EP2721415A1 - Method for ascertaining the ischemic level of a patient with suspected stroke - Google Patents
Method for ascertaining the ischemic level of a patient with suspected strokeInfo
- Publication number
- EP2721415A1 EP2721415A1 EP12734822.5A EP12734822A EP2721415A1 EP 2721415 A1 EP2721415 A1 EP 2721415A1 EP 12734822 A EP12734822 A EP 12734822A EP 2721415 A1 EP2721415 A1 EP 2721415A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- glycogen phosphorylase
- stroke
- patient
- suspected
- determining
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/48—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/91—Transferases (2.)
- G01N2333/91091—Glycosyltransferases (2.4)
- G01N2333/91097—Hexosyltransferases (general) (2.4.1)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2871—Cerebrovascular disorders, e.g. stroke, cerebral infarct, cerebral haemorrhage, transient ischemic event
Definitions
- the invention relates to a method for determining the ischemic level of a suspected stroke patient, as well as a corresponding biomarker and a corresponding use.
- PRIOR ART WO 2003/046140 discloses a method for detecting cardiac disease, in particular a myocardial infarction, in which the presence of at least two antigens in a blood sample is determined. It is an antigen that can be detected early, namely Glycogen phosphorylase BB, and a late-onset antigen, namely troponin-I.
- certain antibodies are used for the detection of native glycogen phosphorylase BB in human sample for the diagnosis of acute coronary syndromes, these antibodies being derived from human glycogen phosphorylase enzymes BB.
- Glycogen phosphorylase is an enzyme that occurs in the form of three different isoenzymes in the body.
- the glycogen phosphorylase isoenzyme BB is one of them, it occurs in great concentration in the heart and brain.
- Glycogen phosphorylase is generally a glycogen metabolizing allosteric enzyme.
- the accession number of glycogen phosphorylase BB in NCB is DSM ACC 2834 and DSM ACC 2835.
- the present invention mainly relates to the so-called stroke (Apoplexia cerebri).
- stroke Apoplexia cerebri
- artheriosclerosis leads to constipation of artheria, which in turn may lead to CNS-related symptoms, including loss of speech and / or language change, and also partial or total paralysis of certain body areas including facial muscles and / or other body areas or similar symptoms.
- Therapeutic regimens include anticoagulant and / or anti-platelet medications and thrombolytic agents. Time is critical for the diagnosis of ischemic stroke and / or partial or complete success of revascularization.
- the object of the present invention is to substantially improve the detection of a stroke.
- the method according to the invention for determining the ischemic level of a suspected stroke patient comprises the following steps:
- the glycogen phosphorylase BB has an epitope as described in the above mentioned WO 2008/064903. Furthermore, the glycogen phosphorylase BB should have a sequence as also described in the international patent application.
- Also contemplated by the present invention is a diagnostic biomarker for determining the ischemic level of a suspected stroke patient characterized by determining the concentration of glycogen phosphorylase BB in a suspected patient sample collected from blood, the determination being by the method as described in particular WO 2008/064903 or EP 1 461 616.
- N 1 16
- Control subjects N 46 * * Control subjects: Older subjects admitted to Accident and Emergency with symptoms similar to those of an acute cerebral event, in particular noncancer but non-stroke related causes of the cerebral event requiring A & E approval.
- IHD ischemic heart disease
- HLP hyperlipoproteinemia
- GPBB plasma levels were unaffected (distorted) in some typical patients with additional disease from these patients including HTN, HLP, DM, age.
- GPBB plasma levels were unaffected (disturbed) in a number of biochemical variables. TIA patients have a low GPBB value similar to non-stroke patients, but some outliers (inexplicable) have very high scores. GPBB is related to P enkephalin (blood-brain barrier markers) but also to glucose levels and GOT (indicator of myocardial or substantial liver cell damage) and CK.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
A method for ascertaining the ischemic level of patients with suspected stroke comprises the steps of: - taking a blood sample from the patient with suspected stroke; determining the concentration of glycogen phosphorylase BB (GPBB) in this blood sample.
Description
Verfahren zum Ermitteln des ischämischen Levels eines Method for determining the ischemic level of a
schlaganfallverdächtigen Patienten stroke patients
Die Erfindung betrifft ein Verfahren zum Ermitteln des ischämischen Levels eines schlaganfallverdächtigten Patienten, sowie einen entsprechenden Biomarker und eine entsprechende Verwendung. The invention relates to a method for determining the ischemic level of a suspected stroke patient, as well as a corresponding biomarker and a corresponding use.
Stand der Technik Aus der WO 2003/046140 ist ein Verfahren zum Nachweis einer Herzerkrankung, insbesondere eines Herzinfarktes bekannt, bei dem die Gegenwart von zumindest zwei Antigenen in einer Blutprobe bestimmt wird. Dabei handelt es sich um ein frühzeitig feststellbares Antigen, nämlich
Glykogen Phosphorylase BB, und ein spät auftretendes Antigen, nämlich Troponin-I. PRIOR ART WO 2003/046140 discloses a method for detecting cardiac disease, in particular a myocardial infarction, in which the presence of at least two antigens in a blood sample is determined. It is an antigen that can be detected early, namely Glycogen phosphorylase BB, and a late-onset antigen, namely troponin-I.
Gemäss der WO 2008/064903 werden bestimmte Antikörper zum Nachweis von nativer Glykogen Phosphorylase BB in menschlichen Probe zur Diagnose von akuten Konorarsyndromen eingesetzt, wobei diese Antikörper aus humanen Glykogen Phosphorylase Enzyme BB abgeleitet sind. According to WO 2008/064903 certain antibodies are used for the detection of native glycogen phosphorylase BB in human sample for the diagnosis of acute coronary syndromes, these antibodies being derived from human glycogen phosphorylase enzymes BB.
Glykogen Phosphorylase (GP) ist ein Enzym, das in Form drei unterschiedlicher Isoenzyme im Körper vorkommt. Das Glykogen Phosphorylase Isoenzym BB ist eines davon, es kommt in grosser Konzentration im Herz und im Gehirn vor. Glykogen Phosphorylase ist allgemein ein Glykogen metabolisierendes allosterisches Enzym. Die Zugangsnummer von Glykogen Phosphorylase BB in NCB ist DSM ACC 2834 und DSM ACC 2835. Glycogen phosphorylase (GP) is an enzyme that occurs in the form of three different isoenzymes in the body. The glycogen phosphorylase isoenzyme BB is one of them, it occurs in great concentration in the heart and brain. Glycogen phosphorylase is generally a glycogen metabolizing allosteric enzyme. The accession number of glycogen phosphorylase BB in NCB is DSM ACC 2834 and DSM ACC 2835.
Die vorliegende Erfindung bezieht sich vor allem aber auf den sogenannten Schlaganfall (Apoplexia cerebri). Zum Beispiel führt Artheriosklerose zu einer Verstopfung von Artherien, was wiederum zu CNS bezogenen Symptomen führen kann, einschliesslich des Verlustes der Sprache und/oder Veränderung der Sprache und auch teilweise oder totaler Paraylse bestimmter Körperbereich einschliesslich der Gesichtsmuskeln und/oder anderer Körperbereiche oder ähnlicher Symptome. Therapeutische Regime umfassen anticoagulante und/oder Antiblutplättchen-Medikationen und thrombolytische Substanzen. Für die Diagnose von ischämischem Schlaganfall und/oder einem teilweisen oder vollen Erfolg der Revaskularisation ist die Zeit kritisch. However, the present invention mainly relates to the so-called stroke (Apoplexia cerebri). For example, artheriosclerosis leads to constipation of artheria, which in turn may lead to CNS-related symptoms, including loss of speech and / or language change, and also partial or total paralysis of certain body areas including facial muscles and / or other body areas or similar symptoms. Therapeutic regimens include anticoagulant and / or anti-platelet medications and thrombolytic agents. Time is critical for the diagnosis of ischemic stroke and / or partial or complete success of revascularization.
Aufgabe task
Aufgabe der vorliegenden Erfindung ist es, die Erkennung eines Schlaganfalls wesentlich zu verbessern.
Lösung der Aufgabe The object of the present invention is to substantially improve the detection of a stroke. Solution of the task
Zur Lösung der Aufgabe führt, dass das erfindungsgemässe Verfahren zum Ermitteln des ischämischen Levels eines schlaganfallverdächtigen Patienten folgende Schritte umfasst: To achieve the object, the method according to the invention for determining the ischemic level of a suspected stroke patient comprises the following steps:
- Entnahme einer Bluprobe von dem schlaganfallverdächtigen Patienten; - taking a Bluprobe from the suspected stroke patient;
- Bestimmung der Konzentration von Glykogen Phosphorylase BB (GPBB) in dieser Blutprobe. - Determination of the concentration of glycogen phosphorylase BB (GPBB) in this blood sample.
In einem bevorzugten Ausführungsbeispiel weist das Glykogen Phosphorylase BB ein Epitop auf, wie es in der oben erwähnten WO 2008/064903 beschrieben ist. Des Weiteren soll das Glykogen Phosphorylase BB eine Sequenz aufweisen, wie sie ebenfalls in der internationalen Patentanmeldung beschrieben ist. In a preferred embodiment, the glycogen phosphorylase BB has an epitope as described in the above mentioned WO 2008/064903. Furthermore, the glycogen phosphorylase BB should have a sequence as also described in the international patent application.
Von der vorliegenden Erfindung wird auch ein diagnostischer Biomarker zum Ermitteln des ischämischen Levels eines schlaganfallverdächtigen Patienten umfasst, der durch eine Bestimmung der Konzentration von Glykogen Phosphorylase BB in einem schlaganfallverdächtigen Patienten entnommen Blutproben gekennzeichnet ist, wobei die Bestimmung nach dem Verfahren erfolgt, wie es inbesondere in der WO 2008/064903 oder der EP 1 461 616 beschrieben ist. Also contemplated by the present invention is a diagnostic biomarker for determining the ischemic level of a suspected stroke patient characterized by determining the concentration of glycogen phosphorylase BB in a suspected patient sample collected from blood, the determination being by the method as described in particular WO 2008/064903 or EP 1 461 616.
Des Weiteren wird generell der Schutz für eine Verwendung der Bestimmung von Konzentration von Glykogen Phosphorylase BB im Blut eines schlaganfallverdächtigen Patienten zur Ermittlung eines Schlaganfalls begehrt.
Statistische Analyse der GPBB-Anwendung in Patienten mit akutem Schlaganfall : Furthermore, protection is generally desired for use in determining the level of concentration of glycogen phosphorylase BB in the blood of a suspected stroke patient. Statistical analysis of GPBB use in patients with acute stroke:
1. Beschreibung der Statistik 1. Description of the statistics
Patienten mit akutem ischämischen Schlaganfall : N = 1 16 Patients with acute ischemic stroke: N = 1 16
Patienten mit TIA (transitorische ischämische Attacke) N= 16 Patients with TIA (Transient Ischemic Attack) N = 16
Kontrollpersonen N= 46* *Kontrollpersonen: ältere Subjekte zugelassen zu A&E (Accident and Emergency) mit Symptomen, die einem akuten cerebralen Ereignis ähneln, insbesondere nicht gesundheitliche jedoch nicht auf ein Schlaganfall zurückzuführende Gründe für das cerebrale Ereignis haben, welche ein A&E Zulassung erfordern. Control subjects N = 46 * * Control subjects: Older subjects admitted to Accident and Emergency with symptoms similar to those of an acute cerebral event, in particular noncancer but non-stroke related causes of the cerebral event requiring A & E approval.
Werte bedeuten ±SD (Standartabweichunq) Values mean ± SD (standard deviation)
Kein Einfluss von Alter: No influence of age:
Schlaganfallpatienten waren älter im Gruppenvergleich Stroke patients were older in the group comparison
Wie auch immer, es wurde keine Korrelation zwischen Alter (unabhängig) und GPBB (abhängige Variable) festgestellt: r:0.018; p=0.8. However, there was no correlation between age (independent) and GPBB (dependent variable): r: 0.018; p = 0.8.
Das Alter hat deshalb wahrscheinlich kein Einfluss auf die beobachteten Unterschiede zwischen den Gruppen. Age is therefore unlikely to affect the observed differences between groups.
2. Gruppierung für klinische, biochemische Charakteristiken bezogen auf GPBB. 2. Grouping for clinical, biochemical characteristics relative to GPBB.
Zwischen den Schlaganfallpatienten hatten klinischen Variablen keinen oder nur einen geringen Einfluss auf den GPBB-Level. Between the stroke patients, clinical variables had little or no influence on the GPBB level.
IHD: ischämische Herzkrankheit IHD: ischemic heart disease
HTN: Hypertension HTN: Hypertension
DM: Diabetes DM: diabetes
HLP: Hyperlipoproteinämie HLP: hyperlipoproteinemia
PEnk: P Enkephalin nur Schla anfall atienten PEnk: P Enkephalin only stroke patients
3. Gemeinsamkeits- undKorrelationsanalysen
GPPB korreliert mit P Enkephalin, mit Glucose und GOT (Herzmuskelschaden oder Leberzellenschaden?) 3. Similarity and Correlation Analysis GPPB correlates with P enkephalin, with glucose and GOT (myocardial damage or liver cell damage?)
** nach Ausschluss von zwei Ausreissern mit akuter MI. ** after excluding two outliers with acute MI.
Keine Korrelation wurde gefunden für: irgendwelche Lipidmessergebnisse (CHol, HDL, LDL, TG), Thrombozyten, Ceratinin, CrP No correlation was found for: any lipid measurement results (CHol, HDL, LDL, TG), platelets, ceratinin, CrP
ZUSAMMENFASSUNG SUMMARY
1 . Ein Unterschied im Mittelwert von GPBB Plasmalevel von Schlaganfall- und Nichtschlaganfall (TIA und schlaganfallähnliche) Patienten konnte beobachtet werden. 1 . A difference in the mean value of GPBB plasma levels from stroke and non-stroke (TIA and stroke-like) patients could be observed.
2. Die GPBB Plasmalevel war nicht betroffen (verzerrt) bei einigen typischen Patienten mit zusätzlichen Erkrankungen von diesen Patienten einschliesslich HTN, HLP, DM, Alter. 2. GPBB plasma levels were unaffected (distorted) in some typical patients with additional disease from these patients including HTN, HLP, DM, age.
3. Die GPBB Plasmalevel waren nicht berührt (gestört) bei einer Anzahl von biochemischen Variablen.
TIA Patienten haben einen geringem GPBB Wert ähnlich wie nicht Schlaganfallpienten, jedoch einige Ausreisser (unerklärlich) haben sehr hohe Werte. GPBB steht in Beziehung zu P Enkephalin (Blut-Hirn-Schranken-Marker) aber auch zu Glucoselevels und GOT (Indikator für Herzmuskel- oder substantiellen Leberzellenschaden) und zu CK.
3. The GPBB plasma levels were unaffected (disturbed) in a number of biochemical variables. TIA patients have a low GPBB value similar to non-stroke patients, but some outliers (inexplicable) have very high scores. GPBB is related to P enkephalin (blood-brain barrier markers) but also to glucose levels and GOT (indicator of myocardial or substantial liver cell damage) and CK.
Claims
1 . Verfahren zum Ermitteln des ischämischen Levels eines schlaganfallverdächtigen Patienten, welches folgende Schritte umfasst: 1 . A method for determining the ischemic level of a suspected stroke patient comprising the steps of:
- Entnahme einer Blutprobe von dem schlaganfallverdächtigen - Taking a blood sample from the suspected stroke
Patienten; patients;
- Bestimmung der Konzentration von Glykogen Phosphorylase - Determination of the concentration of glycogen phosphorylase
BB (GPBB) in dieser Blutprobe. BB (GPBB) in this blood sample.
2. Verfahren nach Anspruch 1 , dadurch gekennzeichnet, dass das Glykogen Phosphorylase BB ein Epitop aufweist, wie es in der WO 2008/064903 beschrieben ist. 2. The method according to claim 1, characterized in that the glycogen phosphorylase BB has an epitope, as described in WO 2008/064903.
3. Verfahren nach Anspruch 2, dadurch gekennzeichnet, dass das Glykogen Phosphorylase BB eine Sequenz aufweist, wie sie in der WO 2008/064903 beschrieben ist. 3. The method according to claim 2, characterized in that the glycogen phosphorylase BB has a sequence as described in WO 2008/064903.
4. Diagnostischer Biomarker zum Ermitteln des ischämischen Levels eines schlaganfallverdächtigen Patienten gekennzeichnet durch eine Bestimmung der Konzentration von Glykogen Phosphorylase BB (GPBB) in einer dem schlaganfallverdächtigen Patienten entnommenen Blutprobe, wobei die Bestimmung nach Verfahren erfolgt, wie sie insbesondere in der WO 2008/064903 oder der EP 1 461 616 beschrieben sind. 4. Diagnostic biomarker for determining the ischemic level of a suspected stroke patient characterized by a determination of the concentration of glycogen phosphorylase BB (GPBB) in a blood sample taken from the suspected stroke patient, wherein the determination is carried out according to methods, in particular in WO 2008/064903 or EP 1 461 616 are described.
5. Biomarker nach Anspruch 4, dadurch gekennzeichnet, dass das Glykogen Phosphorylase BB ein Epitop aufweist, wie es in der WO 2008/064903 beschrieben ist. 5. Biomarker according to claim 4, characterized in that the glycogen phosphorylase BB has an epitope, as described in WO 2008/064903.
6. Biomarker nach Anspruch 5, dadurch gekennzeichnet, dass das Glykogen Phosphorylase BB eine Sequenz aufweist, wie sie in der WO 2008/064903 beschrieben ist. 6. Biomarker according to claim 5, characterized in that the glycogen phosphorylase BB has a sequence as described in WO 2008/064903.
7. Verwendung der Bestimmung der Konzentration von Glykogen Phosphorylase BB im Blut eines schlaganfallverdächtigen Patienten zur Ermittlung eines Schlaganfalles. 7. Use of determining the concentration of glycogen phosphorylase BB in the blood of a suspected stroke patient to determine a stroke.
8. Verwendung eines Kits zur Bestimmung der Konzentration von Glykogen Phosphorylase BB im Blut eines schlaganfallverdächtigen Patienten. 8. Use of a kit for determining the concentration of glycogen phosphorylase BB in the blood of a suspected patient.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE102011051076A DE102011051076A1 (en) | 2011-06-15 | 2011-06-15 | Method for determining the ischemic level of a suspected stroke patient |
PCT/EP2012/061012 WO2012171878A1 (en) | 2011-06-15 | 2012-06-11 | Method for ascertaining the ischemic level of a patient with suspected stroke |
Publications (1)
Publication Number | Publication Date |
---|---|
EP2721415A1 true EP2721415A1 (en) | 2014-04-23 |
Family
ID=46507970
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP12734822.5A Withdrawn EP2721415A1 (en) | 2011-06-15 | 2012-06-11 | Method for ascertaining the ischemic level of a patient with suspected stroke |
Country Status (4)
Country | Link |
---|---|
US (1) | US20140178910A1 (en) |
EP (1) | EP2721415A1 (en) |
DE (1) | DE102011051076A1 (en) |
WO (1) | WO2012171878A1 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3565832A2 (en) | 2017-01-05 | 2019-11-13 | Diagenics Group, Inc. | Detecting agents and epitopes mapping for detecting glycogen phosphorylase isoenzyme bb |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2005510696A (en) | 2001-11-27 | 2005-04-21 | ダイアジェニクス インターナショナル コーポレーション | Immunoassay and immunoassay kit for rapid and simultaneous detection of biochemical labels in patient samples |
US7392140B2 (en) * | 2003-09-23 | 2008-06-24 | Prediction Sciences, Llc | Cellular fibronectin as a diagnostic marker in stroke and methods of use thereof |
US20050181386A1 (en) * | 2003-09-23 | 2005-08-18 | Cornelius Diamond | Diagnostic markers of cardiovascular illness and methods of use thereof |
EP2099822A2 (en) | 2006-12-01 | 2009-09-16 | Diagenics International Corporation | Antibody to the epitope grwirtqqhyyerdpkriyylslefymgrtlqntm or ifnqkivngwqveeaddwlrygnpwekarp or glgdvaevrksfnrhlhftlvkdrnvatprdyffa or dsmatlglaaygygiryefg |
-
2011
- 2011-06-15 DE DE102011051076A patent/DE102011051076A1/en not_active Withdrawn
-
2012
- 2012-06-11 US US14/126,260 patent/US20140178910A1/en not_active Abandoned
- 2012-06-11 WO PCT/EP2012/061012 patent/WO2012171878A1/en active Application Filing
- 2012-06-11 EP EP12734822.5A patent/EP2721415A1/en not_active Withdrawn
Non-Patent Citations (1)
Title |
---|
See references of WO2012171878A1 * |
Also Published As
Publication number | Publication date |
---|---|
DE102011051076A1 (en) | 2012-12-20 |
WO2012171878A1 (en) | 2012-12-20 |
US20140178910A1 (en) | 2014-06-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DE60129314T2 (en) | DIAGNOSIS OF LIVER FIBROSIS WITH THE HELP OF SERUM MARKER ALGORITHMS | |
EP2052254B1 (en) | Biomarkers for inflammation of the liver | |
DE102015216782B3 (en) | Use of microRNAs circulating in the blood serum or blood plasma for identifying patients who are subject to biopsy and as markers for the differential diagnosis of individual non-ischemic cardiomyopathies or cardiac memory disorders | |
EP2247287A2 (en) | Method for the identification of patients in need of therapy having minor cognitive disorders and the treatment of such patients | |
EP2810077A2 (en) | Polypeptide markers for diagnosis and assessment of heart failure | |
EP2449385A1 (en) | Method and markers for diagnosing acute renal failure | |
DE112021006226T5 (en) | NOVEL BIOMARKER FOR DIAGNOSING ALZHEIMER'S DISEASE DISCOVERED IN A BLOOD-DERIVED EXOSOME AND METHOD FOR DIAGNOSING ALZHEIMER'S DISEASE USING THE SAME | |
EP2478377A2 (en) | Polypeptide marker for diagnosing and assessing vascular diseases | |
EP2721415A1 (en) | Method for ascertaining the ischemic level of a patient with suspected stroke | |
EP1711831B1 (en) | Method of diagnosing sepsis by detecting selectively the concentration of superoxide dismutase 1 (sod-1) in samples | |
Shang et al. | Huntington's disease: new aspects on phenotype and genotype | |
EP2388588A1 (en) | Method and quick test for determining the fertility of sperms | |
EP3295177B1 (en) | Method for identifying marker proteins for diagnosis and risk stratification of blood coagulation disorders | |
WO2012123527A1 (en) | Method and markers for the diagnosis of subclinical and clinical forms of t-cell-mediated tubulointerstitial rejection after kidney transplantation | |
DE102008022609B4 (en) | Method for detecting the presence of kidney stones and / or inflammation of the urinary tract | |
DE102018131696A1 (en) | Procedure for analyzing a human blood sample for tuberculosis | |
CN108660201A (en) | The purposes of kit and reagent in reagent preparation box | |
Mayosi | Cardiomyopathies and myocardial disorders in Africa: present status and the way forward | |
EP2167977B1 (en) | Method for determining thrombogenic microparticles | |
Hupf et al. | P1738 Panel of emerging cardiac biomarkers in patients with acute chest pain | |
Smith et al. | P1737 Validation of limb leads in localizing culprit artery in inferior STEMI | |
WO2013150132A2 (en) | Polypeptide markers for diagnosis and assessment of strokes | |
DE102019202788A1 (en) | Method for counting cell types or cell markers in a sample, in particular in a blood sample | |
DE19936035A1 (en) | Lymphocyte proliferation assay kit useful for diagnosis of Alzheimer's disease comprises an anticoagulant, one or more stimulants and an anti-CD69 antibody | |
DE102005042132A1 (en) | Method for diagnosis, assessment and monitoring of sepsis or generalized inflammation, comprises measuring content of immunoglobulin M in a patient sample |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20140114 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
DAX | Request for extension of the european patent (deleted) | ||
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20140812 |