanol using base- catalyst, in accordance with one embodiment disclosed herein.
- R x , Ri, R 2 , and R 3 in Fig. 2 represent aliphatic groups which can be the same or different from each other.
- Fig. 3 is a schematic showing a flowchart for the synthesis of magnetic nano- and micro- biocatalyst containing hydrolase MNA (Magnetic nanobiocatalyst Aggregates), where the hydrolase can be MNA CA (CA: Candida Antarctica Lipase B ) or MNA TL (TL: Thermomyces Lanuginosus Lipase), in accordance with one embodiment disclosed herein.
- MNA CA Candida Antarctica Lipase B
- MNA TL Thermomyces Lanuginosus Lipase
- Fig. 4 is a transmission electron microscopy (TEM) image of CHO-MNPs, in accordance with one embodiment disclosed herein.
- TEM transmission electron microscopy
- Fig. 5a is a microscopic image of MNA CA, in accordance with one embodiment disclosed herein.
- Fig. 5b is a microscopic image of MNA TL after being freeze-dried and redispersed in GTO, in accordance with one embodiment disclosed herein.
- Fig. 7 is a schematic showing a synthesis scheme of magnetic nano- and micro- biocatalyst particles, namely Hydrolase PMMP, Hydrolase PSP, Hydrolase EDAP and Hydrolase GAP, in accordance with some embodiments disclosed herein.
- the hydrolase can be Candida antartica Lipase B (CA) such that the catalytic particles include PMMP CA, PSP CA, EDAP CA and GAP CA in accordance with some embodiments disclosed herein.
- CA Candida antartica Lipase B
- Fig. 8a is a transmission electron microscopy (TEM) image of PMMA-MNPs, in accordance with some embodiments disclosed herein.
- TEM transmission electron microscopy
- Fig. 8b is a transmission electron microscopy (TEM) image of PS-MNPs, in accordance with one embodiment disclosed herein.
- TEM transmission electron microscopy
- Fig. 8c is a transmission electron microscopy (TEM) image of EDA-MNPs, in accordance with one embodiment disclosed herein.
- Fig. 9a is a GC chromatogram of a FAME standard production, in accordance with one embodiment disclosed herein.
- Fig. 9b is a GC chromatogram of FAME produced from GTO in one-pot reaction catalyzed by MNA TL, in accordance with one embodiment disclosed herein.
- Fig. 10 is a graph of FAME production from GTO in one-pot reaction, where the FFA conversion and FAME yield after 12 hours are plotted for different loadings of MNA TL, in accordance with some embodiments disclosed herein.
- ( ⁇ ) represents FFA conversion and ( ⁇ ) represents FAME yield.
- Fig. 1 1 is a graph showing the time course of FAME production by biotransformation of grease with methanol in one-pot reaction with different biocatalysts on a 1g scale: ( ⁇ ) represents MNA TL at 3.3 wt% (TLL at 0.2 wt%), ( ⁇ ) represents Lipozyme ® TL IM at 3.3 wt%, (T) represents free TLL at 0.2 wt%; and on a 30g scale: (A) represents MNA TL at 3.3 wt%, in accordance with some embodiments disclosed herein.
- Fig. 12 is a bar chart showing the FAME conversion from GTO in one-pot reaction when MNA TL is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 13 is a graph showing the esterification conversion of FFA in GTO after 4 hours with different amounts of MNA CA, in accordance with some embodiments disclosed herein.
- Fig. 14 is a graph showing the time course of FFA conversion in the biotransformation of grease with methanol catalyzed by MNA CA at 0.45 wt% (CALB at 0.01 wt%) represented by (B);free CALB at 0.01 wt% represented by ( ⁇ ), and Novozyme 435 ® at 0.45 wt% represented by (A), in accordance with an embodiment disclosed herein.
- Fig. 15 is a bar chart showing the esterification conversion of FFA from GTO when MNA CA is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 16 is a graph showing the time course of esterification of FFA in GTO catalyzed by PMMAP-30 CA and PMMAP-4 CA, in accordance with some embodiments disclosed herein.
- Fig. 17 is a graph showing the time course of esterification of FFA in GTO catalyzed by PSP-30 CA and PSP-4 CA, in accordance with some embodiments disclosed herein.
- Fig. 18 is a graph showing the time course of esterification of FFA in GTO catalyzed by GAP-30 CA, GAP-4 CA and EDAP-30 CA, in accordance with some embodiments disclosed herein.
- Fig. 19 is a bar chart showing the esterification conversion of FFA from GTO when PMMAP CA is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 20 is a schematic showing a chemical reaction occurring in the production of the biodiesel (in this case, FAME) from grease via two steps: a) I) esterification of FFA in grease with methanol using recyclable nano- or micro-size paramagnetic solid acid catalyst; II) transesterification of the remaining triglyceride in grease with methanol using base catalyst.; b) I) esterification of FFA in grease with glycerol using recyclable nano- or micro-size paramagnetic solid acid catalyst; II) transesterification of the triglyceride in grease with methanol using base catalyst, in accordance with one embodiment disclosed herein.
- R x , Ri, R 2 , and R 3 in Fig. 20 represent aliphatic groups which can be the same or different from each other.
- Fig. 21 is a schematic showing a synthesis scheme of recyclable nano- and micro-size paramagnetic solid acid catalysts, in accordance with some embodiments disclosed herein.
- Fig. 22 is a transmission electron microscopy (TEM) image of nano-size SO3H-PGMA-MNPS, in accordance with some embodiments disclosed herein.
- TEM transmission electron microscopy
- Fig. 23 is a graph showing the FFA content in grease after esterification of the FFA with methanol by using nano- and micro-size solid acid catalysts in comparison with Amberlyst 15, in accordance with some embodiments disclosed herein.
- Fig. 25 is a bar chart showing the esterification conversion of FFA in grease in the presence of methanol when nano-size solid acid catalyst S0 3 H-PGMA-MNPs is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 26 is a transmission electron microscopy (TEM) image of nano-size S0 3 H-PS-MNPs, in accordance with some embodiments disclosed herein.
- TEM transmission electron microscopy
- Fig. 27 is a bar chart showing the esterification conversion of FFA in grease in the presence of methanol when nano-size solid acid catalyst S0 3 H-PS-MNPs is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 28 is a scanning electron microscopy (SEM) image of micro-size S0 3 H- PS-MNPs, in accordance with some embodiments disclosed herein.
- Fig. 29 is a graph showing the FFA content in grease after esterification of the
- Fig. 30 is a graph showing the FFA content in grease after esterification of the FFA with glycerol by using micro-size solid acid catalyst S0 3 H-PS-MNPs in comparison with Amberlyst 15, in accordance with one embodiment disclosed herein.
- Fig. 31 is a bar chart showing the esterification conversion of FFA in grease in the presence of methanol when micro-size solid acid catalyst S0 3 H-PS-MNPs is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 32 is a transmission electron microscopy (TEM) image of nano-size S0 3 H-Si-MNPs, in accordance with some embodiments disclosed herein.
- TEM transmission electron microscopy
- Fig. 33 shows pictures of separation of nano-size solid acid catalyst SO3H-S1- MNPs from a mixture by using magnet at time a) 0 min, b) 15 min, c) 30 min and d) 1 hour, in accordance with one embodiment disclosed herein.
- Fig. 34 is a bar chart showing the esterification conversion of FFA in grease in the presence of methanol when nano-size solid acid catalyst SO3H-S1-MNPS is recycled for a different number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 35 is a schematic showing a chemical reaction occurring in the production of FAME from grease trap oil (GTO) or waste grease using whole cell biocatalyst via esterification and transesterification in one-pot reaction, in accordance with some embodiments disclosed herein.
- GTO grease trap oil
- Fig. 36 is a schematic showing a chemical reaction occurring in the production of FAME from grease trap oil (GTO) or waste grease via two-step synthesis strategy. 1) Esterification of FFA with methanol using whole cell biocatalyst; 2) Transesterification of triglyceride with methanol using base-catalyst, in accordance with some embodiments disclosed herein!
- Fig. 37 is a schematic of an isolation and screening process lipase-producing strains from soil, in accordance with one embodiment disclosed herein.
- Fig. 38 is a bar chart showing the FAME yield obtained during catalysis with methanol using six different isolated strains, in accordance with some embodiments disclosed herein.
- the reactions were carried out at 30°C and 250 rpm for 72 h, with 2 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 3:1 , and methanol was added in three equal amounts at 24-h intervals.
- Fig. 39 is a bar chart showing the FFA conversion obtained during esterification of FFA in GTO with methanol using six isolated strains as the first step in the two-step reaction shown in Fig. 38, in accordance some embodiments disclosed herein.
- the reactions were carried out at 30°C and 250 rpm for 72 h, with 2 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 3:1 , and methanol was added in three equal amounts at 24-h intervals.
- Fig. 40 is a graph showing the time course of FAME production from GTO in one-pot reaction with methanol using the recombinant E.coli expressing lipase SML, in accordance with one embodiment disclosed herein.
- the reactions were carried out at 30°C and 500 rpm under magnetic stirring for 96 h, with 5 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 4:1 , and methanol was added in four equal amounts at 24-h intervals.
- Fig. 41 is a graph showing the time course of FFA conversion obtained during esterification of FFA in GTO with methanol using recombinant E.coli expressing the lipase SML as the first step in the two-step strategy shown in Fig. 40, in accordance some embodiments disclosed herein.
- the reactions were carried out at 30°C and 500 rpm under magnetic stirring system for 96 h, with 5 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 4:1 , and methanol was added in four equal amounts at 24-h intervals.
- Fig. 42 is a graph showing the time course of FAME production from GTO in one-pot reaction with methanol using different amounts of recombinant E.coli whole cells expressing lipase SML, in accordance with one embodiment disclosed herein.
- the reactions were carried out at 30°C and 500 rpm under magnetic stirring for 96 h at a molar ratio of methanol to GTO of 4:1 , and methanol was added in four equal amounts at 24-h intervals.
- Fig. 43 is a graph showing the time course of FAME production from GTO with methanol using recombinant E.coli expressing lipase CALB, in accordance with one embodiment disclosed herein.
- the reaction was conducted at 40°C and 250 rpm, with 4 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 3. , and methanol was added in three equal amounts at 12-h intervals.
- Fig. 44 is a graph showing the time course of FFA conversion obtained during esterification of FFA in GTO with methanol using recombinant E.coli expressing lipase CALB as the first step in the two-step strategy shown in Fig. 36, in accordance with some embodiments disclosed herein.
- the reaction was conducted at 40°C and 250 rpm, with 4wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 3:1 , and methanol was added in three equal amounts at 12-h intervals.
- Fig. 45 is a sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS- PAGE) image of cell free extracts of recombinant E. coli strains.
- SDS- PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
- M marker
- 1 E. coli (CALB/TLL) expressing two enzymes with one plasmid
- 2 E. coli (CALB)
- 3 E. coli (TLL)
- 4 E. coli (CALB-TLL) expressing two enzymes with two plasmids.
- Fig. 46 is a graph showing the time course of FAME production from GTO with methanol using recombinant E. coli expressing lipase CALB and TLL in one plasmid, in accordance with one embodiment disclosed herein.
- the reaction was conducted at 30°C and 500 rpm, with 4 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO of 3:1 , and methanol was added in three equal amounts at 6-h intervals.
- ( ⁇ ) represents FAME yield with wet cells
- ( ⁇ ) represents FAME yield with dry cells
- a ) represents FFA content with wet cells
- ( ⁇ ) represents FFA content with dry cells.
- Fig. 47 is a bar chart showing the relative FAME yield produced from GTO with methanol when recombinant E. coli expressing lipase CALB and TLL in one plasmid is recycled for a number of cycles, in accordance with some embodiments disclosed herein.
- Fig. 48 is an exemplary representation of a magnetic micro- or nano- catalyzing particle in accordance with one embodiment disclosed herein.
- Fig. 49 is an exemplary representation of a cell catalyzing particle accordance with one embodiment disclosed herein.
- Oleic acid coated superparamagnetic iron oxide magnetic nanoparticles having diameters of 5-20 nm were synthesized by co-precipitation method.
- An example of the co-precipitation method may be carried out as follows: Into 100 ml_ of de-ionized (Dl) water, 0.01 mol (2.703 g) ferric chloride hexahydrate (FeCI 3 .6H 2 O) and 0.005 mol (0.994 g) ferrous chloride tetrahydrate (FeCI 2 .4H 2 O) were added under mechanical stirring at 80°C and argon bubbling for 30 min. Then, 0.01 mol (8.014 g) of potassium oleate was added into the above solution and the mixture was continuously stirred for another 30 min.
- the iron oxide precipitation was initiated by rapidly injecting 35 ml_ of ammonium hydroxide (4% solution) to above mixture and reaction was continued for another 30 min.
- the oleic acid-stabilized iron oxide magnetic nanoparticles were collected by centrifugation at 16700g and 20°C for 10 min. After further purification by subjecting it to high gradient magnetic separator (HGMS), the OA- MNPs were ready for coating.
- HGMS high gradient magnetic separator
- OA-MNPs were obtained by the co-precipitation method
- 9 mg of ammonium persulfate (APS) and 0.126 ml_ of glycidyl methacrylate (GMA) were added to 25 ml_ suspension of OA-MNPs at a concentration of 0.27-1 mg/mL and the mixture was reacted for 1.5h to obtain GMA-MNPs containing poly(glycidyl methacrylate) shell with a diameter of 40- 300 nm.
- 0.011 mol (2.4 ml_) of 4,7,10-trioxa-1 ,13-tridecanediamine was then added to 48ml_ of aqueous suspension containing 0.
- Trioxa-MNPs 12g of GMA-MNPs, and the mixtures were stirred at 80°C for 24h.
- the resultant Trioxa-MNPs containing amino group on the surface were collected by centrifugation at 12000-21 OOOg for 10-30 min and washed by de-ionized water several times.
- 0.05-0.2g of Trioxa- MNPs was stirred in 135 mL of glutaraldehyde (10% solution) at room temperature for 18h.
- the generated aldehyde-containing nanoparticles (CHO- MNPs) were washed several times in de-ionised (Dl) water to give a mean diameter of 65 nm (Fig. 4).
- Thermomyces lanuginose Lipase TLL or TL
- Thermomyces lanuginose Lipase TLL or TL
- 0.07 g of CHO-MNPs in 35 mL phosphate buffer (7mM, pH 5-8) were shaken at 4°C (or room temperature) for 0.5-12h.
- the obtained biocatalyst MNA TL Magnetic nanobiocatalyst Aggregates immbolised with Thermomyces lanuginose Lipase
- MNPs clustered magnetic nanoparticles
- the micro-biocatalysts were collected by applying a magnetic field, and then subsequently washed and freeze-dried.
- the MNA TL obtained showed regular shape with sizes at 60 nm- 100 ⁇ (Fig. 5b), and having a specific loading of 20-1 OOmg TL per gram particles.
- Example 4 Preparation of magnetic nano-biocatalyst PSP CA 0.025 g of ammonium persulfate and 0.316 mL styrene were added to 30 ml_ of Dl water containing OA-MNPs (0.4-0.8 mg/mL), and the mixture was stirred at 80°C for 1 h. After centrifugation at 16700 g for 10 mins and washing with Dl water for several times, PS-MNPs with diameters of 80-800 nm were obtained (Figure 8b).
- phosphate buffer having a concentration of 0.75-1 mg/mL enzyme and PS-MNPs (which are at a ratio of 400mg CALB per gram of particles) at different pHs (pH from 5 to 8) was incubated at 30°C, 12 h, 30rpm.
- the resultant nanobiocatalyst particles were collected under magnetic field after centrifugation at 5000 rpm for 5 min. 100- 300mg enzymes were immobilized on one gram of PS-MNPs.
- GMA ammonium persulfate and 0.316 mL glycidyl methacrylate (GMA) were added into 30 mL Dl water containing OA-MNPs (0.4-0.8 mg/mL), and the mixture was stirred at 80°C for 1 h. After centrifugation at 16700 g for 10 min and washing by Dl water for several times, the produced GMA-MNPs was re-dispersed in 30mL Dl water.
- EDA-MNPs ethylene diamine magnetic nanoparticles
- Fig. 8c ethylene diamine magnetic nanoparticles
- glutaraldehyde, and EDA-MNP which are at a ratio of 400mg CALB per gram of particles
- the resultant nanobiocatalyst particles were collected under magnetic field after centrifugation at 5000 rpm for 5 min. 10-30mg of enzymes were immobilized on one gram of EDA-MNPs.
- Example 7 Preparation of FAME from GTO and methanol by one-pot reactions with nano- and micro-biocatalyst MNA TL
- a mixture of freeze-dried MNA TL containing 0.1-300 mg of TLL, 1-30 g of GTO (17wt% of FFA), MeOH (7.6 mol of MeOH :1 mol of FFA), and 0.1-9 g of silica gel micro-beads were shaken at 30°C and 30 rpm for 8-12 h.
- MNA TL was separated by applying an external magnetic field. Silica gel micro-bead and glycerol were then removed from biodiesel by centrifugation at 21500g in 10 min.
- the concentration of FAME was analyzed by using an Agilent gas chromatography (GC) with INNOWAX column at an inlet temperature of 220°C and FID temperature of 275°C. 5 pL of the sample was dissolved in 995 pL of A7-hexane containing 2 mmol/L of A?-hexadecane as internal standard.
- the temperature program was set as follows: increase from 150 to 225°C at a rate of 5°C/min, from 225°C to 260°C at the rate of 5°C/min, and keep at 260°C for 3 min.
- the GC chromatograms were shown in Fig. 9b.
- the FAME concentration was calculated based on the calibration curve with FAME standards (Fig. 9a).
- the biodiesel (FAME) standard was prepared from grease in a two-step process. Firstly-, 0.75 g Novozyme 435 ® was used for esterification of 30g waste grease with 2.08 g MeOH (3.5:1 mol of MeOH to FFA) were stirred at 30°C and 500rpm for esterification of FFA. After 2h, the Novozyme 435 ® was separated by centrifugation and the FFA content of grease was determined by titration. Only 0.5 wt% FFA left in the pre-treated grease. In the second step, 0.
- Fig. 3 An example route for preparing nano- and micro-biocatalysts is shown in Fig. 3. Oleic acid coated iron oxide magnetic nanoparticles with a diameter of 5- 20nm were first synthesized by a co-precipitation method and then reacted with poly(glycidyl methacrylate) to give magnetic core-shell structured nanoparticles containing epoxy surface function (GMA-MNPs) with a diameter 40-200 nm.
- GMA-MNPs epoxy surface function
- Fig. 5a and MNA TL (Fig. 5b) with size of 60nm-100 m were obtained.
- the micro-biocatalysts were formed by the non-crosslinked clustering of the individual nano-biocatalysts via physical interaction among the enzymes on the particles.
- the overall synthesis of both biocatalysts is simple and highly reproducible with 70-90% yield.
- Fig. 6 shows the separation of the biocatalysts in the mixture of GTO and FAME under external magnetic field within 1 min. The separation was fast and complete.
- Fig. 7 MNPs with iron oxide core and polymer shell such as polystyrene (PS) and poly(methyl methacrylate) (PMMA) were synthesized by the treatment of OA MNPs with the corresponding monomer such as methyl methacrylate or styrene, respectively.
- PS polystyrene
- PMMA poly(methyl methacrylate)
- freeze-dried MNA TL was used to catalyze the biotransformation of GTO containing 17% of FFA with MeOH (7.6 mol of MeOH:1 mol of FFA) in the presence of silica gel micro-beads at catalyst loading of 0.2wt% of TLL to GTO.
- the reaction was performed at 30°C for 12 h, and the biodiesel formation was followed by GC analysis (Fig. 9b).
- Fig. 9b By using 0.1-0.5 wt% of enzyme loading (based on TLL), the FAME yield reached 90-99% (Fig. 10).
- the addition of silica gel helped to remove the water present, thus driving the esterification to the formation of biodiesel.
- the developed nano- and micro-biocatalysts are also useful for the high- yielding transformation of FFA in GTO to FAME via esterification with methanol.
- This is the first step in the two-step preparation of biodiesel from grease shown in Fig. 2.
- MNA CA was used for the esterfication of FFA in GTO containing 16% FFA with MeOH.
- the reaction was examined at 0.01-0.1wt% of CA to GTO, 3.8: 1 (mol.mol) of MeOH to FFA, and 30°C.
- the reduced amount of FFA in GTO was determined by titration. As shown in Fig.
- nano-biocatalysts PMMA CA, PSP CA, EDAP CA and GAP CA were also proven to be efficient for the esterification of FFA in GTO with methanol to FAME.
- the acid value was drop from 15% to ⁇ 2% within 0.5-1 h reaction at low catalyst loading (1-2wt%; based on the nano-catalysts) (Fig.16- 8).
- the specific activity of these nanobiocatalysts was two times higher than that achieved with commercialized immobilized lipase Novozym 435 for the same transformation.
- the biocatalysts were also recycled and reused for six times, reducing the acid to ⁇ 2% in each run of the reaction.
- micro- or nano-biocatalysts may be used in a one-pot reaction for esterification of free fatty acids to FAME and the transesterification of triglycerides to FAME as shown in Fig. 1 or as a pre-treatment step esterification of free fatty acids to FAME in the two-step reaction shown in Fig. 2.
- Fig. 48 provides an exemplary graphical representation of a magnetic micro- or nano- catalyzing particle that may be adopted by some of the particles described in Examples 1-12.
- the particle 420 comprises an outer shell 424 having a magnetic core 422 encapsulated by the outer shell 424.
- Catalysing entities 426 are immobilized on the outer shell 424 by linkers 428.
- Oleic acid-stabilized superparamagnetic iron oxide magnetic nanoparticles were synthesized by co-precipitation method, yielding particles with diameters of 5-20 nm. 25 mg ammonium persulfate and 0 316 mL glycidyl methacrylate were added into 30 mL deionised (Dl) water containing 6.75 mg OA- MNPs, and the mixture was stirred at 80 °C for 1 h.
- the resultant poly(glycidyl methacrylate)-coated magnetic nanoparticles have a core-shell structure with diameter of 90 nm.
- the PGMA-MNPs were centrifuged at 16 700 g for 10 min, washed with Dl water several times, and re-suspended in Dl water. 7.28 g Na 2 SO 3 was then added into the PGMA-MNPs solution and the volume was adjusted to 72 mL by adding Dl water. The mixture was stirred at 80 °C for 24 h. The resultant sulfonated particles were repeatedly washed with Dl water. The particles were then protonated with 48 mL HCI solution (4%). After repeated washing by Dl water and freeze drying, nano-size solid acid catalyst SO 3 H-PGMA-MNPS with diameter of 90 nm were obtained (Fig. 22). By titration against 0.02 M KOH solution, the catalyst is tested to have an acid loading of 2.3 mmol H + /g.
- the catalyst was separated from the product mixture, washed with n-hexane, and freeze-dried. Subseguently, the catalyst was used in the new reaction round carried out in similar condition as the first batch.
- the magnetic property of the S0 3 H-PGMA-MNPs allows the catalyst to be separated from product mixture within 5 s (Fig. 24).
- the nano-size SO 3 H-PGMA- MNPs can be reused at least for 10 cycles without any regeneration needed, in which 96% conversion was achieved in each reaction round (Fig. 25).
- PS-MNPs polystyrene-coated magnetic nanoparticles
- HGMS high-gradient magnetic separator
- nano-size solid acid catalyst S0 3 H-PS-MNPs with diameter of 80 nm were obtained (Fig. 26).
- the catalyst is tested to have an acid loading of 1.11 mmol H + /g.
- Example 17 Esterification of FFA in grease with methanol by using nano-size paramagnetic solid acid catalyst SOgH-PS-MNPs A mixture of 8 mg catalyst, 0.195 g grease, and 0.18 mL methanol were shaken at 70°C and 1000 rpm. After 30 min, the catalyst and excess methanol were separated from the pretreated grease. By titration against 0.02 M KOH solution, the FFA content in pretreated grease was tested and the results showed that the FFA was reduced from 16 wt.% to 0.32 wt.% (corresponds to 98% conversion) as shown in Fig. 23.
- Example 18 Recycling of nano-size paramagnetic solid acid catalyst SO H-PS- MNPsfor esterification of FFA in grease with methanol
- the catalyst was separated from the product mixture, washed with n-hexane, and dried. Subsequently, the catalyst was used in the new reaction round carried out in similar condition as the first batch.
- the nano-size SO 3 H-PS-MNPS can be reused for at least for 8 cycles without any regeneration needed, in which conversion as high as 72-95% was achieved in each reaction round (Fig. 27).
- the PS-MNPs were prepared using the procedures in Example 16 and were purified by using HGMS and vacuum-dried to obtain micro-size PS-MNPs granules. Next, 150 mg of the granules were added into 7.5 ml_ sulfuric acid and the mixture was stirred at 39°C for 1.5 hours. After repeated washing by Dl water and vacuum drying, micro-size solid acid catalysts S0 3 H-PS-MNPs with sizes 60-500 ⁇ were obtained (Fig. 28). By titration against 0.02 M KOH solution, the catalyst is tested to have an acid loading of 2.25 mmol H + /g.
- Example 20 Esterification of FFA in grease with methanol by using micro-size solid acid catalyst SO ⁇ H-PS-MNPs
- Example 21 Scaled-up esterification of FFA in grease with methanol by using micro- size solid acid catalyst SQ ⁇ H-PS-MNPs
- Example 22 Esterification of FFA in grease with glycerol by using micro-size solid acid catalyst SOgH-PS-MNPs
- Example 23 Recycling of micro-size solid acid catalyst SO ⁇ H-PS-MNPs for esterification of FFA in grease with methanol
- Example 24 Synthesis of nano-size paramagnetic solid acid catalyst SOgH-Si-MNPs
- OA-MNPs were synthesized using similar protocol described in Example 13. Thereafter, 2 mL OA-MNPs, 5 mL aqueous ammonia, 160 mL ethanol, and 1 mL TEOS (tetraethylorthosilicate) were added into 40 mL Dl water, and the mixture was stirred at room temperature and 400 rpm for 24 hours.
- the resultant silica-coated magnetic nanoparticles (Si-MNPs) had a multicore-shell structure with mean diameter of 200 nm.
- the Si-MNPs were repeatedly washed by Dl water and freeze- dried.
- Example 25 Esterification of FFA in grease with methanol by using nano-size paramagnetic solid acid catalyst SO ⁇ H-Si-MNPs A mixture of 8 mg catalyst, 0.195 g grease, and 0.18 mL methanol were stirred at 70°C and 1000 rpm. After 5 hours, the catalyst and excess methanol were separated from the pretreated grease. By titration against 0.02 M KOH solution, the FFA content in pretreated grease was tested and the results showed that the FFA was reduced from 16 wt.% to 1 wt.% (corresponds to 94% conversion) as shown in Fig. 23.
- Example 26 Recycling of nano-size solid acid catalyst SO H-Si-MNPs for esterification of FFA in grease with methanol
- the catalyst was separated from the product mixture, washed with n-hexane and methanol, and freeze-dried. Subsequently, the catalyst was used in the new reaction round carried out in similar condition as the first batch.
- the magnetic property of the SO 3 H-S1-MNPS allows the catalyst to be separated from water within 30 mins (Fig. 33).
- the nano-size SO 3 H-S1- MNPs can be reused at least for 3 cycles without any regeneration needed (Fig. 34).
- the nano-size solid acid catalysts are paramagnetic core-shell nanoparticles which comprise of magnetic iron oxide (Fe 3 O 4 ) cores, external coating shell to protect the Fe 3 O 4 cores, and acid functional group grafted onto the surface of the coating shell (Fig. 21 ).
- the magnetic cores were synthesized by co-precipitation method, yielding Fe 3 O 4 nanoparticles with size of 5-20 nm in diameter, which is in the range of size required for the particles to exhibit superparamagnetic property.
- the polymerization reaction was carried out by adding about 6.75-16 mg OA-MNPs in a total of 30-40 mL mixture volume to 25 mg ammonium persulfate (APS) initiator and 0.316 mL monomer. The mixture was stirred at 80°C for 1-2.5 h to obtain polymer coated-MNPs.
- PGMA poly(glycidyl methacrylate)
- PS polystyrene
- Si silica
- the polymerization reaction was carried out by adding about 6.75-16 mg OA-MNPs in a total of 30-40 mL mixture volume to 25 mg ammonium persulfate (APS) initiator and 0.316 mL monomer. The mixture was stirred at 80°C for 1-2.5 h to obtain polymer coated-MNPs.
- APS ammonium persulfate
- the Stober method was carried out by mixing 2 mL OA-MNPs, 5 mL aqueous ammonia, 160 mL ethanol, and 1 mL TEOS (tetraethylorthosilicate) with 40 mL Dl water, and the mixture was stirred at room temperature and 400 rpm for 24 hours to afford silica-coated MNPs.
- TEOS tetraethylorthosilicate
- PGMA chains contain epoxide groups, which are chemically active and thus allow for the facile attachment of sulfonic acids via sulfonation reaction, thus yielding nanoparticles with acid function on the surface.
- PS chains contain reactive benzene rings which can be grafted with sulfonic acid moieties.
- Si is terminated by silanol functional groups which can be modified into thiols and subsequently oxidized to sulfonic acids.
- sulfonic acid functional groups were grafted onto the surface of each Fe30 -coated nanoparticles.
- Sulfonic acid was selected as the acid functional groups due to its inexpensive cost and high catalytic activity.
- the sulfonic acid groups were covalently attached on the nano-support, yielding stable nano-size solid acid catalyst which can be recycled and reused without any regeneration step.
- the micro-size solid acid catalysts obtained were the aggregated nano-size solid acid catalysts achieved by drying under vacuum.
- the fabricated catalysts namely nano-size sulfonated poly(g
- the four types of catalyst were successfully used for the pretreatment step in biodiesel production from grease, to reduce high FFA content.
- Methanol was used for esterification owing to its low cost.
- glycerol a byproduct of base-catalyzed transesterification process, was also used for the pretreatment step to reduce FFA in grease. The use of cheap glycerol can further decrease the biodiesel production cost.
- the paramagnetic property of the SO 3 H-PGMA-MNPS allows the catalyst to be separated within 5 s (Fig. 24).
- the easily separated catalysts can be reused for at least for 10 cycles without any regeneration needed, thus potentially being able to lower the production cost of biodiesel (Fig. 25).
- the acid concentration was sufficiently low for the next step biodiesel synthesis.
- the FFA content can be reduced from 16 wt.% to 1 wt.% (corresponds to 93% conversion) within 26 hours.
- the micro-size SO 3 H-PS-MNPS solid acid catalyst has higher activity compared to Amberlyst 15 for the esterification with glycerol (Fig. 30).
- Fig. 48 provides an exemplary representation of a magnetic micro- or nano- catalyzing particle that may be adopted by some of the particles described in Examples 13-26.
- the particle 400 comprises an outer shell 424 having a magnetic core 422 encapsulated by the outer shell 424.
- Catalysing entities 426 are immobilized on the outer shell 424 by linkers 428.
- Example 27 Screening for lipase-producing strains from soil Two grams of soil sample was suspended in 10 mL of M9 medium containing, per liter of tap water, 8.5 g of Na 2 HP0 4 .2H 2 0, 3.0 g of KH 2 P0 4 , 0.5 g of NaCI, 1.0 g of NH 4 CI, 2 mL of MgSO 4 (1 M) and 1 mL of Tris-methyl (MT) solution. The suspension was supplemented with 0.1 g of olive oil as the sole carbon source. The enrichment culture was conducted at 30°C and 300 rpm for 2-3 days.
- a Rhodamine B selection agar medium composed of, per liter of tap water, 1 g of (NH 4 ) 2 S0 , 1 g of K 2 HP0 4 , 5 g of KCI, 0.5 g of MgS0 4 .7H 2 0, 0.1 g of FeS0 4 .7H 2 0, 5 g of yeast extract, 5 g of tryptone, 120
- the colonies developed on agar with clear fluorescence zones under UV-illumination were selected for final screening.
- the strains isolated with obvious lipase activity by preliminary screening were individually inoculated into 3 mL of Lysogeny Broth (LB) medium and cultivated for 12 h, the preculture of 2.5 mL was inoculated to 50 mL of fermentation medium (glucose 8.0 g/L, yeast extract 5.0 g/L, peptone 5.0 g/L, K 2 HP0 4 0.5 g/L, KH 2 P0 0.5 g/L, NaCI 1.0 g/L, MgS0 .7H 2 0 0.4 g/L, Olive oil 5 g/L, pH 7.0).
- yeast extract 5.0 g/L
- peptone 5.0 g/L
- K 2 HP0 4 0.5 g/L
- KH 2 P0 0.5 g/L
- NaCI 1.0 g/L MgS0 .7H 2 0
- the cultivation was then cultivated for another 12 h at 30°C and 250 rpm. It will be appreciated that in other examples, the cultivation can be carried out at about 20°C to about 40°C and about 150 to about 400 rpm for about 6 to 18 hours. It will also be appreciated that in other examples, the enzyme expression can be carried out at about 15°C to about 30°C and about 150 to about 400 rpm for about 6 to 18 hours.
- the cells were harvested by centrifugation at 8000 rpm for 5 min and washed for 2 times with de-ionized water, the wet cells were then stored in -80°C for 6 h, and subjected to lyophilization using vacuum freeze dryer for 1 day to obtain the lyophilized cells. The lyophilized cells were used as catalysts for biodiesel production from GTO or esterification of FFA in GTO.
- Example 28 FAME production from GTO using isolated strains from soil
- the mixture was subjected to GC analysis to quantify the FAME using an Agilent GC with INNOWAX column and an inlet temperature of 220°C, Flame Ionization Detector (FID) temperature of 275°C.
- the temperature program was as follows: the temperature was increased from 150 to 225°C at a rate of 15°C/min, from 225°C to 260°C with the rate of 5°C/min and kept at 260°C for 3 min.
- the FAME conversion was calculated based on the FAME produced from the reaction described above and the FAME standard produced from the two-step reaction catalyzed by Novozyme 435 and KOH as described in Example 7 above.
- the strain P1-28 displayed the highest FAME yield, and the FAME yield from GTO reached 32% (Fig. 38).
- Example 29 Esterification of FFA in GTO using isolated strains from soil 2.0 g of GTO and 0.04 g of lyophilized cells (2 wt% catalyst loading) were added together to form a mixture. Methanol was added in equal amounts at 24-h intervals (molar ratio of methanol to FFA, 3:1). The reaction was conducted at 30°C and 300 rpm for 72 h. After reaction, 150 ⁇ _ of reaction mixture was withdrawn and centrifuged at 1 , 000 rpm for 10 min, the supernatant was mixed with isopropyl alcohol (5 mL) and then titrated using the KOH solution (20 mM) to determine the acid content left in GTO. Among all the strains isolated from soil, the strain P1-28 exhibited the highest esterification activity, and the FFA conversion reached 55% (Fig. 39).
- Example 30 Preparation of E.coli whole cell biocatalyst expressing lipase SML
- Recombinant E.coli 11 express expressing lipase SML (Serratia marcescens lipase) was inoculated to 5 mL of Lysogeny Broth (LB) medium after cultivation at 37 °C and 250 rpm for 12 h, 1% (v/v) of the preculture was transferred to 250 mL Erienmeyer flask containing 50 mL Terrific Broth (TB) medium containing, per liter of tap water, 12 g of tryptone, 24 g of yeast extract, 4 mL of glycerol, 2.3 g of KH2PO4, 16.37 g of K 2 HP0 4 .3H 2 0, 50 mg of kanamycin.
- LB Lysogeny Broth
- TB Terrific Broth
- the culture was incubated at 37 °C and 250 rpm up to an OD (Optical Density) 600nm of 0.6-0.8. Subsequently, lipase expression was induced by addition of isopropylthiogalactoside (IPTG, final concentration 0.1 mM). It will be appreciated that in other examples, the IPTG concentration used can vary from about 0.05 to 5 mM.
- IPTG isopropylthiogalactoside
- the culture was grown for an additional 12 h at 20 °C and 250 rpm and then cells were harvested by centrifugation at 6000 rpm for 5 min.
- Example 33 Preparation of E.coli whole cell biocatalyst expressing lipase CALB Recombinant E. coli BL 21 was inoculated to 5 mL of LB medium, after cultivation for 12 h, 2% (v/v) of the preculture was transferred to 500 mL Erienmeyer flask containing 100 mL LB medium supplemented with 50 mg/L of kanamycin. The culture was incubated at 37 °C and 250 rpm up to an OD600nm of 0.6-0.8. Subsequently, lipase expression was induced by addition of isopropylthiogalactoside (IPTG, final concentration 1 mM).
- IPTG isopropylthiogalactoside
- the culture was grown for an additional 6 h at 30 °C and 250 rpm and cells were harvested by centrifugation at 6000 rpm for 5 min. After washing two times with de-ionized water, the harvested wet cells were kept in - 80°C for 6 h, and subjected to lyophilization using vacuum freeze dryer for 24-36 h to obtain the lyophilized cells. The lyophilized E.coli whole cells were then used for biodiesel production from GTO or esterification of FFA in GTO.
- Example 34 FAME production from GTO using recombinant E.coli expressing lipase (CALB) 2.0 g of GTO and 0.08 g of lyophilized cells of recombinant E.coli expressing lipase CALB (4 wt% catalyst loading) were added together to form a mixture. Methanol was added in equal amounts at 12-h intervals (molar ratio of methanol to GTO, 3:1). The reaction was performed at 40°C and 250 rpm in the shaker. At designed time intervals, the FAME yield was determined as described in example 2. After 84 h reaction, 34% FAME yield was obtained (Fig. 43).
- CALB recombinant E.coli expressing lipase
- Example 36 Preparation of E.coli whole cell biocatalvst expressing lipases CALB and TLL
- Recombinant E.coli BL21 (DE3) expressing lipases CALB and TLL in one plasmid was inoculated to 5 mL of Lysogeny Broth (LB) medium, after cultivation at 37 °C and 250 rpm for 12 h, 1 % (v/v) of the preculture was transferred to a 500 mL Erlenmeyer flask containing 100 mL LB medium supplemented with 50 mg of kanamycin. The culture was incubated at 37 °C and 250 rpm up to an OD (Optical Density) 600nm of 0.6. Subsequently, lipase expression was induced by addition of isopropylthiogalactoside (IPTG, final concentration 0.2 mM).
- IPTG isopropylthiogalactoside
- the IPTG concentration used can vary from about 0.05 to 5 mM.
- the culture was grown for an additional 4 h at 30 °C and 250 rpm to an OD 600nm of 3, and then cells were harvested by centrifugation at 6000 rpm for 5 min.
- the E. coli whole cells were then used for biodiesel production from GTO or esterification of FFA in GTO.
- the expressing of the lipases CALB and TLL was analysed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) (Fig. 45).
- Cell-free extract was prepared by the disruption of the harvested cells with homogenizer under 20 psi followed by centrifugation.
- Soluble cell lysate (corresponding to 0.5 mL cell culture) were loaded to SDS-PAGE, and the gels were stained with Coomassie brilliant blue.
- Example 37 FAME production from GTO using recombinant E. coli expressing lipases CALB and TLL
- Example 38 Recycling of recombinant E. coli expressing lipases CALB and TLL for FAME production from GTO
- the whole cell E. coli was separated from the product mixture, washed with te/t-butanol, and dried at 30°C for 2 h. Subsequently, the whole cell E. coli was used in a new reaction round carried out in same conditions as the first batch. The cells retained 75% of the original productivity (FAME yield) after five reaction cycles (Fig. 47).
- Fig. 37 The screening process for lipase-producing strains from soil adopted by some of the Examples is shown in Fig. 37.
- two-step screening strategy was developed: the preliminary screening for lipase activity and the final screening for esterification or transesterification activities.
- An exemplary procedure for preliminary screening was as follows: Soil samples were collected from different places in Singapore, each soil sample (1-5 g) was suspended in 10 mL mineral salts medium. The suspension was supplemented with oil or fatty acid ester as carbon source to give a final concentration of 0.5-5% (v/v), and the enrichment culture was carried out at 20- 30°C and 150-300 rpm for 2 ⁇ 3 days.
- the strains were individually inoculated into 3-5 mL of LB medium and cultivated for 8-16 h, the preculture of 1 -5% (v/v) was inoculated to fermentation medium for further cultivation at 20- 30°C and 150-300 rpm. After 12 h cultivation, the cells were harvested by centrifugation and washed for 2 times with de-ionized water. The wet cells were then stored in -80 °C for 4-12 h and subjected to lyophilization using vacuum freeze dryer for 1 -3 days to obtain the lyophilized cells. The lyophilized cells were used as catalyst for esterification or transesterification activities test, respectively. Among all the strains tested, six strains displayed obvious esterification or transesterification activities.
- strain P1 -28 was identified as Serratia marcescens according to 16S rDNA gene sequencing and taxonomic analyses.
- the method for construction of recombinant E.coli expressing hydrolases from Serratia marcescens YXJ- 1002 was as follows: The enzyme gene sml was amplified by polymerase chain reaction (PCR) using DNA polymerase and a combination of forward (5 - ACTG4 TA TGGGCATCTTTAGCTATAAGGATCTG-3') and reverse (5'- TG CAA G C ⁇ 7 ⁇ A G G C C AAC AC C AC CTG ATC G-3 ' ) primers, where the underlines represent the Ndel and Hind III sites, respectively.
- the DNA genome from Serratia marcescens YXJ-1002 was used as a template.
- the PCR product was digested with Ndel and Hind III and inserted into corresponding restriction enzyme sites of plasmid pET-28a to construct recombinant expression plasmid pET28a-sml.
- the recombinant expression plasmid was transformed into E. coli T7 Express, and kanamycin-resistant transformants were subsequently selected using LB-agar plates supplemented with kanamycin. After the enzyme was cloned and expressed in E.coli, the hydrolytic activity of recombinant E.coli cell was greatly enhanced.
- Recombinant K coli 12 10 7 0.5 2304 + 40 215.3 ⁇ 0.1 a
- the reaction consisting of 0.03 g lyophilized cells, 2 mL olive oil emulsion and 3 mL phosphate buffer (pH 7.5, 25 mM), was conducted at 30°C and 250 rpm for 20 min. 5 mL of 95% ethanol was used to terminate the reaction.
- the amount of free fatty aicd produced was quantified by titration using KOH solution. One unit was defined as the amount of enzyme releasing 1 .0 micromole (10 "6 mole) of fatty acid per minute under the conditions above.
- the method for construction of recombinant E.coli expressing hydrolases such as the lipase CALB from Candida antarctica in the Examples was as follows: Optimized CALB gene (accession number Z30645.1 ) was synthesized by GenScript. CALB gene was digested with BamH I and Kpn I and inserted into corresponding restriction enzyme sites of plasmid pRSFDuet to construct recombinant expression plasmid pRSFDuet-Calb. The recombinant expression plasmid was transformed into E. coli BL 21 (DE3), and kanamycin-resistant transformants were subsequently selected using LB-agar plates supplemented with kanamycin.
- Optimized CALB gene accession number Z30645.1
- CALB gene was digested with BamH I and Kpn I and inserted into corresponding restriction enzyme sites of plasmid pRSFDuet to construct recombinant expression plasmid pRSFDuet
- the recombinant E.coli cells expressing the lipase CALB was prepared by cultivation, the cells harvested by centrifugation were washed three times with Dl water, and immediately lyophilized to obtain cell powder as described above, then used as whole cell biocatalyst for biodiesel production.
- the efficient transformation of GTO to FAME via one-pot esterification and transesterification with methanol was achieved by using the whole cell biocatalyst.
- the lyophilized E.coli whole cells expressing lipase SML was used as a catalyst to convert the GTO containing 17.4% of FFA with MeOH (4 mol of MeOH : 1 mol of GTO) at a catalyst loading of 5 wt% based on GTO.
- the developed whole cell biocatalysts are also useful for the high-yielding transformation of FFA in GTO to FAMEs via esterification with methanol.
- This is the first step in the two-step strategy for biodiesel production from grease shown in Fig. 36.
- E.coli whole cells expressing lipase SML was used for the esterification of FFA in GTO containing 17.4% of FFA with MeOH.
- the reaction was examined at 30°C and 500 rpm under magnetic stirring with 5 wt% of catalyst to GTO, 4:1 (mol.mol) of MeOH to GTO, and methanol was added in four equal amounts with 24-h interval.
- the reduced amount of FFA in GTO was determined by titration. As shown in Fig.
- the whole cell biocatalysts are able to convert the high amount of FFA in grease to FAME and can be used as an efficient pretreatment step. If desired, the remaining triglycerides in grease can also be easily converted to FAME via conventional base-catalysis.
- the E. coli whole cells expressing lipases CALB and TLL in one plasmid was also used for esterification of FFA in GTO containing 21.4% of FFA with methanol.
- the reaction was conducted at 30°C and 500 rpm, 4 wt% of catalyst loading based on GTO and molar ratio of methanol to GTO is 3:1 , and the methanol was added in three equal amounts with 6-h intervals.
- Fig. 46 87% FAME yield was achieved in 72 h.
- These cells can further be recycled up to five times while retaining 75% of the original productivity, shown in Fig. 47.
- the cell catalyst may be used in a one-pot reaction for esterification of free fatty acids to FAME and the transesterification of triglycerides to FAME as shown in Fig. 35 or as a pre-treatment step esterification of free fatty acids to FAME in the two-step reaction shown in Fig. 36.
- Fig. 49 provides an exemplary graphical representation of a cell catalyzing particle that may be adopted by some of the particles described in Examples 27-38.
- the particle 430 comprises a cell body 432 that produces catalysing entities 436 for the catalysis of FFA to fatty acid esters.
- the dotted lines 438 represent that the catalyzing entities 436 are produced and/or secreted by the cell body 432.
- Embodiments of the present disclosure advantageously allow free fatty acids (FFA) to be converted to fatty acid esters, in particular fatty acid methyl esters (FAME), at a high conversion rate. More specifically, at least 80% of the FFA may be converted to FAME from a composition comprising more than 10% by weight of FFAs, for example between 15% to 40% wt of FFAs.
- FFA free fatty acids
- Embodiments of the present disclosure can allow the production of FAME from grease in a one-pot reaction at high conversion efficiency, without having to undergo the conventional two-step esterification/transesterification reaction which may incur additional cost and reduce efficiency.
- embodiments of the present discloures also have the flexibility to be adopted in the conventional two-step esterification/transesterification reaction, where the embodiments of the catalysts disclosed herein can be used for the esterficiation process of the two-step reaction.
- embodiments of the method disclosed herein do not require high heat or pressure to carry out the reaction.
- the conversion of FFA to FAME in grease may be carried out at substantially ambient conditions.
- embodiments of the method disclosed herein may be performed under mild reaction conditions with the use of non-toxic and non-corrosive catalyst, and thus does not adversely affect the environment.
- Corrosive acid catalysts used in conventional esterification/transesterification reaction processes may not be necessary for some embodiments of the method disclosed herein.
- the methods disclosed herein do not require the use of a toxic solvent such as terf-butanol as compared with conventional processes. Accordingly, in some embodiments, the methods and catalysts disclosed herein can be regarded as being environment friendly.
- the catalysts disclosed herein can be recycled and reused in a fast and simple manner.
- the recycled catalysts can beneficially be used for a plurality of conversion cycles of free fatty acids to fatty acid esters while still maintaining a high conversion rate, that is, at least 80% of the FFA may be converted to FAME from a composition comprising more than 10% by weight of FFAs.
- the recyclability and reusability of some embodiments of the catalysts can potentially reduce the cost of biodiesel/biofuel production as the cost of catalyst replacement after each cycle is minimized.
- embodiments of the catalysts disclosed herein can be produced in a fast, efficient manner and at a low cost. This can potentially decreases the overall production cost biodiesel/biofuel production.
- SE 1 A method of producing fatty acid esters from a composition comprising at least 10% by weight of free fatty acids (FFA), the method comprising:
- SE 2 The method of SE 1 , wherein the fatty acid esters comprises fatty acid alky esters.
- SE 3 The method of any one of the preceding SEs, wherein the incubation step comprises incubating the plurality of micro- or nano-sized catalysing particles with the composition in the presence of an alcohol.
- SE 4 The method of any one of the preceding SEs, wherein the incubation step is carried out at temperature of less than 150°C.
- SE 5 The method of any one of the preceding SEs, wherein the incubation step is carried out at a pressure of less than 121 KPa.
- SE 6 The method of any one of the preceding SEs, wherein the incubation step is carried out from between 30 to 5760 minutes.
- SE 7 The method of any one of the preceding SEs, wherein the micro- or nano- sized catalysing particles have an average particle size or diameter of no more than 800 pm.
- SE 8 The method of any one of the preceding SEs, wherein the composition further comprises glycerides, preferably triglycerides.
- SE 9 The method of any one of the preceding SEs, wherein the composition comprises grease, preferably brown grease.
- SE 10 The method of SE 8, wherein the micro- or nano-sized catalysing particles is capable of additionally catalysing the conversion of the glycerides to fatty acid esters.
- SE 11 The method of SE 10, wherein the conversion of FFA to fatty acid esters and the conversion of glycerides to fatty acid esters is carried out simultaneously.
- SE 12 The method of SE 1 , wherein the conversion of FFA to fatty acid esters and the conversion of glycerides to fatty acid esters is a one-step process.
- SE 13 The method of SE 10, further comprises exposing the glyceride to a base to catalyse the conversion of the glycerides to fatty acid esters.
- SE 14 The method of any one of SEs 3 to 13, wherein the alcohol is selected from the group consisting of methanol, glycerol, ethanol, propanoi, butanol, amyl alcohol, and mixtures thereof.
- SE 15 The method of any one of SEs 3 to 14, wherein molar ratio of the alcohol to the composition is from 2:1 to 40:1.
- SE 16 The method of any one of the preceding SEs, wherein the micro- or nano-sized catalysing particles are selected from a group consisting of polymer particles, silica particles, micro-organism cells and mixtures thereof.
- SE 17 The method of SE 16, wherein the polymer particles or silica particles are magnetic particles.
- SE 18 The method of SE 17, wherein the magnetic particles are paramagnetic particles.
- SE 19 The method of SE 17, wherein the magnetic particle comprises:
- a catalyzing entity immobilized on the outer shell, for catalyzing the conversion of FFA to fatty acid esters.
- SE 20 The method of SE 17, wherein the magnetic property of the magnetic core is provided by a metal oxide, preferably an iron oxide.
- SE 21 The method of any one of SEs 19 to 20, wherein the magnetic core comprises a plurality of magnetic nano-sized particles.
- SE 22 The method of SE 21 , wherein the magnetic nano-sized particles are coated with a capping agent, preferably oleic acid.
- SE 23 The method of any one of SEs 21 to 22, wherein the magnetic nano- sized particles have an average diameter of 5-20 nm.
- SE 24 The method of any one of SE 18 to 23, wherein the outer shell is at least one of a polymer shell or a silica shell.
- SE 25 The method of SE 24, wherein the polymer shell comprises a polymer selected from the group consisting of poly(glycidyl methacrylate) (PGMA), polystyrene (PS) and poly(methyl methacrylae) (PMMA).
- PGMA poly(glycidyl methacrylate)
- PS polystyrene
- PMMA poly(methyl methacrylae)
- SE 26 The method of any one of SE 19 to 25, wherein the catalyzing entity is selected from at least one of an enzyme and an acid group.
- SE 27 The method of SE 26, wherein the enzyme comprises a hydrolase.
- SE 28 The method of SE 26, wherein the acid group comprises sulfonic acid.
- SE 29 The method of SE 27, wherein the hydrolase is selected from the group consisting of Candida antartica Lipase B (CALB) and Thermomyces lanuginose Lipase.
- CALB Candida antartica Lipase B
- Thermomyces lanuginose Lipase Thermomyces lanuginose Lipase.
- SE 30 The method of any one of SE 19 to 29, wherein the hydrolase is immobilized on the polymer shell via a linker selected from the group comprising epoxide functional group containing linker, amine functional group containing linker, aldehyde functional group containing linker, benzene functional group containing linker, ester functional group containing linker and mixtures thereof.
- SE 31 The method of SE 30, wherein the linker is 4,7, 10-trioxa-1 ,13- tridecanediamine.
- SE 32 The method of SE 16, wherein the micro-organism is a wild type strain of micro-organism expressing hydrolase.
- SE 33 The method of SE 15, wherein the micro-organism is a recombinant micro-organism expressing hydrolase.
- SE 34 The method of any one of SE 32 to 33, wherein the hydrolase comprises lipase.
- SE 35 The method of SE 32 wherein the wild type strain of micro-organism is SM YXJ-1002.
- SE 36 The method of SE 33, wherein the recombinant micro-organism is Escherichia coli expressing lipase.
- SE 37 The method of SE 32, wherein the wild type strain of micro-organism expressing hydrolase is isolated from soil using oil and/or fatty acid ester as a carbon source, preferably a sole carbon source.
- SE 38 The method of SE 37, wherein the oil comprises olive oil and the fatty acid ester comprises methyl palmitate.
- a micro- or nano-sized catalysing particle comprising:
- catalytic means associated with the body for catalysing the conversion of free fatty acids (FFA) to fatty acid esters
- catalysing particle is adapted to catalyse the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters.
- SE 40 The micro- or nano-sized catalysing particle of SE 39, wherein the particle is a magnetic particle and the body comprises:
- the catalytic means associated with the body is a catalyzing entity immobilized on the outer shell, for catalyzing the conversion of FFA to fatty acid esters.
- SE 41 The micro- or nano-sized catalysing particle of SE 40, wherein the magnetic property of the magnetic core is provided by a metal oxide.
- SE 42 The micro- or nano-sized catalysing particle of any one of SEs 40 to 41 , wherein the magnetic core comprises a plurality of magnetic nano-sized particles.
- SE 43 The micro- or nano-sized catalysing particle of SE 42, wherein the magnetic nano-sized particles are coated with a capping agent, preferably oleic acid.
- SE 44 The micro- or nano-sized catalysing particle of any one of SEs 40 to 43, wherein the outer shell is at least one of a polymer shell or a silica shell.
- SE 45 The micro- or nano-sized catalysing particle of SE 44, wherein the polymer shell comprises a polymer selected from the group consisting of poly(glycidyl methacrylate) (PGMA), polystyrene (PS) and poly(methyl methacrylae) (PMMA).
- PGMA poly(glycidyl methacrylate)
- PS polystyrene
- PMMA poly(methyl methacrylae)
- SE 46 The micro- or nano-sized catalysing particle of any one of SEs 40 to 45, wherein the catalyzing entity is selected from the group consisting of an enzyme and an acid group.
- SE 47 The micro- or nano-sized catalysing particle of SE 46, wherein the enzyme comprises a hydrolase.
- SE 48 The micro- or nano-sized catalysing particle of SE 46, wherein the acid group comprises sulfonic acid.
- SE 49 The micro- or nano-sized catalysing particle of SE 47, wherein the hydrolase is selected from the group consisting of Candida antartica Lipase B (CALB) and Thermomyces lanuginose Lipase.
- SE 50 The micro- or nano-sized catalysing particle of any one of SE 40 to 49, wherein the hydrolase is immobilized on the outer shell via a linker selected from the group comprising epoxide functional group containing linker, amine functional group containing linker, aldehyde functional group containing linker, benzene functional group containing linker, ester functional group containing linker and mixtures thereof.
- a linker selected from the group comprising epoxide functional group containing linker, amine functional group containing linker, aldehyde functional group containing linker, benzene functional group containing linker, ester functional group containing linker and mixtures thereof.
- SE 51 The micro- or nano-sized catalysing particle of any one of SE 40 to 50, wherein the particle has a specific loading of 10-100 mg enzyme per particle.
- SE 52 The micro- or nano-sized catalysing particle of SE 50, wherein the linker is 4,7, 10-trioxa-1 , 13-tridecanediamine.
- SE 53 The micro- or nano-sized catalysing particle of SE 39, wherein the micro- or nano-sized catalysing particle is a cell of a micro-organism, the body of the particle is the body of the cell, and the catalytic means associated with the body is an enzyme produced in or from the body of the cell for catalyzing the conversion of FFA to fatty acid esters.
- SE 54 The micro- or nano-sized catalysing particle of SE 53, wherein the enzyme is hydrolase.
- SE 55 The micro- or nano-sized catalysing particle of any one of SEs 53 to 54, wherein the micro-organism is a recombinant micro-organism expressing the hydrolase.
- SE 56 The micro- or nano-sized catalysing particle of any one of SEs 53 to 55, wherein the hydrolase comprises lipase.
- SE 57 The micro- or nano-sized catalysing particle of SE 55, wherein the recombinant micro-organism comprises one or more nucleic acid sequence that encodes for the hydrolase, the nucleic acid sequence having at least about 80% homology/identity, at least about 90% homology/identity, at least about 95% homology/identity, at least about 96% homology/identity, at least about 97% homology/identity, at least about 98% homology/identity, at least about 99% homology/identity or about 100% homology/identity to SEQ ID No. 1 and/or SEQ ID No. 3 and/or SEQ ID No. 5.
- SEQ ID No. 1 SEQ ID No. 1 :
- SE 58 The micro- or nano-sized catalysing particle of SE 55, wherein the recombinant micro-organism expresses the enzyme that is capable of catalysing the conversion of FFA to fatty acid esters, the enzyme comprising an amino acid sequence that at least about 80% homology/identity, at least about 90% homology/identity, at least about 95% homology/identity, at least about 96% homology/identity, at least about 97% homology/identity, at least about 98% homology/identity, at least about 99% homology/identity or about 100% homology/identity to SEQ ID No. 2 or SEQ ID No. 4 or SEQ ID No. 6.
- SEQ ID No. 4 MRSSLVLFFVSAWTALASPIRREVSQDLFNQFNLFAQYSAAAYCGKNNDAPAGTNI TCTGNACPEVEKADATFLYSFEDSGVGDVTGFLALDNTNKLIVLSFRGSRSIENWIG NLNFDLKEINDICSGCRGHDGFTSSWRSVADTLRQKVEDAVREHPDYRWFTGHS LGGALATVAGADLRGNGYDIDVFSYGAPRVGNRAFAEFLTVQTGGTLYRITHTNDIV PRLPPREFGYSHSSPEYWIKSGTLVPVTRNDIVKIEGIDATGGNNQPNIPDIPAHLW YFGLIGTCL SEQ ID No 6:
- SE 59 The micro- or nano-sized catalysing particle of SE 55, wherein the recombinant micro-organism is Escherichia coli expressing lipase.
- SE 60 A method of producing a micro- or nano-sized catalysing particle, the method comprising:
- the catalysing entity is adapted to catalyse the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters.
- SE 61 The method as claimed of SE 60, wherein the step of forming a magnetic core comprises forming a plurality of magnetic nano-sized particles.
- SE 62 The method of SE 61 , wherein the step of forming a plurality of magnetic nano-sized particles comprises coprecipitation to obtain the magnetic nano-sized particles.
- SE 63 The method of any one of SEs 61 to 62, wherein the magnetic nano- sized particles have an average diameter of 5-20 nm.
- SE 64 The method of any one of SEs 60 to 63, wherein the outer shell is at least one of a polymer shell or a silica shell.
- SE 65 The method of SE 64, wherein the step of encapsulating the magnetic core with the polymer shell comprises:
- SE 66 The method of SE 65, wherein the step of encapsulating the magnetic core with the silica shell comprises:
- SE 67 The method of any one of SEs 60 to 66, wherein the step of immobilizing a catalyzing entity to the outer shell comprising at least one of chemical coupling catalyzing entity to the outer shell or physically adsorbing the catalyzing entity to the outer shell.
- SE 68 The method of any one of SEs 60 to 66, wherein the step of immobilizing a catalyzing entity to the outer shell comprising:
- SE 69 A method of a obtaining a cell catalyst comprising: a) identifying a strain of micro-organism from a repertoire of hydrolase producing micro-organisms, the identified strain of micro-organism capable of catalysing the conversion of more FFA to fatty acid esters than at least 50% of the other strains of micro-organisms in the repertoire; b) identifying a gene sequence of the hydrolase that is capable of catalysing the conversion of FFA to fatty acid esters from the identified strain in step
- step a) introducing the gene sequence in a host cell to obtain a recombinant host cell that is capable of expressing the hydrolase in an amount that is more than the strain of micro-organism identified in step a) under substantially similar conditions,
- the recombinant host cell is capable of catalysing the conversion of at least 80% of the FFA in a composition comprising at least 10% by weight of FFA, to fatty acid esters.
- SE 70 A method of separating the magnetic catalysing particles of any one of SE 40 to 52 from a mixture, the method comprising:
- SE 71 A method of producing fatty acid esters from a composition comprising at least 10% by weight of free fatty acids (FFA), the method comprising: incubating a plurality of micro- or nano-sized catalysing particles obtained from the method of SE 68 with the composition, to catalyse the conversion of FFA to fatty acid esters, such that at least 80% of the FFA are converted to fatty acid esters.
- FFA free fatty acids
- the disclosed process producing FAME from grease trap oil (GTO) containing high concentration of FFA is achieved by both esterification and transesterification in one-pot with nano- or micro-biocatalysts.
- the disclosed process for producing FAME from grease trap oil (GTO) containing high concentration of FFA involves two steps in which high yielding of transformation of FFA in grease to the FAME is achieved by using nano- or micro-biocatalysts in the first step, and the conversion of the remaining triglyceride to FAME is achieved in the second step.
- the disclosed the grease trap oil is brown grease containing 14-22 wt% of FFA.
- the disclosed nano- and micro-biocatalysts are enzymes immobilized on magnetic nanoparticles.
- the disclosed magnetic nanoparticles are nanoparticles containing magnetic core, polymer shell, and functional groups on the surface.
- the disclosed magnetic core comprises multiple sub- nanoparticles with superparamagnetic properties and size or diameter of 5-20 nm.
- the disclosed sub-nanoparticle is iron oxide nanoparticle.
- the disclosed sub-nanoparticle is iron oxide nanoparticle with oleic acid coating.
- the disclosed the polymer shell is poly(glycidyl methacrylate) (PGMA).
- the disclosed polymer shell is polystyrene (PS). In one embodiment, the disclosed polymer shell is poly(methyl methacrylate) (PMMA).
- the disclosed functional group on the surface is epoxide. In one embodiment, the disclosed functional group on the surface is amine.
- the disclosed functional group on the surface is aldehyde.
- the disclosed functional group on the surface in is benzene. In one embodiment, the disclosed functional group on the surface is ester.
- the disclosed amine group is introduced via the reaction of epoxide surface group with a diamine.
- the disclosed diamine is ethylenediamine.
- the disclosed diamine is 4,7, 10-trioxa-1 , 13-tridecanediamine.
- the disclosed aldehyde group is introduced via the reaction of amine surface group with glutaraldehyde.
- the disclosed magnetic nanoparticles have a uniform size distribution with size or diameter at 40-800 rim.
- the disclosed enzyme is a hydrolase.
- the disclosed hydrolase is Candida antartica Lipase B (CALB).
- the disclosed hydrolase is Thermomyces Lanuginosus Lipase (TLL).
- the disclosed enzyme is immobilized on magnetic nanoparticles by covalent binding. In one embodiment, the disclosed enzyme is immobilized on magnetic nanoparticles by physical interaction.
- the disclosed microbiocatalysts are clusters of individual nanobiocatalyst.
- the disclosed clusters are non-crosslinked clusters.
- the disclosed clusters are reversible clusters.
- the disclosed microbiocatalysts are MNA TL which is the non-crosslinked cluster of nano-biocatalysts containing Thermomyces Lanuginosus Lipase (TLL) on the magnetic nanoparticles (CHO-MNPs) consisting of iron oxide core, poly(glycidyl methacrylate) shell, and aldehyde surface group.
- TLL Thermomyces Lanuginosus Lipase
- the disclosed microbiocatalysts MNA TL is prepared by shaking of TLL and CHO-MNPs in phosphate buffer (7mM, pH 5-8) at 4-30°C for 0.5-12h.
- the disclosed microbiocatalysts is MNA CA which is the non-crosslinked cluster of nano-biocatalysts containing Candida Antarctica Lipase B (CALB) on the magnetic nanoparticles (CHO- MNPs) consisting of iron oxide core, poly(glycidyl methacrylate) shell, and aldehyde surface group.
- the disclosed microbiocatalysts MNA CA is prepared by shaking CALB and CHO-MNPs in phosphate buffer (7mM, pH 5-8) at 4-30°C for 0.5-12h.
- the disclosed nanobiocatalysts in is GAP CA which contains CALB on the magnetic nanoparticles (GA-MNPs) consisting of iron oxide core, poly(glycidyl methacrylate) shell, and aldehyde surface group.
- GAP CA which contains CALB on the magnetic nanoparticles (GA-MNPs) consisting of iron oxide core, poly(glycidyl methacrylate) shell, and aldehyde surface group.
- the disclosed nanobiocatalysts GAP CA is prepared by shaking CALB and GA-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the disclosed nanobiocatalysts is EDAP CA which contains CALB on the magnetic nanoparticles (EDA-MNPs) consisting of iron oxide core, poly(glycidyl methacrylate) shell, and amine surface group.
- EDA-MNPs magnetic nanoparticles
- the disclosed nanobiocatalysts EDAP CA is prepared by shaking CALB, glutaraldehyde, and EDA-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the disclosed nanobiocatalysts is PSP CA which contains CALB on the magnetic nanoparticles (PS-MNPs) consisting of iron oxide core, polystyrene shell, and benzene surface group.
- PS-MNPs magnetic nanoparticles
- the disclosed nanobiocatalysts PSAP CA is prepared via physical adsorption by shaking CALB and PS-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the disclosed nanobiocatalysts is PMMAP CA which contains CALB on the magnetic nanoparticles (PMMA-MNPs) consisting of iron oxide core, poly(methyl methacrylate) shell, and ester surface group.
- PMMA-MNPs magnetic nanoparticles
- the disclosed nanobiocatalysts PMMAP CA is prepared via physical adsorption by shaking CALB and PMMA-MNPs in phosphate salt buffer at pH of 7 and 4-30°C for 4-12h.
- the disclosed micro-biocatalysts have a regular shape with size or diameter smaller than 100pm.
- the disclosed micro- biocatalysts have a specific loading of 10-100 mg enzyme per gram particles.
- the disclosed nano-biocatalysts have a specific loading of 10-300 mg enzyme per gram particles.
- the disclosed separation of the nano- or micro-biocatalysts is achieved by using external magnetic field.
- the disclosed separation of the nano- or micro-biocatalysts is achieved by centrifugation followed by magnetic separation.
- the disclosed high yielding production of FAME from grease trap oil (GTO) containing high concentration of FFA is achieved by the reaction of grease trap oil (GTO) with MeOH in the presence of silica gel microbead with nano- or micro-biocatalysts.
- the disclosed biocatalysts are recyclable, with high yielding of FAME in each cycle of biotransformation.
- the disclosed biocatalysts are separated from the reaction mixture under external magnetic field after each cycle of reaction, washed, freeze-dried, and then used for next cycles of reactions.
- the disclosed high-yielding transformation of FFA in GTO to FAME is achieved by the reaction of grease trap oil (GTO) with MeOH with nano- or micro-biocatalysts, leaving the product with ⁇ 1 wt% FFA which is suitable for further transformation of the remaining triglyceride to FAME by conventional base catalysis.
- GTO grease trap oil
- the disclosed biocatalysts are recyclable, with effectively reduction of FFA in GTO to 1-2 wt% in each cycle of biotransformation.
- the disclosed biocatalysts are separated from the reaction mixture under external magnetic field after each cycle of reaction, washed, freeze-dried, and then used for next cycles of reactions.
- a process for reducing free fatty acid in grease via esterification with an alcohol by using a recyclable nano- or micro- size paramagnetic solid acid catalyst is provided.
- the disclosed alcohol is methanol.
- the disclosed alcohol is glycerol.
- the disclosed recyclable nano-size paramagnetic solid acid catalyst is core-shell nanoparticles which consist of magnetic cores, polymer or inorganic shell, and acid groups on the surface.
- the disclosed magnetic cores comprises of multiple sub- nanoparticles with superparamagnetic properties and size or diameter of 5-20 nm.
- the disclosed sub-nanoparticles are iron oxide nanoparticles.
- the disclosed sub-nanoparticles are iron oxide coated with oleic acid.
- the disclosed polymer shell is poly(glycidyl methacrylate). In one embodiment, the disclosed polymer shell is polystyrene.
- the disclosed inorganic shell is silica.
- the disclosed acid group is sulfonic acid.
- the disclosed recyclable micro-size paramagnetic solid acid catalyst is the aggregated recyclable nano-size paramagnetic solid acid catalysts.
- the disclosed recyclable nano-size paramagnetic solid acid catalyst is prepared by mixing poly(glycidyl methacrylate)-coated magnetic nanoparticles with sodium sulfite, followed by mixing with hydrochloric acid.
- the disclosed recyclable nano-size paramagnetic solid acid catalyst is prepared by shaking polystryrene-coated magnetic nanoparticles with sulfuric acid.
- the disclosed recyclable nano-size paramagnetic solid acid catalyst is prepared by mixing silica-coated magnetic nanoparticles with 3- mercaptopropyl trimethoxysilane in ethanol and deionized water, followed by mixing with hydrogen peroxide in methanol and deionized water, and followed by mixing with sulfuric acid solution.
- the disclosed recyclable micro-size paramagnetic solid acid catalyst is prepared by drying the polystyrene-coated magnetic nanoparticles under vacuum and shaking the resultant microparticles with sulfuric acid.
- the disclosed recyclable nano-size paramagnetic solid acid catalyst is separated by using external magnetic field. In one embodiment, the disclosed recyclable micro-size paramagnetic solid acid catalyst is separated by centrifugation.
- the disclosed process for reducing free fatty acid in grease is achieved by the reaction of grease with methanol by using recyclable nano- or micro-size paramagnetic solid acid catalysts, leaving the product with low value of free fatty acid which is subjected to base-catalyzed transesterification with methanol to produce biodiesel.
- the disclosed recyclable nano- or micro-size paramagnetic solid acid catalysts are separated from reaction mixture by centrifugation or under magnetic field, washed, dried, and subsequently used in the next reaction round.
- the disclosed recyclable nano- or micro-size paramagnetic solid acid catalysts are reused without any regeneration needed, leaving the product with low value of free fatty acid after each reaction round.
- the disclosed process for reducing free fatty acid in grease is achieved by the reaction of grease with glycerol by using recyclable nano- or micro-size paramagnetic solid acid catalyst, leaving the product with low value of free fatty acid which is subjected to base-catalyzed transesterification with methanol to produce biodiesel.
- the disclosed recyclable nano- or micro-size paramagnetic solid acid catalysts are separated from reaction mixture by centrifugation or under magnetic field, washed, dried, and subsequently used in the next reaction round.
- the disclosed recyclable nano- or micro-size paramagnetic solid acid catalysts are reused without any regeneration needed, leaving the product with low value of free fatty acid after each reaction round.
- the disclosed process for producing FAME from grease trap oil (GTO) containing high concentration of FFA is achieved by both esterification and transesterification in one-pot reaction with whole cell biocatalysts.
- the disclosed process for producing FAME from grease trap oil (GTO) containing high concentration of FFA involves two steps in which high yielding of transformation of FFA in grease to the FAME is achieved by using whole cell biocatalyst in the first step, and the conversion of the remaining triglyceride to FAME is achieved in the second step with base catalysts.
- the disclosed grease trap oil (GTO) is brown grease containing 15-40 wt% of FFA.
- the disclosed whole cell biocatalysts are cells of a microorganism.
- the disclosed microorganism is a wild type strain.
- the disclosed microorganism is a recombinant microorganism. In one embodiment, the disclosed recombinant microorganism is recombinant Escherichia coli.
- the disclosed recombinant Escherichia coli is used for expressing enzyme.
- the disclosed enzyme is a hydrolase.
- the disclosed hydrolase is lipase SML from a wild type strain. In one embodiment, the disclosed hydrolase is Candida antartica Lipase B (CALB).
- CALB Candida antartica Lipase B
- the disclosed wild type strain is Serratia marcescens YXJ- 1002.
- the disclosed Serratia marcescens YXJ-1002 was isolated from soil using oil or fatty acid ester as sole carbon source.
- the disclosed oil is olive oil. In one embodiment, the disclosed oil is grease trap oil (GTO).
- GTO grease trap oil
- the disclosed fatty acid ester is methyl palmitate.
- the disclosed soil samples were collected in Singapore.
- the disclosed recombinant Escherichia coli is Escherichia coli T7 express.
- the disclosed recombinant Escherichia coli is Escherichia coli BL 21 (DE3).
- the disclosed whole cell biocatalysts are the lyophilized cells.
- the disclosed lyophilized cells are lyophilized Escherichia coli 17 express cells expressing lipase SML.
- the disclosed lyophilized cells are lyophilized Escherichia coli BL 21 (DE3) cells expressing lipase CALB.
- the disclosed preparation of lyophilized whole cell biocatalysts comprising 1 ) Inoculating the Escherichia coli T7 or Escherichia coli BL 21(DE3) cells to LB medium for seed cultivation; 2) Inoculating seed culture to LB or TB medium containing kanamycin for cultivation; 3) Inducing the enzyme expression by addition of isopropylthiogalactoside (TPTG); 4) Harvesting the cells by centrifugation and washing using de-ionized water; 5) Lyophilizing the wet whole cells using vacuum freeze to obtain the lyophilized cells.
- TPTG isopropylthiogalactoside
- the disclosed seed cultivation is conducted at 20-40°C and 150-400 rpm for 6-18 h. In one embodiment, the amount of seed culture used for inoculation is 0.5-5% (v/v).
- the OD600 value for enzyme induction is 0.6-0.8.
- the final concentration of IPTG used for induction is 0.05-5 mM.
- the enzyme expression is conducted at 15-30°C and 150- 400 rpm for 6-18 h.
- the cells harvested are washed with de-ionized water for 1-3 times. In one embodiment, the lyophilization is done for 24-72 h.
- the high yielding production of FAME from grease trap oil (GTO) containing high concentration of FFA is achieved by reaction of grease trap oil (GTO) with methanol using the whole cell biocatalysts.
- the catalyst loading of the whole cell biocatalysts is 1-10 wt% based on the grease trap oil (GTO).
- the total molar ratio of methanol to grease trap oil (GTO) was 3:1-8:1.
- the reaction was conducted at 20-50°C.
- the high-yielding transformation of FFA in GTO to FAME is achieved by the reaction of grease trap oil (GTO) with methanol with whole cell biocatalyst, leaving the product with ⁇ 1 wt% FFA which is suitable for further transformation of the remaining triglyceride to FAME by conventional base catalysis.
- the catalyst loading of the whole cell biocatalysts is 1-10 wt% based on the grease trap oil (GTO).
- the total molar ratio of methanol to grease trap oil (GTO) was 2:1-4:1.
- the reaction was conducted at 20-50°C.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Materials Engineering (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- General Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Wood Science & Technology (AREA)
- Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
- Enzymes And Modification Thereof (AREA)
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161541243P | 2011-09-30 | 2011-09-30 | |
| US201161541239P | 2011-09-30 | 2011-09-30 | |
| US201161564962P | 2011-11-30 | 2011-11-30 | |
| PCT/SG2012/000365 WO2013048346A1 (en) | 2011-09-30 | 2012-10-01 | Method of converting grease containing high content of free fatty acids to fatty acid esters and catalysts for use in said method |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP2751237A1 true EP2751237A1 (de) | 2014-07-09 |
| EP2751237A4 EP2751237A4 (de) | 2016-08-17 |
Family
ID=47996103
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP12835766.2A Withdrawn EP2751237A4 (de) | 2011-09-30 | 2012-10-01 | Verfahren zur umwandlung von fett mit hohem gehalt an freien fettsäuren in fettsäureester und katalysatoren zur verwendung in diesem verfahren |
Country Status (4)
| Country | Link |
|---|---|
| EP (1) | EP2751237A4 (de) |
| CN (1) | CN104080897A (de) |
| SG (2) | SG11201401013TA (de) |
| WO (1) | WO2013048346A1 (de) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20190040980A (ko) * | 2016-08-16 | 2019-04-19 | 헨켈 아게 운트 코. 카게아아 | 잠열성 중합 촉매 또는 개시제로서의 자성 나노캡슐 |
| WO2022171029A1 (zh) * | 2021-02-10 | 2022-08-18 | 上海科技大学 | 一种聚酯的降解方法 |
| EP4305184A1 (de) * | 2021-03-09 | 2024-01-17 | Conagen Inc. | Biosynthetische herstellung von makrocyclischen moschuslactonen aus fettsäuren |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1094439A (zh) * | 1993-04-20 | 1994-11-02 | 化学工业部西南化工研究院 | 修饰植物油的酯交换方法 |
| CN100404643C (zh) * | 2006-07-07 | 2008-07-23 | 清华大学 | 有机介质反应体系中微生物细胞转化油脂生产生物柴油的工艺 |
| US7767837B2 (en) * | 2007-05-04 | 2010-08-03 | Tda Research, Inc. | Methods of making alkyl esters |
| WO2009143159A1 (en) * | 2008-05-19 | 2009-11-26 | Wayne State University | Methods and catalysts for making biodiesel from the transesterification and esterification of unrefined oils |
| US20110224451A1 (en) * | 2008-06-11 | 2011-09-15 | Rajiv Kumar Chaturvedi | Process for production of biodiesel |
| CN102144035B (zh) * | 2008-07-08 | 2014-10-08 | 科技研究局 | 通过酶促水解及随后的化学/酶促酯化生产生物柴油 |
-
2012
- 2012-10-01 SG SG11201401013TA patent/SG11201401013TA/en unknown
- 2012-10-01 WO PCT/SG2012/000365 patent/WO2013048346A1/en not_active Ceased
- 2012-10-01 CN CN201280056907.9A patent/CN104080897A/zh active Pending
- 2012-10-01 SG SG10201602493YA patent/SG10201602493YA/en unknown
- 2012-10-01 EP EP12835766.2A patent/EP2751237A4/de not_active Withdrawn
Also Published As
| Publication number | Publication date |
|---|---|
| CN104080897A (zh) | 2014-10-01 |
| SG10201602493YA (en) | 2016-05-30 |
| SG11201401013TA (en) | 2014-04-28 |
| EP2751237A4 (de) | 2016-08-17 |
| WO2013048346A1 (en) | 2013-04-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Mandari et al. | Biodiesel production using homogeneous, heterogeneous, and enzyme catalysts via transesterification and esterification reactions: A critical review | |
| Bolina et al. | Biolubricant production from several oleaginous feedstocks using lipases as catalysts: Current scenario and future perspectives | |
| Parandi et al. | Biodiesel production from waste cooking oil using a novel biocatalyst of lipase enzyme immobilized magnetic nanocomposite | |
| Tripathi et al. | Isolation, purification and characterization of lipase from Microbacterium sp. and its application in biodiesel production | |
| Tran et al. | Microalgae harvesting and subsequent biodiesel conversion | |
| Babaki et al. | Enzymatic production of biodiesel using lipases immobilized on silica nanoparticles as highly reusable biocatalysts: effect of water, t-butanol and blue silica gel contents | |
| Abdulmalek et al. | Recent developments of lipase immobilization technology and application of immobilized lipase mixtures for biodiesel production | |
| Cao et al. | One-step direct transesterification of wet yeast for biodiesel production catalyzed by magnetic nanoparticle-immobilized lipase | |
| Tran et al. | Immobilization of Burkholderia sp. lipase on a ferric silica nanocomposite for biodiesel production | |
| Karimi | Immobilization of lipase onto mesoporous magnetic nanoparticles for enzymatic synthesis of biodiesel | |
| Cipolatti et al. | Nanomaterials for biocatalyst immobilization–state of the art and future trends | |
| Tran et al. | Enzymatic transesterification of microalgal oil from Chlorella vulgaris ESP-31 for biodiesel synthesis using immobilized Burkholderia lipase | |
| Xia et al. | Lipase‐catalyzed production of biodiesel: a critical review on feedstock, enzyme carrier and process factors | |
| Cazaban et al. | Lipase immobilization on siliceous supports: application to synthetic reactions | |
| Verma et al. | Recent advances in feedstocks and enzyme-immobilised technology for effective transesterification of lipids into biodiesel | |
| Seo et al. | Multifunctional nanoparticle applications to microalgal biorefinery | |
| Cirujano et al. | Challenges and opportunities for the encapsulation of enzymes over porous solids for Biodiesel production and Cellulose valorization into Glucose | |
| Sundaramahalingam et al. | An encapsulated report on enzyme-assisted transesterification with an allusion to lipase | |
| Maroju et al. | Efficient biodiesel production from rice bran oil using magnetite immobilized-recombinant lipase from probiotic Bacillus licheniformis | |
| WO2013048346A1 (en) | Method of converting grease containing high content of free fatty acids to fatty acid esters and catalysts for use in said method | |
| Yadav et al. | Approach to microalgal biodiesel production: Insight review on recent advancements and future outlook | |
| KR102091313B1 (ko) | 메탄산화세균 고정화를 위한 매크로 다공성 지지체 및 이를 이용한 메탄올 생산방법 | |
| Tran et al. | Modeling the methanolysis of triglyceride catalyzed by immobilized lipase in a continuous-flow packed-bed reactor | |
| El-Kady et al. | Effect of different TiO2 morphologies on the activity of immobilized lipase for biodiesel production | |
| Acıkgoz-Erkaya et al. | Immobilization of Candida rugosa lipase on magnetic biosilica particles: hydrolysis and transesterification studies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20140331 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: LI, AI-TAO Inventor name: ZILLILLAH, ZILLILLAH Inventor name: YAN, JIN-YONG Inventor name: NGO, NGUYEN PHUONG THAO Inventor name: TAN, GUOWEI Inventor name: WANG, WEN Inventor name: LI, ZHI |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: TAN, GUOWEI Inventor name: LI, AI-TAO Inventor name: WANG, WEN Inventor name: YAN, JIN-YONG Inventor name: NGO, NGUYEN PHUONG THAO Inventor name: ZILLILLAH, ZILLILLAH Inventor name: LI, ZHI |
|
| RA4 | Supplementary search report drawn up and despatched (corrected) |
Effective date: 20151029 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: C07C 67/02 20060101ALI20151023BHEP Ipc: C11C 3/04 20060101ALI20151023BHEP Ipc: B01J 37/36 20060101ALI20151023BHEP Ipc: C08G 63/48 20060101ALI20151023BHEP Ipc: C11B 1/00 20060101AFI20151023BHEP |
|
| DA4 | Supplementary search report drawn up and despatched (deleted) | ||
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: C11C 3/04 20060101ALI20151214BHEP Ipc: B01J 37/36 20060101ALI20151214BHEP Ipc: C08G 63/48 20060101ALI20151214BHEP Ipc: C11B 1/00 20060101AFI20151214BHEP Ipc: C07C 67/02 20060101ALI20151214BHEP |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: C07C 67/02 20060101ALI20160215BHEP Ipc: C08G 63/48 20060101ALI20160215BHEP Ipc: C11C 3/04 20060101ALI20160215BHEP Ipc: C11B 1/00 20060101AFI20160215BHEP Ipc: B01J 37/36 20060101ALI20160215BHEP |
|
| RA4 | Supplementary search report drawn up and despatched (corrected) |
Effective date: 20160720 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: C08G 63/48 20060101ALI20160714BHEP Ipc: C11C 3/04 20060101ALI20160714BHEP Ipc: C07C 67/02 20060101ALI20160714BHEP Ipc: C11B 1/00 20060101AFI20160714BHEP Ipc: B01J 37/36 20060101ALI20160714BHEP |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20170216 |