EP2403990A2 - Enzymatic textile bleach-whitening methods - Google Patents
Enzymatic textile bleach-whitening methodsInfo
- Publication number
- EP2403990A2 EP2403990A2 EP10705848A EP10705848A EP2403990A2 EP 2403990 A2 EP2403990 A2 EP 2403990A2 EP 10705848 A EP10705848 A EP 10705848A EP 10705848 A EP10705848 A EP 10705848A EP 2403990 A2 EP2403990 A2 EP 2403990A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- formula
- acid
- textile
- enzymatic
- enzyme
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 238000000034 method Methods 0.000 title claims abstract description 92
- 239000004753 textile Substances 0.000 title claims abstract description 85
- 230000002255 enzymatic effect Effects 0.000 title claims abstract description 63
- 102000004190 Enzymes Human genes 0.000 claims abstract description 91
- 108090000790 Enzymes Proteins 0.000 claims abstract description 91
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 claims abstract description 88
- 239000000203 mixture Substances 0.000 claims abstract description 65
- 238000004061 bleaching Methods 0.000 claims abstract description 64
- 239000000463 material Substances 0.000 claims abstract description 46
- 239000000758 substrate Substances 0.000 claims abstract description 37
- 150000002148 esters Chemical class 0.000 claims abstract description 33
- 239000006081 fluorescent whitening agent Substances 0.000 claims abstract description 20
- 239000003352 sequestering agent Substances 0.000 claims abstract description 18
- 239000004094 surface-active agent Substances 0.000 claims abstract description 15
- 150000002978 peroxides Chemical class 0.000 claims abstract description 13
- 239000003381 stabilizer Substances 0.000 claims abstract description 13
- 239000003995 emulsifying agent Substances 0.000 claims abstract description 12
- 239000002253 acid Substances 0.000 claims abstract description 11
- 230000002087 whitening effect Effects 0.000 claims abstract description 9
- 229920002994 synthetic fiber Polymers 0.000 claims abstract description 8
- 239000004758 synthetic textile Substances 0.000 claims abstract description 7
- -1 for example Chemical compound 0.000 claims description 29
- 230000008569 process Effects 0.000 claims description 23
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 18
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 claims description 12
- UYAAVKFHBMJOJZ-UHFFFAOYSA-N diimidazo[1,3-b:1',3'-e]pyrazine-5,10-dione Chemical group O=C1C2=CN=CN2C(=O)C2=CN=CN12 UYAAVKFHBMJOJZ-UHFFFAOYSA-N 0.000 claims description 10
- 102220500059 eIF5-mimic protein 2_S54V_mutation Human genes 0.000 claims description 10
- 239000001257 hydrogen Substances 0.000 claims description 10
- 229910052739 hydrogen Inorganic materials 0.000 claims description 10
- 238000012545 processing Methods 0.000 claims description 10
- 229940116423 propylene glycol diacetate Drugs 0.000 claims description 10
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical group [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 claims description 9
- 229910052736 halogen Inorganic materials 0.000 claims description 9
- 102000016938 Catalase Human genes 0.000 claims description 8
- 108010053835 Catalase Proteins 0.000 claims description 8
- UYXTWWCETRIEDR-UHFFFAOYSA-N Tributyrin Chemical compound CCCC(=O)OCC(OC(=O)CCC)COC(=O)CCC UYXTWWCETRIEDR-UHFFFAOYSA-N 0.000 claims description 8
- 150000002367 halogens Chemical class 0.000 claims description 8
- URAYPUMNDPQOKB-UHFFFAOYSA-N triacetin Chemical compound CC(=O)OCC(OC(C)=O)COC(C)=O URAYPUMNDPQOKB-UHFFFAOYSA-N 0.000 claims description 8
- ZMLPKJYZRQZLDA-UHFFFAOYSA-N 1-(2-phenylethenyl)-4-[4-(2-phenylethenyl)phenyl]benzene Chemical group C=1C=CC=CC=1C=CC(C=C1)=CC=C1C(C=C1)=CC=C1C=CC1=CC=CC=C1 ZMLPKJYZRQZLDA-UHFFFAOYSA-N 0.000 claims description 6
- XUJLWPFSUCHPQL-UHFFFAOYSA-N 11-methyldodecan-1-ol Chemical compound CC(C)CCCCCCCCCCO XUJLWPFSUCHPQL-UHFFFAOYSA-N 0.000 claims description 6
- 230000007062 hydrolysis Effects 0.000 claims description 6
- 238000006460 hydrolysis reaction Methods 0.000 claims description 6
- 239000002736 nonionic surfactant Substances 0.000 claims description 6
- 125000004430 oxygen atom Chemical group O* 0.000 claims description 6
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 5
- XCMDVRAWAIYDEE-UHFFFAOYSA-N 1,2-diphenyl-3h-pyrazole Chemical class C1C=CN(C=2C=CC=CC=2)N1C1=CC=CC=C1 XCMDVRAWAIYDEE-UHFFFAOYSA-N 0.000 claims description 4
- JTXMVXSTHSMVQF-UHFFFAOYSA-N 2-acetyloxyethyl acetate Chemical compound CC(=O)OCCOC(C)=O JTXMVXSTHSMVQF-UHFFFAOYSA-N 0.000 claims description 4
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical group C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 claims description 4
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical group [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 claims description 4
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical group [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 claims description 4
- 150000002191 fatty alcohols Chemical class 0.000 claims description 4
- 235000013773 glyceryl triacetate Nutrition 0.000 claims description 4
- 229910052744 lithium Inorganic materials 0.000 claims description 4
- 239000011591 potassium Chemical group 0.000 claims description 4
- 229910052700 potassium Inorganic materials 0.000 claims description 4
- 239000011734 sodium Chemical group 0.000 claims description 4
- 229910052708 sodium Inorganic materials 0.000 claims description 4
- 229960002622 triacetin Drugs 0.000 claims description 4
- 229920002125 Sokalan® Polymers 0.000 claims description 3
- 238000010923 batch production Methods 0.000 claims description 3
- 125000005842 heteroatom Chemical group 0.000 claims description 3
- 230000003301 hydrolyzing effect Effects 0.000 claims description 3
- ABLZXFCXXLZCGV-UHFFFAOYSA-N phosphonic acid group Chemical group P(O)(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 claims description 3
- TXVWTOBHDDIASC-UHFFFAOYSA-N 1,2-diphenylethene-1,2-diamine Chemical class C=1C=CC=CC=1C(N)=C(N)C1=CC=CC=C1 TXVWTOBHDDIASC-UHFFFAOYSA-N 0.000 claims description 2
- BCMCBBGGLRIHSE-UHFFFAOYSA-N 1,3-benzoxazole Chemical class C1=CC=C2OC=NC2=C1 BCMCBBGGLRIHSE-UHFFFAOYSA-N 0.000 claims description 2
- 125000004958 1,4-naphthylene group Chemical group 0.000 claims description 2
- 125000005731 2,5-thiophenylene group Chemical group [H]C1=C([*:1])SC([*:2])=C1[H] 0.000 claims description 2
- ZYGHJZDHTFUPRJ-UHFFFAOYSA-N coumarin Chemical class C1=CC=C2OC(=O)C=CC2=C1 ZYGHJZDHTFUPRJ-UHFFFAOYSA-N 0.000 claims description 2
- 239000004584 polyacrylic acid Substances 0.000 claims description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims 5
- 229940088598 enzyme Drugs 0.000 description 84
- 239000004744 fabric Substances 0.000 description 30
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 24
- 150000004965 peroxy acids Chemical class 0.000 description 19
- 238000011282 treatment Methods 0.000 description 19
- 239000004952 Polyamide Substances 0.000 description 18
- 239000007844 bleaching agent Substances 0.000 description 18
- 230000000694 effects Effects 0.000 description 18
- 229920002647 polyamide Polymers 0.000 description 18
- 239000000126 substance Substances 0.000 description 17
- 108090000623 proteins and genes Proteins 0.000 description 16
- 102000004169 proteins and genes Human genes 0.000 description 14
- 108091033319 polynucleotide Proteins 0.000 description 12
- 102000040430 polynucleotide Human genes 0.000 description 12
- 239000002157 polynucleotide Substances 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 11
- 150000003839 salts Chemical class 0.000 description 11
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 10
- 238000009990 desizing Methods 0.000 description 10
- 150000001413 amino acids Chemical class 0.000 description 9
- 108010059820 Polygalacturonase Proteins 0.000 description 8
- 235000011054 acetic acid Nutrition 0.000 description 8
- 229960000583 acetic acid Drugs 0.000 description 8
- 108010005400 cutinase Proteins 0.000 description 8
- 108010093305 exopolygalacturonase Proteins 0.000 description 8
- 230000001590 oxidative effect Effects 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 241000187480 Mycobacterium smegmatis Species 0.000 description 7
- 229920002302 Nylon 6,6 Polymers 0.000 description 7
- 102000004316 Oxidoreductases Human genes 0.000 description 7
- 108090000854 Oxidoreductases Proteins 0.000 description 7
- 125000002252 acyl group Chemical group 0.000 description 7
- 108090000637 alpha-Amylases Proteins 0.000 description 7
- 150000007524 organic acids Chemical class 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- WNLRTRBMVRJNCN-UHFFFAOYSA-N adipic acid Chemical compound OC(=O)CCCCC(O)=O WNLRTRBMVRJNCN-UHFFFAOYSA-N 0.000 description 6
- 102000004139 alpha-Amylases Human genes 0.000 description 6
- 229940024171 alpha-amylase Drugs 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 239000000835 fiber Substances 0.000 description 6
- 239000012535 impurity Substances 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 230000000052 comparative effect Effects 0.000 description 5
- 150000002431 hydrogen Chemical group 0.000 description 5
- 229920001277 pectin Polymers 0.000 description 5
- 229910000029 sodium carbonate Inorganic materials 0.000 description 5
- 235000017550 sodium carbonate Nutrition 0.000 description 5
- JVBXVOWTABLYPX-UHFFFAOYSA-L sodium dithionite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])=O JVBXVOWTABLYPX-UHFFFAOYSA-L 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 108010065511 Amylases Proteins 0.000 description 4
- 102000013142 Amylases Human genes 0.000 description 4
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Chemical compound CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 4
- 229920002292 Nylon 6 Polymers 0.000 description 4
- 229920002230 Pectic acid Polymers 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical class [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 4
- 229920002472 Starch Polymers 0.000 description 4
- 235000019418 amylase Nutrition 0.000 description 4
- 229940025131 amylases Drugs 0.000 description 4
- 125000003118 aryl group Chemical group 0.000 description 4
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 4
- SEXRCKWGFSXUOO-UHFFFAOYSA-N benzo[a]phenazine Chemical compound C1=CC=C2N=C3C4=CC=CC=C4C=CC3=NC2=C1 SEXRCKWGFSXUOO-UHFFFAOYSA-N 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 238000007796 conventional method Methods 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 4
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 4
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 4
- NAQMVNRVTILPCV-UHFFFAOYSA-N hexane-1,6-diamine Chemical compound NCCCCCCN NAQMVNRVTILPCV-UHFFFAOYSA-N 0.000 description 4
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 4
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- FBUKVWPVBMHYJY-UHFFFAOYSA-N nonanoic acid Chemical compound CCCCCCCCC(O)=O FBUKVWPVBMHYJY-UHFFFAOYSA-N 0.000 description 4
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- 229910052760 oxygen Inorganic materials 0.000 description 4
- 229920000728 polyester Polymers 0.000 description 4
- 238000009991 scouring Methods 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 235000019698 starch Nutrition 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 4
- 102000057234 Acyl transferases Human genes 0.000 description 3
- 108700016155 Acyl transferases Proteins 0.000 description 3
- 102000005575 Cellulases Human genes 0.000 description 3
- 108010084185 Cellulases Proteins 0.000 description 3
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 3
- 229920000832 Cutin Polymers 0.000 description 3
- 108090001060 Lipase Proteins 0.000 description 3
- 102000004882 Lipase Human genes 0.000 description 3
- 239000004367 Lipase Substances 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 239000001361 adipic acid Substances 0.000 description 3
- 235000011037 adipic acid Nutrition 0.000 description 3
- 150000003863 ammonium salts Chemical class 0.000 description 3
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 239000000460 chlorine Substances 0.000 description 3
- 229910052801 chlorine Inorganic materials 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 3
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 3
- 235000019421 lipase Nutrition 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 108010087558 pectate lyase Proteins 0.000 description 3
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 3
- 239000010318 polygalacturonic acid Substances 0.000 description 3
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- 102220294335 rs1554842938 Human genes 0.000 description 3
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 3
- 238000004513 sizing Methods 0.000 description 3
- 239000008107 starch Substances 0.000 description 3
- 125000001424 substituent group Chemical group 0.000 description 3
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 3
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 3
- 239000001993 wax Substances 0.000 description 3
- 238000004383 yellowing Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 2
- GYSCBCSGKXNZRH-UHFFFAOYSA-N 1-benzothiophene-2-carboxamide Chemical compound C1=CC=C2SC(C(=O)N)=CC2=C1 GYSCBCSGKXNZRH-UHFFFAOYSA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 2
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 2
- 108010025188 Alcohol oxidase Proteins 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 102100032487 Beta-mannosidase Human genes 0.000 description 2
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 2
- 239000005635 Caprylic acid (CAS 124-07-2) Substances 0.000 description 2
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical class NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 2
- GHVNFZFCNZKVNT-UHFFFAOYSA-N Decanoic acid Natural products CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010015776 Glucose oxidase Proteins 0.000 description 2
- 239000004366 Glucose oxidase Substances 0.000 description 2
- 108010073450 Lactate 2-monooxygenase Proteins 0.000 description 2
- BCXBKOQDEOJNRH-UHFFFAOYSA-N NOP(O)=O Chemical class NOP(O)=O BCXBKOQDEOJNRH-UHFFFAOYSA-N 0.000 description 2
- 239000004677 Nylon Substances 0.000 description 2
- 239000005642 Oleic acid Substances 0.000 description 2
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 2
- 235000021314 Palmitic acid Nutrition 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- KFSLWBXXFJQRDL-UHFFFAOYSA-N Peracetic acid Chemical compound CC(=O)OO KFSLWBXXFJQRDL-UHFFFAOYSA-N 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- RAHZWNYVWXNFOC-UHFFFAOYSA-N Sulphur dioxide Chemical compound O=S=O RAHZWNYVWXNFOC-UHFFFAOYSA-N 0.000 description 2
- 102220477940 Triggering receptor expressed on myeloid cells 1_T25S_mutation Human genes 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 229910052783 alkali metal Inorganic materials 0.000 description 2
- 125000000217 alkyl group Chemical group 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 108010055059 beta-Mannosidase Proteins 0.000 description 2
- 238000005282 brightening Methods 0.000 description 2
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 2
- 229910052794 bromium Inorganic materials 0.000 description 2
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 229920002301 cellulose acetate Polymers 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 239000013066 combination product Substances 0.000 description 2
- 229940127555 combination product Drugs 0.000 description 2
- 238000010924 continuous production Methods 0.000 description 2
- 125000000753 cycloalkyl group Chemical group 0.000 description 2
- 238000000354 decomposition reaction Methods 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- OSVXSBDYLRYLIG-UHFFFAOYSA-N dioxidochlorine(.) Chemical compound O=Cl=O OSVXSBDYLRYLIG-UHFFFAOYSA-N 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- JBKVHLHDHHXQEQ-UHFFFAOYSA-N epsilon-caprolactam Chemical compound O=C1CCCCCN1 JBKVHLHDHHXQEQ-UHFFFAOYSA-N 0.000 description 2
- 125000001301 ethoxy group Chemical group [H]C([H])([H])C([H])([H])O* 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 229940116332 glucose oxidase Drugs 0.000 description 2
- 235000019420 glucose oxidase Nutrition 0.000 description 2
- 108010090622 glycerol oxidase Proteins 0.000 description 2
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- WQYVRQLZKVEZGA-UHFFFAOYSA-N hypochlorite Chemical compound Cl[O-] WQYVRQLZKVEZGA-UHFFFAOYSA-N 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 2
- QQVIHTHCMHWDBS-UHFFFAOYSA-N isophthalic acid Chemical compound OC(=O)C1=CC=CC(C(O)=O)=C1 QQVIHTHCMHWDBS-UHFFFAOYSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 125000005647 linker group Chemical group 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 2
- 229920001778 nylon Polymers 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- 229960002446 octanoic acid Drugs 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 235000021313 oleic acid Nutrition 0.000 description 2
- 239000001814 pectin Substances 0.000 description 2
- 235000010987 pectin Nutrition 0.000 description 2
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 2
- 235000019260 propionic acid Nutrition 0.000 description 2
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 102220243542 rs1239929428 Human genes 0.000 description 2
- 102220075010 rs796053096 Human genes 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 239000000344 soap Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000009987 spinning Methods 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 150000003463 sulfur Chemical class 0.000 description 2
- TUNFSRHWOTWDNC-HKGQFRNVSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCC[14C](O)=O TUNFSRHWOTWDNC-HKGQFRNVSA-N 0.000 description 2
- 229940005605 valeric acid Drugs 0.000 description 2
- 238000009941 weaving Methods 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- 210000002268 wool Anatomy 0.000 description 2
- VKZRWSNIWNFCIQ-WDSKDSINSA-N (2s)-2-[2-[[(1s)-1,2-dicarboxyethyl]amino]ethylamino]butanedioic acid Chemical compound OC(=O)C[C@@H](C(O)=O)NCCN[C@H](C(O)=O)CC(O)=O VKZRWSNIWNFCIQ-WDSKDSINSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- MPJQXAIKMSKXBI-UHFFFAOYSA-N 2,7,9,14-tetraoxa-1,8-diazabicyclo[6.6.2]hexadecane-3,6,10,13-tetrone Chemical compound C1CN2OC(=O)CCC(=O)ON1OC(=O)CCC(=O)O2 MPJQXAIKMSKXBI-UHFFFAOYSA-N 0.000 description 1
- IEORSVTYLWZQJQ-UHFFFAOYSA-N 2-(2-nonylphenoxy)ethanol Chemical compound CCCCCCCCCC1=CC=CC=C1OCCO IEORSVTYLWZQJQ-UHFFFAOYSA-N 0.000 description 1
- 102100038837 2-Hydroxyacid oxidase 1 Human genes 0.000 description 1
- LJCNDNBULVLKSG-UHFFFAOYSA-N 2-aminoacetic acid;butane Chemical compound CCCC.CCCC.NCC(O)=O LJCNDNBULVLKSG-UHFFFAOYSA-N 0.000 description 1
- JZUHIOJYCPIVLQ-UHFFFAOYSA-N 2-methylpentane-1,5-diamine Chemical compound NCC(C)CCCN JZUHIOJYCPIVLQ-UHFFFAOYSA-N 0.000 description 1
- CJAZCKUGLFWINJ-UHFFFAOYSA-N 3,4-dihydroxybenzene-1,2-disulfonic acid Chemical class OC1=CC=C(S(O)(=O)=O)C(S(O)(=O)=O)=C1O CJAZCKUGLFWINJ-UHFFFAOYSA-N 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102220596352 CUGBP Elav-like family member 1_L12I_mutation Human genes 0.000 description 1
- 101710128063 Carbohydrate oxidase Proteins 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 229920002284 Cellulose triacetate Polymers 0.000 description 1
- 239000004155 Chlorine dioxide Substances 0.000 description 1
- 108010089254 Cholesterol oxidase Proteins 0.000 description 1
- 108010000659 Choline oxidase Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical class OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010015133 Galactose oxidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 108050008938 Glucoamylases Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010004237 Glycine oxidase Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 108010008292 L-Amino Acid Oxidase Proteins 0.000 description 1
- 102000007070 L-amino-acid oxidase Human genes 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- JHWNWJKBPDFINM-UHFFFAOYSA-N Laurolactam Chemical compound O=C1CCCCCCCCCCCN1 JHWNWJKBPDFINM-UHFFFAOYSA-N 0.000 description 1
- 108090000856 Lyases Proteins 0.000 description 1
- 102000004317 Lyases Human genes 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 229920000571 Nylon 11 Polymers 0.000 description 1
- 229920000299 Nylon 12 Polymers 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108010063734 Oxalate oxidase Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 108010042687 Pyruvate Oxidase Proteins 0.000 description 1
- 108010060059 Sarcosine Oxidase Proteins 0.000 description 1
- 102000008118 Sarcosine oxidase Human genes 0.000 description 1
- 239000004115 Sodium Silicate Substances 0.000 description 1
- 229920002334 Spandex Polymers 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 108010092464 Urate Oxidase Proteins 0.000 description 1
- 102100033220 Xanthine oxidase Human genes 0.000 description 1
- 108010093894 Xanthine oxidase Proteins 0.000 description 1
- NNLVGZFZQQXQNW-ADJNRHBOSA-N [(2r,3r,4s,5r,6s)-4,5-diacetyloxy-3-[(2s,3r,4s,5r,6r)-3,4,5-triacetyloxy-6-(acetyloxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6s)-4,5,6-triacetyloxy-2-(acetyloxymethyl)oxan-3-yl]oxyoxan-2-yl]methyl acetate Chemical compound O([C@@H]1O[C@@H]([C@H]([C@H](OC(C)=O)[C@H]1OC(C)=O)O[C@H]1[C@@H]([C@@H](OC(C)=O)[C@H](OC(C)=O)[C@@H](COC(C)=O)O1)OC(C)=O)COC(=O)C)[C@@H]1[C@@H](COC(C)=O)O[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O NNLVGZFZQQXQNW-ADJNRHBOSA-N 0.000 description 1
- 238000005299 abrasion Methods 0.000 description 1
- WETWJCDKMRHUPV-UHFFFAOYSA-N acetyl chloride Chemical compound CC(Cl)=O WETWJCDKMRHUPV-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 150000001263 acyl chlorides Chemical class 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000007933 aliphatic carboxylic acids Chemical class 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 229910000288 alkali metal carbonate Inorganic materials 0.000 description 1
- 229910052910 alkali metal silicate Inorganic materials 0.000 description 1
- 150000001340 alkali metals Chemical class 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- AEMOLEFTQBMNLQ-BKBMJHBISA-N alpha-D-galacturonic acid Chemical compound O[C@H]1O[C@H](C(O)=O)[C@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-BKBMJHBISA-N 0.000 description 1
- WQZGKKKJIJFFOK-DVKNGEFBSA-N alpha-D-glucose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-DVKNGEFBSA-N 0.000 description 1
- 229940059260 amidate Drugs 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 230000003625 amylolytic effect Effects 0.000 description 1
- 125000002490 anilino group Chemical group [H]N(*)C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 108010009043 arylesterase Proteins 0.000 description 1
- 102000028848 arylesterase Human genes 0.000 description 1
- 239000003637 basic solution Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 108010019077 beta-Amylase Proteins 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 150000001642 boronic acid derivatives Chemical class 0.000 description 1
- 102220411787 c.160T>C Human genes 0.000 description 1
- 102220351326 c.35T>A Human genes 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 125000005587 carbonate group Chemical group 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 150000001733 carboxylic acid esters Chemical class 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 235000019398 chlorine dioxide Nutrition 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000013065 commercial product Substances 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- GSPKZYJPUDYKPI-UHFFFAOYSA-N diethoxy sulfate Chemical compound CCOOS(=O)(=O)OOCC GSPKZYJPUDYKPI-UHFFFAOYSA-N 0.000 description 1
- 125000001664 diethylamino group Chemical group [H]C([H])([H])C([H])([H])N(*)C([H])([H])C([H])([H])[H] 0.000 description 1
- 102000038379 digestive enzymes Human genes 0.000 description 1
- 108091007734 digestive enzymes Proteins 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- VTIIJXUACCWYHX-UHFFFAOYSA-L disodium;carboxylatooxy carbonate Chemical compound [Na+].[Na+].[O-]C(=O)OOC([O-])=O VTIIJXUACCWYHX-UHFFFAOYSA-L 0.000 description 1
- ILRSCQWREDREME-UHFFFAOYSA-N dodecanamide Chemical compound CCCCCCCCCCCC(N)=O ILRSCQWREDREME-UHFFFAOYSA-N 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 125000000031 ethylamino group Chemical group [H]C([H])([H])C([H])([H])N([H])[*] 0.000 description 1
- 229940071087 ethylenediamine disuccinate Drugs 0.000 description 1
- 125000004705 ethylthio group Chemical group C(C)S* 0.000 description 1
- NPUKDXXFDDZOKR-LLVKDONJSA-N etomidate Chemical compound CCOC(=O)C1=CN=CN1[C@H](C)C1=CC=CC=C1 NPUKDXXFDDZOKR-LLVKDONJSA-N 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019387 fatty acid methyl ester Nutrition 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 239000000446 fuel Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000000174 gluconic acid Substances 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 108010062584 glycollate oxidase Proteins 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 108010002430 hemicellulase Proteins 0.000 description 1
- 108010018734 hexose oxidase Proteins 0.000 description 1
- 125000003707 hexyloxy group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])O* 0.000 description 1
- 150000002484 inorganic compounds Chemical class 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 125000002510 isobutoxy group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])O* 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 230000002366 lipolytic effect Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000001455 metallic ions Chemical class 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 125000004708 n-butylthio group Chemical group C(CCC)S* 0.000 description 1
- 125000004706 n-propylthio group Chemical group C(CC)S* 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- MGFYIUFZLHCRTH-UHFFFAOYSA-N nitrilotriacetic acid Chemical class OC(=O)CN(CC(O)=O)CC(O)=O MGFYIUFZLHCRTH-UHFFFAOYSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 229920000847 nonoxynol Polymers 0.000 description 1
- 239000004745 nonwoven fabric Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 125000000962 organic group Chemical group 0.000 description 1
- 239000011368 organic material Substances 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- LCLHHZYHLXDRQG-ZNKJPWOQSA-N pectic acid Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)O[C@H](C(O)=O)[C@@H]1OC1[C@H](O)[C@@H](O)[C@@H](OC2[C@@H]([C@@H](O)[C@@H](O)[C@H](O2)C(O)=O)O)[C@@H](C(O)=O)O1 LCLHHZYHLXDRQG-ZNKJPWOQSA-N 0.000 description 1
- JRKICGRDRMAZLK-UHFFFAOYSA-L peroxydisulfate Chemical compound [O-]S(=O)(=O)OOS([O-])(=O)=O JRKICGRDRMAZLK-UHFFFAOYSA-L 0.000 description 1
- 125000005342 perphosphate group Chemical group 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 125000000587 piperidin-1-yl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920002239 polyacrylonitrile Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000098 polyolefin Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 239000012286 potassium permanganate Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 108010001816 pyranose oxidase Proteins 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 102220037457 rs201443058 Human genes 0.000 description 1
- 102220083031 rs746990000 Human genes 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 229960001922 sodium perborate Drugs 0.000 description 1
- 229940045872 sodium percarbonate Drugs 0.000 description 1
- PFUVRDFDKPNGAV-UHFFFAOYSA-N sodium peroxide Chemical compound [Na+].[Na+].[O-][O-] PFUVRDFDKPNGAV-UHFFFAOYSA-N 0.000 description 1
- NTHWMYGWWRZVTN-UHFFFAOYSA-N sodium silicate Chemical compound [Na+].[Na+].[O-][Si]([O-])=O NTHWMYGWWRZVTN-UHFFFAOYSA-N 0.000 description 1
- 229910052911 sodium silicate Inorganic materials 0.000 description 1
- MWNQXXOSWHCCOZ-UHFFFAOYSA-L sodium;oxido carbonate Chemical compound [Na+].[O-]OC([O-])=O MWNQXXOSWHCCOZ-UHFFFAOYSA-L 0.000 description 1
- YKLJGMBLPUQQOI-UHFFFAOYSA-M sodium;oxidooxy(oxo)borane Chemical compound [Na+].[O-]OB=O YKLJGMBLPUQQOI-UHFFFAOYSA-M 0.000 description 1
- 108010038899 sorbitol oxidase Proteins 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000006276 transfer reaction Methods 0.000 description 1
- AQLJVWUFPCUVLO-UHFFFAOYSA-N urea hydrogen peroxide Chemical compound OO.NC(N)=O AQLJVWUFPCUVLO-UHFFFAOYSA-N 0.000 description 1
- 239000002351 wastewater Substances 0.000 description 1
- 239000010457 zeolite Substances 0.000 description 1
- 239000002888 zwitterionic surfactant Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38636—Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/39—Organic or inorganic per-compounds
- C11D3/3947—Liquid compositions
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/40—Dyes ; Pigments
- C11D3/42—Brightening agents ; Blueing agents
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06L—DRY-CLEANING, WASHING OR BLEACHING FIBRES, FILAMENTS, THREADS, YARNS, FABRICS, FEATHERS OR MADE-UP FIBROUS GOODS; BLEACHING LEATHER OR FURS
- D06L4/00—Bleaching fibres, filaments, threads, yarns, fabrics, feathers or made-up fibrous goods; Bleaching leather or furs
- D06L4/40—Bleaching fibres, filaments, threads, yarns, fabrics, feathers or made-up fibrous goods; Bleaching leather or furs using enzymes
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06L—DRY-CLEANING, WASHING OR BLEACHING FIBRES, FILAMENTS, THREADS, YARNS, FABRICS, FEATHERS OR MADE-UP FIBROUS GOODS; BLEACHING LEATHER OR FURS
- D06L4/00—Bleaching fibres, filaments, threads, yarns, fabrics, feathers or made-up fibrous goods; Bleaching leather or furs
- D06L4/60—Optical bleaching or brightening
Definitions
- the present invention relates to methods for the enzymatic bleach-whitening of synthetic textile material, in particular polyamide or polyamide-containing textile materials.
- a pretreatment or preparation step is typically required to properly prepare the textile materials for further use and in particular for the dyeing, printing and/or finishing stages typically required for commercial goods.
- These textile treatment steps remove impurities and color bodies, either naturally existing or those added by the spinning and weaving steps to the fibers and/or fabrics.
- textile treatments may include a number of varying treatments and stages, the most common include: de-sizing, the removal of sizing agents, such as starches, via enzymatic, alkali or oxidative soaking; scouring, the removal of greases, oils, waxes, pectic substances, protein and fats by contact with a solution of sodium hydroxide at temperatures near boiling; and bleaching, the removal and lightening of color bodies from textiles by commonly using oxidizing agents (such as hydrogen peroxide, hypochlorite, and chlorine dioxide), or by using reducing agents (such as, sulfur dioxide or dithionite salts).
- oxidizing agents such as hydrogen peroxide, hypochlorite, and chlorine dioxide
- reducing agents such as, sulfur dioxide or dithionite salts
- the present invention accordingly relates to a method for bleach-whitening of synthetic textile material, in particular polyamide or polyamide-containing textile material, comprising contacting said textile material with
- the subject matter according to the present invention provides methods for bleaching and whitening of synthetic textile material, in particular polyamide or polyamide-containing textile materials, which are contacted with an enzymatic bleaching composition and a fluorescent whitening agent for a length of time and under conditions enabling a full white effect to be achieved.
- the invention is also suitable for the brightening of pastel shades.
- the invention also provides dyed textiles produced from textiles that have been prepared according to the enzymatic bleaching-whitening methods described herein.
- the enzymatic bleach-whitening process according to the present invention is environmentally friendly and provides synthetic textile material which does not exhibit yellowing problems encountered in subsequent drying when the residual sulfur derivatives are not properly and thoroughly removed as compared to the whitening obtained in conventional reduction bleach.
- the enzymatic bleaching step of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, for example, Molecular Cloning: A Laboratory Manual, 2 nd ed., (Sambrook et al., 1989); Oligonucleotide Synthesis (MJ. Gait, ed., 1984); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1994); PCR: The Polymerase Chain Reaction (MuIMs et al., eds., 1994); and Gene Transfer and Expression: A Laboratory Manual (Kriegler, 1990).
- nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
- bleaching means the process of treating a textile material for a sufficient length of time and under appropriate pH and temperature conditions to produce a lighter color in said textile material by removal, modification or masking of color-causing compounds in the textile material.
- bleaching refers to the treatment of a textile material to effect a brightening of the textile material.
- bleaching agent encompasses any moiety that is capable of bleaching a textile. They may require the presence of a bleach activator. Bleaching may generally be performed using chemical bleaching agent(s) and/or enzymatically generated bleaching agent(s). Examples of suitable chemical bleaching agents useful in the processes - A -
- H 2 O 2 may be considered a chemical bleaching agent when it has been generated enzymatically in situ.
- a "chemical bleaching composition” contains one or more chemical bleaching agent(s).
- an "enzymatic bleaching system” or “enzymatic bleaching composition” as understood in the context of the present invention contains one or more perhydrolase enzymes and one or more ester substrates capable of enzymatically generating a bleaching agent, and a hydrogen peroxide source, for production of a peracid bleaching agent.
- enzymatic bleaching systems are described, for example, in WO 2005/056782.
- synthetic textile material comprises polyamides, polyurethanes, polyacrylics, polyesters, polyolefines, polylactide, and semi-synthetic material such as cellulose acetate.
- the cited textile materials can be in a very wide range of forms of presentations, for example, in the form of fibers, yarns, fabrics, garments, knits, wovens and non-wovens.
- polyamide or polyamide-containing textile materials comprises synthetic polyamide, for example, Nylon 6 (polycaproamide), Nylon 6,6 (polyhexamethylene adipamide), Nylon 7 (polyenanthamide), Nylon 6,12 (polyhexamethylene dodecamide), Nylon 11 , Nylon 12 and copolyamides of Nylon 6,6 or Nylon 6, such as polymers made from hexamethylene diamine, ⁇ -caprolactam and adipic acid and polymers prepared from adipic acid, hexamethylene diamine and isophthalic acid, or from adipic acid, hexamehylene diamine and 2-methyl-pentamethylene diamine or 2-ethyl-tetramethylene diamine.
- synthetic polyamide for example, Nylon 6 (polycaproamide), Nylon 6,6 (polyhexamethylene adipamide), Nylon 7 (polyenanthamide), Nylon 6,12 (polyhexamethylene dodecamide), Nylon 11 ,
- blends for example, blends of polyamide/wool, polyamide/polyacrylonitril, polyamide/cellulose, polyamide/polyester, polyamide/cellulose acetate, polyamide/cellulose triacetate, polyamide/cellulose/wool and all blends indicated above blended with elastane fibers.
- a “perhydrolase” refers to an enzyme that is capable of catalyzing a perhydrolysis reaction that results in the production of a sufficiently high amount of peracid suitable for use in an enzymatic textile bleaching composition according to the method described herein.
- a perhydrolase enzyme used in the methods described herein exhibits a high perhydrolysis to hydrolysis ratio.
- the perhydrolase comprises, consists of, or consists essentially of the Mycobacterium smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 , or a variant or homolog thereof.
- the perhydrolase enzyme comprises acyl transferase activity and catalyzes an aqueous acyl transfer reaction.
- esters substrate in reference to an enzymatic textile bleaching composition according to the invention described herein refers to a perhydrolase substrate that contains an ester linkage.
- Esters comprising aliphatic and/or aromatic carboxylic acids and alcohols may be utilized as substrates with perhydrolase enzymes.
- the ester source is selected from the esters of one or more of the following acids: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid.
- the ester source is an acetate ester. In some embodiments, the ester source is selected from one or more of propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
- perhydrolyzation or “perhydrolyze” or “perhydrolysis” as used herein refer to a reaction wherein a peracid is generated from an ester substrate and a hydrogen peroxide source.
- the perhydrolyzation reaction is catalyzed with a perhydrolase, e.g., acyl transferase or aryl esterase, enzyme.
- -OR * is -OH.
- -OR * is replaced by -NH 2 .
- a peracid is produced by perhydrolysis of a carboxylic acid or amide substrate.
- peracid refers to a molecule derived from a carboxylic acid ester which has been reacted with hydrogen peroxide to form a highly reactive product that is able to transfer one of its oxygen atoms. It is this ability to transfer oxygen atoms that enables a peracid, for example, peracetic acid, to function as a bleaching agent.
- perhydrolysis to hydrolysis ratio refers to the ratio of the amount of enzymatically produced peracid to the amount of enzymatically produced acid by a perhydrolase enzyme from an ester substrate under defined conditions and within a defined time.
- the assays provided in WO 05/056782 are used to determine the amounts of peracid and acid produced by the enzyme.
- an effective amount of perhydrolase enzyme refers to the quantity of perhydrolase enzyme necessary to achieve the enzymatic activity required in the processes or methods described herein. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular enzyme variant used, the pH used, the temperature used and the like, as well as the results desired (e.g., level of bleaching).
- transferase refers to an enzyme that catalyzes the transfer of a functional group from one substrate to another substrate.
- an acyl transferase may transfer an acyl group from an ester substrate to a hydrogen peroxide substrate to form a peracid.
- acyl refers to an organic group with the general formula RCO-, derived from an organic acid by removal of the -OH group.
- acyl group names end with the suffix "-oyl,” e.g., ethanoyl chloride, CH 3 CO-CI, is the acyl chloride formed from ethanoic acid, CH 3 CO-OH.
- acylation refers to a chemical transformation in which one of the substituents of a molecule is substituted by an acyl group, or the process of introduction of an acyl group into a molecule.
- oxidizing chemical refers to a chemical that has the capability of bleaching a textile.
- the oxidizing chemical is present at an amount, pH and temperature suitable for bleaching.
- the term includes, but is not limited to hydrogen peroxide and peracids.
- the terms “purified” and “isolated” refer to the removal of contaminants from a sample and/or to a material (e.g., a protein, nucleic acid, cell, etc.) that is removed from at least one component with which it is naturally associated.
- a material e.g., a protein, nucleic acid, cell, etc.
- these terms may refer to a material which is substantially or essentially free from components which normally accompany it as found in its native state, such as, for example, an intact biological system.
- polynucleotide refers to a polymeric form of nucleotides of any length and any three-dimensional structure and single- or multi-stranded (e.g., single-stranded, double-stranded, triple-helical, etc.), which contain deoxyribonucleotides, ribonucleotides, and/or analogs or modified forms of deoxyribonucleotides or ribonucleotides, including modified nucleotides or bases or their analogs. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the polynucleotides applied applied within the context of the present invention encode a particular amino acid sequence.
- any type of modified nucleotide or nucleotide analog may be used, so long as the polynucleotide retains the desired functionality under conditions of use, including modifications that increase nuclease resistance (e.g., deoxy, 2'-0-Me, phosphorothioates, etc.).
- Labels may also be incorporated for purposes of detection or capture, for example, radioactive or nonradioactive labels or anchors, e.g., biotin.
- polynucleotide also includes peptide nucleic acids (PNA). Polynucleotides may be naturally occurring or non-naturally occurring.
- Polynucleotide and “nucleic acid” and “oligonucleotide” are used herein interchangeably.
- Polynucleotides of the invention may contain RNA, DNA, or both, and/or modified forms and/or analogs thereof.
- a sequence of nucleotides may be interrupted by non-nucleotide components.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S ("thioate”), P(S)S ("dithioate”), (O)NR 2 ("amidate"), P(O)R, P(O)OR', CO or CH 2 ("formacetal"), in which each R or R' is independently H or substituted or unsubstituted alkyl (Ci-C 2 o) optionally containing an ether (-O-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. Polynucleotides may be linear or circular or comprise a combination of linear and circular portions. Suitable polynucleotides are described in WO 2005/056782.
- polypeptide refers to any composition comprised of amino acids and recognized as a protein by those of skill in the art.
- the conventional one-letter or three-letter code for amino acid residues is used herein.
- polypeptide and protein are used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
- homologous proteins are familiar to those skilled in the art and are described in more detail in WO 2005/056782 on pages 12, 13 and 50 to 52, which are herein incorporated by reference.
- homologous proteins are engineered to produce enzymes with desired activity(ies).
- the degree of homology between sequences may be determined using any suitable method known in the art.
- PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment.
- Another example of a useful algorithm is the BLAST algorithm. Useful methods and programs are referred to in WO 2005/056782 on pages 59 and 60, which are herein incorporated by reference.
- “Surfactant” refers to a substance that reduces surface tension of a liquid.
- Emulsifier refers to a substance that promotes the suspension of one liquid in another.
- Sequestering agent refers to a substance capable of reacting with metallic ions by forming a water-soluble complex in which the metal is held in a non-ionizable form.
- Size refers to compounds used in the textile industry to improve weaving performance by increasing the abrasion resistance and strength of the yarn. Size is usually made of, for example, starch or starch-like compounds.
- desize or “desizing,” as used herein, refer to the process of eliminating size, generally starch, from textiles usually prior to applying special finishes, dyes or bleaches.
- Desizing enzyme(s) refer to enzymes that are used to enzymatically remove the size.
- Exemplary enzymes are amylases, cellulases and mannanases.
- scouring means to remove impurities, for example, much of the impurities (e.g., pectins, proteins, wax, etc.) naturally found in textile materials.
- impurities e.g., pectins, proteins, wax, etc.
- scouring can remove, in some embodiments, residual materials introduced by manufacturing processes, such as spinning, coning or slashing lubricants.
- bleaching may be employed to remove impurities from textiles.
- bioscouring enzyme(s) refers to an enzyme(s) capable of removing at least a portion of the impurities found in textile materials.
- pectinase denotes a pectinase enzyme defined according to the art where pectinases are a group of enzymes that cleave glycosidic linkages of pectic substances mainly poly(1 ,4-alpha-D-galacturonide) and its derivatives (see Sakai et al. (1993) Advances in Applied Microbiology 39:213-294).
- a pectinase useful herein is a pectinase enzyme which catalyzes the random cleavage of alpha-1 ,4-glycosidic linkages in pectic acid also called polygalacturonic acid by transelimination, such as the enzyme class polygalacturonate lyase (EC 4.2.2.2) (PGL), also known as poly(1 ,4-alpha-D-galacturonide) lyase, also known as pectate lyase.
- PGL enzyme class polygalacturonate lyase
- PGL poly(1 ,4-alpha-D-galacturonide) lyase
- pectic substances denotes pectate, polygalacturonic acid and pectin which may be esterified to a higher or lower degree.
- cutinase refers to as a plant, bacterial or fungal derived enzyme used in textile processing. Cutinases are lipolytic enzymes capable of hydrolyzing the substrate cutin. Cutinases can breakdown fatty acid esters and other oil-based compositions need to be removed in the processing (e.g., the scouring) of textiles. "Cutinase” means an enzyme that has significant plant cutin hydrolysis activity. Specifically, a cutinase will have hydrolytic activity on the biopolyester polymer cutin found on the leaves of plants. Suitable cutinases may be isolated from many different plant, fungal and bacterial sources.
- ⁇ -amylase refers to an enzyme that cleaves the ⁇ (1-4)glycosidic linkages of amylose to yield maltose molecules (disaccharides of ⁇ -glucose).
- Amylases are digestive enzymes found in saliva and are also produced by many plants. Amylases break down long-chain carbohydrates (such as starch) into smaller units.
- An "oxidative stable" ⁇ -amylase is an ⁇ -amylase that is resistive to degradation by oxidative means, when compared to non-oxidative stable ⁇ -amylase, especially when compared to the non-oxidative stable ⁇ -amylase form which the oxidative stable ⁇ -amylase was derived.
- protea means a protein or polypeptide domain of a protein or polypeptide derived from a microorganism, e.g. a fungus, bacterium, or from a plant or animal, and that has the ability to catalyze cleavage of peptide bonds at one or more of various positions of a protein carbohydrate backbone.
- Catalase refers to an enzyme (i.e., a polypeptide having catalytic activity) that catalyzes the decomposition of hydrogen peroxide to water and oxygen.
- Batch process or “batchwise process” or “discontinuous process” refers to processing of textiles as lots or batches in which the whole of each batch is subjected to a process or one stage of a process at a time.
- Exhaust process refers to a batch process in which pretreatment chemicals and/or an enzymatic pretreatment composition and dye are added simultaneously or sequentially in a single textile treatment bath.
- Liquor ratio refers to the ratio of the weight of liquor (liquid) employed in a textile treatment process to the weight of the textile treated.
- A “an” and “the” include plural references unless the context clearly dictates otherwise.
- the enzymatic textile bleach-whitening methods described herein are particularly carried out as a discontinuous process (one-bath two-steps exhaustion method) but can also be carried out as a semi-continuous process like pad-batch or pad-roll.
- the enzymatic bleaching composition used in accordance with the enzymatic textile bleach-whitening method of the present invention contain a perhydrolase enzyme, an ester substrate for the perhydrolase enzyme suitable for production of a peracid upon catalytic reaction of the perhydrolase enzyme on the substrate in the presence of a hydrogen peroxide source and/or hydrogen peroxide, a surfactant and/or an emulsifier, a peroxide stabilizer, a sequestering agent, and a buffer which maintains a pH of about 6 to about 8 during a textile bleaching process.
- the enzymatic bleaching composition may, optionally, further contain a bioscouring agent or enzyme and/or a desizing agent or enzyme.
- One or more perhydrolase enzymes may be used in the compositions according to the methods for enzymatic textile bleach-whitening as described herein.
- the perhydrolase enzyme is naturally-occurring (i.e., a perhydrolase enzyme encoded by a genome of a cell).
- the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence of a naturally-occurring perhydrolase enzyme.
- the perhydrolase enzyme is a naturally-occurring M. smegmatis perhydrolase enzyme.
- the perhydrolase enzyme comprises, consists of, or consists essentially of the amino acid sequence set forth in SEQ ID NO:1 or a variant or homologue thereof.
- the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence set forth in SEQ ID NO:1.
- M. smegmatis perhydrolase The amino acid sequence of M. smegmatis perhydrolase is shown below: MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGLSARTTNID DPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIALGMSVLVTQVLTSAGG VGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTELARVYSALASFMKVPFFDAGSVI STDGVDGIHFTEANNRDLGVALAEQVRSLL (SEQ ID NO:1 ).
- the perhydrolase enzyme comprises one or more substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1.
- the perhydrolase enzyme comprises any one or any combination of substitutions of amino acids selected from M1 , K3, R4, 15, L6, C7, D10, S11 , L12, T13, W14, W16, G15, V17, P18, V19, D21 , G22, A23, P24, T25, E26, R27, F28, A29, P30, D31 , V32, R33, W34, T35, G36, L38, Q40, Q41 , D45, L42, G43, A44, F46, E47, V48, I49, E50, E51 , G52, L53, S54, A55, R56, T57, T58, N59, I60, D61 , D62, P63, T
- the perhydrolase enzyme comprises one or more of the following substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12C, Q, or G; T25S, G, or P; L53H, Q, G, or S; S54V, L A, P, T, or R; A55G or T; R67T, Q, N, G, E, L, or F; K97R; V125S, G, R, A, or P; F154Y; F196G.
- the perhydrolase enzyme is the S54V variant of SEQ ID NO:1.
- the perhydrolase enzyme comprises a combination of amino acid substitutions at amino acid positions equivalent to amino acid positions in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12I S54V; L12M S54T; L12T S54V; L12Q T25S S54V; L53H S54V; S54P V125R; S54V V125G; S54V F196G; S54V K97R V125G; or A55G R67T K97R V125G.
- the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio of at least 1. In some embodiments, the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio greater than 1.
- the perhydrolase enzyme is provided in the enzymatic textile bleaching composition used according to the textile bleach-whitening method of the present invention at a concentration of about 0.5 to about 2.5 ppm, about 1.5 to about 2.0 ppm, for example, about 1.7 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic bleaching compositions used in accordance with the method described herein include an ester which serves as a substrate for the perhydrolase enzyme for production of a peracid in the presence of hydrogen peroxide.
- the ester substrate is an ester of an aliphatic and/or aromatic carboxylic acid.
- the ester substrate is an ester of one or more of the following: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid.
- glycerol triacetate, glycerol tributyrate, and other esters serve as acyl donors for peracid formation.
- the ester substrate is selected from propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
- the ester substrate is propylene glycol diacetate, ethylene glycol diacetate, or ethyl acetate.
- the ester substrate is propylene glycol diacetate.
- the ester substrate for example, propylene glycol diacetate
- the ester substrate is provided at a concentration of about 2000 to about 4000 ppm, about 2500 to about 3500 ppm, about 2800 ppm to about 3200 ppm, or about 3000 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic bleaching compositions used in accordance with the method described herein include a hydrogen peroxide source.
- Hydrogen peroxide can be either added directly in batch, or generated continuously “in situ” by chemical, electro-chemical, and/or enzymatic means.
- the hydrogen peroxide source is hydrogen peroxide.
- the hydrogen peroxide source is a solid compound that generates hydrogen peroxide spontaneously upon addition to water.
- Such compounds include adducts of hydrogen peroxide with various inorganic or organic compounds, of which the most widely employed is sodium carbonate perhydrate, also referred to as sodium percarbonate.
- lnorganic perhydrate salts are one embodiment of hydrogen peroxide source.
- inorganic perhydrate salts include perborate, percarbonate, perphosphate, persulfate and persilicate salts.
- the inorganic perhydrate salts are normally the alkali metal salts.
- hydrogen peroxide adducts useful in the compositions used in accordance with the method described herein include adducts of hydrogen peroxide with zeolites, or urea hydrogen peroxide.
- the hydrogen peroxide source compounds may be included as the crystalline and/or substantially pure solid without additional protection.
- the preferred executions of such granular compositions utilize a coated form of the material which provides better storage stability for the perhydrate salt in the granular product.
- Suitable coatings comprise inorganic salts such as alkali metal silicate, carbonate or borate salts or mixtures thereof, or organic materials such as waxes, oils, or fatty soaps.
- the hydrogen peroxide source is an enzymatic hydrogen peroxide generation system.
- the enzymatic hydrogen peroxide generation system comprises an oxidase and its substrate.
- Suitable oxidase enzymes include, but are not limited to: glucose oxidase, sorbitol oxidase, hexose oxidase, choline oxidase, alcohol oxidase, glycerol oxidase, cholesterol oxidase, pyranose oxidase, carboxyalcohol oxidase, L-amino acid oxidase, glycine oxidase, pyruvate oxidase, glutamate oxidase, sarcosine oxidase, lysine oxidase, lactate oxidase, vanillyl oxidase, glycolate oxidase, galactose oxidase, uri
- any enzyme that generates H 2 O 2 with a suitable substrate may be used in the present invention.
- lactate oxidases from Lactobacillus species which are known to create H 2 O 2 from lactic acid and oxygen may be used.
- acid e.g., gluconic acid in the above example
- One advantage of the enzymatic generation of acid is that this reduces the pH of a basic solution to the pH range in which a peracid is most effective in bleaching (i.e., at or below the pKa).
- enzymes e.g., alcohol oxidase, ethylene glycol oxidase, glycerol oxidase, amino acid oxidase, etc.
- ester substrates in combination with the perhydrolase enzymes of the present invention to generate peracids.
- the hydrogen peroxide generating oxidase is a carbohydrate oxidase.
- Hydrogen peroxide may also be generated electrochemically, for example using a fuel cell fed oxygen and hydrogen gas.
- the hydrogen peroxide source is hydrogen peroxide provided at a concentration of about 1000 to about 3200 ppm, about 1500 to about 2800 ppm, about 2000 ppm to about 2200 ppm, or about 2100 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic textile bleaching compositions used in accordance with the present method contain one or more, i.e., at least one surfactant and/or at least one emulsifier.
- Surfactants suitable for use in practicing the present invention include, without limitation, nonionic (see, e.g., U.S. Pat. No. 4,565,647, which is herein incorporated by reference); anionic; cationic; and zwitterionic surfactants (see, e.g., U.S. Pat. No. 3,929,678 which is herein incorporated by reference).
- Anionic surfactants include, without limitation, linear alkylbenzenesulfonate, ⁇ -olefinsulfonate, alkyl sulfate (fatty alcohol sulfate), alcohol ethoxysulfate, secondary alkanesulfonate, alpha-sulfo fatty acid methyl ester, alkyl- or alkenylsuccinic acid, and soap.
- Non-ionic surfactants include, without limitation, fatty alcohol ethoxylate, isotridecanol ethoxylate, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamineoxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, polyhydroxy alkyl fatty acid amide, and N-acyl N-alkyl derivatives of glucosamine (“glucamides").
- the surfactant and/or emulsifier comprises a non-ionic surfactant.
- the non-ionic surfactant is a fatty alcohol ethoxylate.
- the non-ionic surfactant is isotridecanol ethoxylate.
- the non-ionic surfactant is a fatty alcohol ethoxylate and isotridecanol ethoxylate.
- the composition used in accordance with the present method comprises a surfactant and an emulsifier.
- a surfactant may be present at a concentration of about 300 ppm to about 4800 ppm, about 600 ppm to about 3600 ppm, or about 300 ppm to about 1200 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic bleaching composition contains isotridecanol ethoxylate at a concentration of about 300 ppm to about 3600 ppm, about 600 ppm to about 3000 ppm, or about 900 ppm to about 2400 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic bleaching compositions used in accordance with the method described herein contain a peroxide stabilizer.
- peroxide stabilizers include, but are not limited to, sodium silicate, sodium carbonate, acrylic polymers, magnesium salts, and phosphonic acid.
- the peroxide stabilizer is phosphonic acid.
- a peroxide stabilizer may be present in the enzymatic textile bleaching composition at a concentration of about 60 ppm to about 600 ppm, about 60 ppm to about 1200 ppm, or about 120 ppm to about 960 ppm based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic bleaching compositions used in accordance with the method described herein include a sequestering agent.
- sequestering agents include, but are not limited to, amino carboxylates, amino phosphonates, polyfunctionally-substituted aromatic chelating agents, polyhydroxy-carboxylic acids, aminopolycarboxylic acids, polyphosphonates, and polyacrylic acids, and mixtures thereof.
- Amino carboxylates useful as sequestering agents include ethylenediaminetetracetates, N-hydroxyethylethylenediaminetriacetates, nitrilotriacetates, ethylenediamine tetraproprionates, and triethylenetetraaminehexacetates.
- Polyfunctionally-substituted aromatic sequestering agents are also useful in the compositions herein (see U.S. Pat. No. 3,812,044).
- Preferred compounds of this type in acid form are dihydroxydisulfobenzenes such as 1 ,2-dihydroxy-3,5-disulfobenzenediethylenetriamine- pentaacetates, and ethanoldiglycines, alkali metal, ammonium, and substituted ammonium salts therein and mixtures thereof.
- Amino phosphonates are also suitable for use as sequestering agents in the compositions of the invention when at least low levels of total phosphorus are permitted.
- a biodegradable sequestering agent suitable for use herein is ethylenediamine disuccinate ("EDDS"), especially the [S, S] isomer as described in U.S. Pat. No. 4,704,233.
- EDDS ethylenediamine disuccinate
- the sequestering agent is polyacrylic acid.
- a sequestering agent may be present in the enzymatic textile bleaching composition at a concentration of about 60 ppm to about 1800 ppm, about 300 ppm to about 1200 ppm, or about 180 ppm to about 1200 ppm based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- At least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent are applied as a combination product containing each of at least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent.
- the said combination product is designated bleaching processor and is commercially available, for example, CLARITE ® LTC (product of Huntsman).
- a surfactant may be present at a concentration of about 5% to about 40%, about 20% to about 30%, or about 5% to about 10%, based on the total weight of the bleaching processor.
- a peroxide stabilizer may be present in the bleaching processor at a concentration of about 1% to about 5%, about 1 % to about 10%, or about 2% to about 8%, based on the total weight of the bleaching processor.
- a sequestering agent may be present in the bleaching processor at a concentration of about 1 % to about 15%, about 5% to about 10%, or about 3% to about 10%, based on the total weight of the bleaching processor.
- the bleaching processor contains isotridecanol ethoxylate at a concentration of about 5% to about 30%, about 10% to about 25%, or about 15% to about 20%, based on the total weight of the bleaching processor.
- the bleaching processor is suitably provided as an aqueous composition comprising the above indicated components.
- the enzymatic bleaching composition contains a buffer that is capable of maintaining the pH of the composition at a pH of about 6 to about 8.
- the buffer is a carbonate buffer, pH 8.
- Suitable fluorescent whitening agents used in accordance with the method described herein are, for example, distyryl biphenyl derivatives as described in U.S. Pat. No. 3,984,399, U.S. Pat. No. 5,969,204 and U.S. Pat. No. 6,096,919 which are herein incorporated by reference.
- distyryl biphenyl derivatives indicated correspond to compounds of the formula in which
- M is hydrogen, lithium, sodium, potassium, ammonium or ammonium that is mono-, di-, tri- or tetra-substituted by C-i-C ⁇ alkyl or C 2 -Cehydroxyalkyl which may be interrupted by an oxygen atom or a mixture thereof, and R 1 and R 2 independently of one another are hydrogen, d-C ⁇ alkyl, d-C ⁇ alkoxy or halogen.
- the compound of the formula (1 ) corresponds to the compound of the formula (1a)
- fluorescent whitening agents are, for example, triazolyl stilbene disulfonic acid derivatives as described in U.S. Pat. No. 3,485,831 , U.S. Pat. No. 3,453,268 and U.S. Pat. No. 3,994,834 which are herein incorporated by reference.
- fluorescent whitening agents which come into consideration for practising the present invention are, for example, diamino stilbene derivatives of the formula
- R 3 and R 4 independently of one another are Ci-C 4 alkoxy, Ci-C 4 alkylthio, substituted or unsubstituted amino or an N-heterocycle which may contain further heteroatoms;
- R 5 and R 6 independently of one another are hydrogen, Ci-C 4 alkyl, Ci-C 4 alkoxy or halogen;
- R 7 and R 8 independently of one another are hydrogen, d-C 4 alkyl, d-C 4 alkoxy or halogen;
- C 2 -C 6 hydroxyalkyl which may be interrupted by an oxygen atom as suitable substituent for M in the meaning of mono-, di-, tri- or tetra-substituted ammonium is suitably typically a radical of formula -CH 2 CH 2 OH, -CH 2 -CH(OH)-CH 3 , -(CH 2 ) 2 -O-(CH 2 ) 2 -OH, -(CH 2 ) 2 -O-CH 2 -CH 2 -OH or -(CH 2 ) 2 -O-CH 2 -CH(CH 3 )-OH.
- CrC ⁇ alkyl as suitable substituent for M in the meaning of mono-, di-, tri- or tetra-substituted ammonium is, for example, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, isobutyl, pentyl or hexyl.
- R 1 and R 2 defined as CrC ⁇ alkyl independently of one another are, for example, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, isobutyl, pentyl or hexyl and, preferably, Ci-C 4 alkyl, such as ethyl.
- Ri and R 2 defined as Ci-C 6 alkoxy independently of one another are, for example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, isobutoxy, pentyloxy or hexyloxy, preferably Ci-C 4 alkoxy, such as methoxy or ethoxy.
- Ri, R2, Rs, Re, R7 and R 8 defined as halogen independently of one another are, for example, fluorine, chlorine or bromine, preferably chlorine or bromine and in particular chlorine, the definitions and preferences also applying to the following halogen radicals.
- R 3 and R 4 defined as Ci-C 4 alkylthio independently of one another are, for example, methylthio, ethylthio, n-propylthio, isopropylthio or n-butylthio, preferably ethylthio or n-propylthio.
- R 3 , R 4 , R 5 , Re, R7 and R 8 defined as Ci-C 4 alkoxy independently of one another are, for example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy or isobutoxy, preferably methoxy or ethoxy, the definitions and preferences also applying to the following Ci-C 4 alkoxy radicals.
- R 5 , Re, R7 and R 8 defined as Ci-C 4 alkyl independently of one another are, for example, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl or isobutyl, the definitions and preferences also applying to the following d-C 4 alkyl radicals.
- R3 and R 4 as substituted or unsubstituted amino independently of one another are, for example, amino which is unsubstituted or substituted on the N-atom by, for example, the following radicals:
- N-mono- or N,N-di-Ci-C 4 alkylamino which includes both the unsubstituted radicals, for example, ethylamino or diethylamino, and the radicals substituted in the alkyl moiety by, for example, N,N-di-Ci-C 4 alkylamino, Ci-C 4 alkoxy, hydroxy, carboxy, sulfo or sulfato; C 5 -C 7 cycloalkylamino, which includes both the unsubstituted radicals and the radicals substituted in the cycloalkyl ring, for example by Ci-C 4 alkyl, in particular methyl; phenylamino or N-Ci-C 4 alkyl-N-phenylamino, which includes both the unsubstituted radicals and the radicals substituted in the phenyl ring, for example by Ci-C 4 alkyl which in turn may be substituted by phenyl, Ci-
- R 3 and R 4 in the meaning of an N-heterocycle which may contain further heteroatoms independently of one another are, for example, morpholino or piperidin-1-yl.
- Carboxy generally means the group -COOM
- Sulfo generally means the group -SO 3 M, in which M is hydrogen, lithium, sodium, potassium, ammonium or ammonium that is mono-, di-, tri- or tetra-substituted by Ci-C 4 alkyl or Ci-C 4 hydroxyalkyl or a mixture thereof.
- At least one of a distyryl biphenyl derivative and a triazolyl stilbene disulfonic acid derivative are used in accordance with the method described herein.
- At least one of a distyryl biphenyl derivative of the formula (1 a) and a triazolyl stilbene disulfonic acid derivative of the formula (2) are used in accordance with the method described herein.
- the fluorescent whitening agent is provided at a concentration of about 0.05 to about 0.8 %, about 0.08 to about 0.5 %, about 0.1 to about 0.4 %, based on the weight of the textile material.
- An organic acid is appropriately used to adjust the pH for the uptake of the fluorescent whitening agent.
- the organic acid is suitably oxalic acid, citric acid and acetic acid.
- the organic acid is acetic acid.
- the organic acid is provided at a concentration of about 100 to about 4000 ppm, about 600 to about 3000 ppm, about 800 ppm to about 1600 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the pH is adjusted to pH 4 to 5, for example, pH 4.5.
- the method of the invention utilizes a liquor ratio of about 2:1 to about 50:1 , about 5:1 to about 20:1 , for example, about 20:1 or 10:1.
- the method according to the present invention is performed in a discontinuous process, for example, as a one-bath-two-steps exhaustion method.
- the enzymatic textile bleaching is carried out in the first step and in a subsequent second step whitening is carried out by adding the fluorescent whitening agent into the same bath after adjustment of the bath to pH 4 to 5, for example, pH 4.5, during 20 minutes at about 65°C to about 95°C.
- the method is performed in a semi-continuous process like pad-batch or pad-roll.
- Textiles are contacted with the enzymatic bleaching composition at a temperature of about 55°C to about 75 0 C, about 60 0 C to about 70 0 C, for a processing time of about 20 to about 60 minutes at a pH of about 6 to about 8.
- the bleaching temperature is about 65°C and the processing time is about 50 minutes.
- the temperature of the enzymatic bleaching composition is raised by about 2°C per minute from a starting temperature of about 20 0 C to about 50 0 C, for example, about 20°C to about 40 0 C, until the processing temperature for bleaching is reached.
- the whitening step is carried out in a separate bath after enzymatic textile bleaching, washing-off and neutralization (two-baths-two-steps).
- One or more rinsing steps are performed after treatment of the textile material with the enzymatic bleaching composition, to remove the bleaching composition.
- the textile is rinsed with an aqueous composition (water or a composition containing water).
- the rinsing temperature is about 40 0 C to about 60 0 C, for example, about 50 0 C.
- the aqueous rinsing composition contains a catalase enzyme to catalyze the decomposition of hydrogen peroxide to water and oxygen.
- the textile is rinsed twice with a catalase containing aqueous composition for about 10 minutes for each rinse.
- residual hydrogen peroxide is removed by rinsing twice with an aqueous composition containing catalase at about 50°C.
- a rinsing step as described above is applied in the one-bath-two-steps method after the whitening step is finished.
- the methods for enzymatic textile bleach-whitening described herein include one or more bioscouring enzyme(s).
- One or more bioscouring enzyme(s) may be included in the enzymatic textile bleaching composition, or a textile may be treated with bioscouring enzyme(s) in a subsequent processing step after treatment in the enzymatic textile bleaching composition.
- bioscouring enzymes there come into consideration for practicing the present invention pectinases, hemicellulases, cellulases, enzymes that hydrolyze polyester substrates, for example, cutinases or lipases and other bioscouring enzymes, for example, proteases.
- Suitable pectinases their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 19 to 21 , which are herein incorporated by reference.
- Suitable cellulases, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 22 and 23, which are herein incorporated by reference.
- bioscouring enzymes which come into consideration for practicing the present invention, may be used, for example, proteases, protease variants, and lipases. These enzymes, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 23 to 25, which are herein incorporated by reference.
- polyester substrates suitable for use in the present invention may be used, for example, cutinases or lipases. These enzymes, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 21 and 22, which are herein incorporated by reference.
- the bioscouring enzyme is a pectinase.
- the methods for enzymatic textile bleach-whitening described herein include one or more desizing enzyme(s).
- One or more desizing enzyme(s) may be included in the enzymatic textile bleaching composition, or a textile may be treated with desizing enzyme(s) in a previous processing step before treatment in the enzymatic textile bleaching composition.
- the desizing enzyme is an amylolytic enzyme. Mannanases and glucoamylases may also be used. In some embodiments, the desizing enzyme is an ⁇ - or ⁇ -amylase and combinations thereof.
- Suitable amylases their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 18 and 19, which are herein incorporated by reference.
- the following examples are intended to illustrate, but not limit, the invention. Temperatures are in degrees Celsius, parts are parts by weight and the percentage data are percentages by weight, unless noted otherwise. Parts by weight bear the same relation to parts by volume as the kilogram to the litre.
- Enzymatic bleach-whitening carried out as a one-bath-two-steps exhaustion method Nylon 66 fabric, prescoured and heat-set at 175°C, is treated in a bath containing the bleaching processor, soda ash, the ester substrate, hydrogene peroxide and the perhydrolase enzyme in the amounts given in Table 1 using a liquor ratio of 20:1.
- the temperature is raised from ambient temperature to a target temperature of 65°C at a rate of 2°C per minute.
- the bath is then held at 65°C for 30 minutes and afterwards adjusted to pH 4.5 by addition of acetic acid (80%).
- the fluorescent whitening agent in the amount given in Table 1 is added to the bath and treatment is continued at a temperature of 65°C for further 20 minutes.
- After draining the fabric is rinsed twice for 10 minutes each at 50 0 C and then dried at 70 0 C.
- 0.5 g/l of a 25% solution of Catalase T100 available from Genencor
- Nylon 66 fabric prescoured and heat-set at 175°C, is treated in a bath containing the components in the amounts given in Table 2 using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 95°C at a rate of 2°C per minute. The bath is then held at 95°C for 30 minutes. After draining the fabric is rinsed twice for 10 minutes each at 50 0 C and subsequently dried at 70 0 C.
- Table 2 Comparative Examples 1 to 3 - reduction bleach with sodium dithionite
- INVADINE DA or ULTRAVON EL commercial wetting agents available from Huntsman
- Nylon 66 fabric prescoured and heat-set at 175°C, is treated in a bath containing
- the dried fabric obtained according to step (i) is treated using a liquor ratio of 20:1.
- the temperature is raised from ambient temperature to a target temperature of 95°C at a rate of 2°C per minute.
- the bath is then held at 95°C for 30 minutes. After draining the fabric is rinsed twice for 10 minutes each at 50 0 C and subsequently dried at 70 0 C.
- Nylon 6 texturized knitgood, prescoured and heat-set at 175°C, is treated in a bath containing
- T100 (product of Genencor) is included in each rinse.
- Nylon 6 texturized knitgood, prescoured and heat-set at 175°C is treated in a bath containing the components as given in Table 2 for Comparative Example 1 using a liquor ratio of 20:1.
- the temperature is raised from ambient temperature to a target temperature of 95°C at a rate of 2°C per minute.
- the bath is then held at 95°C for 30 minutes. After draining the fabric is rinsed twice for 10 minutes each at 50 0 C and subsequently dried at 70 0 C.
- the degree of whiteness of the fabrics obtained according to the Examples and the Comparative Examples is determined according to the method described by Ganz (Journal of Color and Appearance 1_, No. 5 (1972)). Differences in Whiteness above 5 units Ganz are visually significant. The results are given in Tables 3 to 6.
- the enzymatic bleach at 65°C clearly improves the base white of Nylon 66 fibers, the bleaching effect being more efficient than the bleaching effect achieved by conventional reduction bleach. Superiorfull white effects (with fluorescence) are achieved when the fabric is treated according to the enzymatic bleach-whitening method when compared to a fabric treated in accordance with the conventional bleach-whitening method. One-bath-two-steps bleach-whitening allows to achieve highest full white effects.
Landscapes
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Textile Engineering (AREA)
- Inorganic Chemistry (AREA)
- Detergent Compositions (AREA)
- Chemical Or Physical Treatment Of Fibers (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
A method for bleach-whitening of synthetic textile material is provided comprising contacting said textile material with (a) an enzymatic textile bleaching composition comprising (i) a perhydrolase enzyme, (ii) an ester substrate for said perhydrolase enzyme, (iii) a hydrogen peroxide source, (iv) a surfactant and/or an emulsifier, (v) a peroxide stabilizer, (vi) a sequestering agent, (vii) a buffer which maintains a pH of about 6 to about 8, and (b) at least one fluorescent whitening agent, and, optionally, (c) at least one acid or disperse shading dye for shaded variations of white, for a length of time and under conditions suitable to permit measurable whitening of the textile material, thereby producing a bleached-whitened textile material.
Description
Enzymatic textile bleach-whitening methods
The present invention relates to methods for the enzymatic bleach-whitening of synthetic textile material, in particular polyamide or polyamide-containing textile materials.
In the processing of textile materials, such as fibers, yarns or fabrics, a pretreatment or preparation step is typically required to properly prepare the textile materials for further use and in particular for the dyeing, printing and/or finishing stages typically required for commercial goods. These textile treatment steps remove impurities and color bodies, either naturally existing or those added by the spinning and weaving steps to the fibers and/or fabrics.
While textile treatments may include a number of varying treatments and stages, the most common include: de-sizing, the removal of sizing agents, such as starches, via enzymatic, alkali or oxidative soaking; scouring, the removal of greases, oils, waxes, pectic substances, protein and fats by contact with a solution of sodium hydroxide at temperatures near boiling; and bleaching, the removal and lightening of color bodies from textiles by commonly using oxidizing agents (such as hydrogen peroxide, hypochlorite, and chlorine dioxide), or by using reducing agents (such as, sulfur dioxide or dithionite salts).
Currently employed bleach-whitening processes of polyamide fibers are usually carried out in the presence of reducing agents like stabilized (buffered) sodium dithionite. Known disadvantages of these processes are related to ecology (odor, waste water etc.) and yellowing problems encountered in subsequent drying when the residual sulfur derivatives are not properly and thoroughly removed from the textile substrate.
An enzymatic bleach-whitening process which does not show the above indicated disadvantages and constitutes a new benchmark, as the white effects achieved are clearly improved in comparison with the whitening obtained in reduction bleach, would be desirable.
There is a need for an effective enzymatic textile bleach-whitening process which minimizes the adverse environmental impact and provides fabrics without yellowing problems when compared to conventional textile bleach-whitening processes.
It has been found that the problems indicated are largely solved by the enzymatic bleach-whitening method defined herein below.
The present invention accordingly relates to a method for bleach-whitening of synthetic textile material, in particular polyamide or polyamide-containing textile material, comprising contacting said textile material with
(a) an enzymatic textile bleaching composition comprising (i) a perhydrolase enzyme,
(ii) an ester substrate for said perhydrolase enzyme,
(iii) a hydrogen peroxide source,
(iv) a surfactant and/or an emulsifier,
(v) a peroxide stabilizer,
(vi) a sequestering agent,
(vii) a buffer which maintains a pH of about 6 to about 8, and
(b) at least one fluorescent whitening agent, and, optionally,
(c) at least one acid or disperse shading dye for shaded variations of white, for a length of time and under conditions suitable to permit measurable whitening of the textile material, thereby producing a bleached-whitened textile material.
The subject matter according to the present invention provides methods for bleaching and whitening of synthetic textile material, in particular polyamide or polyamide-containing textile materials, which are contacted with an enzymatic bleaching composition and a fluorescent whitening agent for a length of time and under conditions enabling a full white effect to be achieved. In another aspect, the invention is also suitable for the brightening of pastel shades.
The invention also provides dyed textiles produced from textiles that have been prepared according to the enzymatic bleaching-whitening methods described herein.
The enzymatic bleach-whitening process according to the present invention is environmentally friendly and provides synthetic textile material which does not exhibit yellowing problems encountered in subsequent drying when the residual sulfur derivatives are not properly and thoroughly removed as compared to the whitening obtained in conventional reduction bleach.
The enzymatic bleaching step of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, for example, Molecular Cloning: A Laboratory Manual, 2nd ed., (Sambrook et al., 1989); Oligonucleotide Synthesis (MJ. Gait, ed., 1984); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1994); PCR: The Polymerase Chain Reaction (MuIMs et al., eds., 1994); and Gene Transfer and Expression: A Laboratory Manual (Kriegler, 1990).
Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains.
Singleton, et al., Dictionary of Microbiology and Molecular Biology, 2nd ed., John Wiley and Sons, New York (1994), and Hale & Markham, The Harper Collins Dictionary of Biology, Harper Perennial, New York (1991 ) provide one of skill in the art with a general dictionary of many of the biotechnology related terms used in this invention. Any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention.
Numeric ranges provided herein are inclusive of the numbers defining the range.
Unless otherwise indicated, nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
The term "bleaching," as used herein, means the process of treating a textile material for a sufficient length of time and under appropriate pH and temperature conditions to produce a lighter color in said textile material by removal, modification or masking of color-causing compounds in the textile material. Thus, "bleaching" refers to the treatment of a textile material to effect a brightening of the textile material.
The term "bleaching agent" as used herein encompasses any moiety that is capable of bleaching a textile. They may require the presence of a bleach activator. Bleaching may generally be performed using chemical bleaching agent(s) and/or enzymatically generated bleaching agent(s). Examples of suitable chemical bleaching agents useful in the processes
- A -
and methods described herein are sodium peroxide, sodium perborate, potassium permanganate, and peracids. In some aspects, H2O2 may be considered a chemical bleaching agent when it has been generated enzymatically in situ. A "chemical bleaching composition" contains one or more chemical bleaching agent(s).
An "enzymatic bleaching system" or "enzymatic bleaching composition" as understood in the context of the present invention contains one or more perhydrolase enzymes and one or more ester substrates capable of enzymatically generating a bleaching agent, and a hydrogen peroxide source, for production of a peracid bleaching agent. Such enzymatic bleaching systems are described, for example, in WO 2005/056782.
The term "synthetic textile material" comprises polyamides, polyurethanes, polyacrylics, polyesters, polyolefines, polylactide, and semi-synthetic material such as cellulose acetate.
The cited textile materials can be in a very wide range of forms of presentations, for example, in the form of fibers, yarns, fabrics, garments, knits, wovens and non-wovens.
The term "polyamide or polyamide-containing textile materials" comprises synthetic polyamide, for example, Nylon 6 (polycaproamide), Nylon 6,6 (polyhexamethylene adipamide), Nylon 7 (polyenanthamide), Nylon 6,12 (polyhexamethylene dodecamide), Nylon 11 , Nylon 12 and copolyamides of Nylon 6,6 or Nylon 6, such as polymers made from hexamethylene diamine, ε-caprolactam and adipic acid and polymers prepared from adipic acid, hexamethylene diamine and isophthalic acid, or from adipic acid, hexamehylene diamine and 2-methyl-pentamethylene diamine or 2-ethyl-tetramethylene diamine. It also encompasses blends, for example, blends of polyamide/wool, polyamide/polyacrylonitril, polyamide/cellulose, polyamide/polyester, polyamide/cellulose acetate, polyamide/cellulose triacetate, polyamide/cellulose/wool and all blends indicated above blended with elastane fibers.
A "perhydrolase" refers to an enzyme that is capable of catalyzing a perhydrolysis reaction that results in the production of a sufficiently high amount of peracid suitable for use in an enzymatic textile bleaching composition according to the method described herein. Generally, a perhydrolase enzyme used in the methods described herein exhibits a high perhydrolysis to hydrolysis ratio. In some embodiments, the perhydrolase comprises, consists of, or consists essentially of the Mycobacterium smegmatis perhydrolase amino acid sequence set forth in
SEQ ID NO:1 , or a variant or homolog thereof. In some embodiments, the perhydrolase enzyme comprises acyl transferase activity and catalyzes an aqueous acyl transfer reaction.
A "peracid" is an organic acid of the formula RC(=O)OOH, wherein R is an aliphatic, aromatic or araliphatic radical.
An "ester substrate" in reference to an enzymatic textile bleaching composition according to the invention described herein refers to a perhydrolase substrate that contains an ester linkage. Esters comprising aliphatic and/or aromatic carboxylic acids and alcohols may be utilized as substrates with perhydrolase enzymes. In some embodiments, the ester source is selected from the esters of one or more of the following acids: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid. In some embodiments, the ester source is an acetate ester. In some embodiments, the ester source is selected from one or more of propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
The term "perhydrolyzation" or "perhydrolyze" or "perhydrolysis" as used herein refer to a reaction wherein a peracid is generated from an ester substrate and a hydrogen peroxide source. The perhydrolyzation reaction is catalyzed with a perhydrolase, e.g., acyl transferase or aryl esterase, enzyme. In some embodiments, a peracid is produced by perhydrolysis of an ester substrate of the formula RC(=O)OR*, where R and R* are the same or different organic moieties, in the presence of hydrogen peroxide (H2O2). In one embodiment, -OR* is -OH. In one embodiment, -OR* is replaced by -NH2. In some embodiments, a peracid is produced by perhydrolysis of a carboxylic acid or amide substrate.
The term "peracid," as used herein, refers to a molecule derived from a carboxylic acid ester which has been reacted with hydrogen peroxide to form a highly reactive product that is able to transfer one of its oxygen atoms. It is this ability to transfer oxygen atoms that enables a peracid, for example, peracetic acid, to function as a bleaching agent.
The phrase "perhydrolysis to hydrolysis ratio" refers to the ratio of the amount of enzymatically produced peracid to the amount of enzymatically produced acid by a perhydrolase enzyme
from an ester substrate under defined conditions and within a defined time. In some embodiments, the assays provided in WO 05/056782 are used to determine the amounts of peracid and acid produced by the enzyme.
As used herein, "effective amount of perhydrolase enzyme" refers to the quantity of perhydrolase enzyme necessary to achieve the enzymatic activity required in the processes or methods described herein. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular enzyme variant used, the pH used, the temperature used and the like, as well as the results desired (e.g., level of bleaching).
As used herein, the term "transferase" refers to an enzyme that catalyzes the transfer of a functional group from one substrate to another substrate. For example, an acyl transferase may transfer an acyl group from an ester substrate to a hydrogen peroxide substrate to form a peracid.
As used herein, the term "acyl" refers to an organic group with the general formula RCO-, derived from an organic acid by removal of the -OH group. Typically, acyl group names end with the suffix "-oyl," e.g., ethanoyl chloride, CH3CO-CI, is the acyl chloride formed from ethanoic acid, CH3CO-OH.
As used herein, the term "acylation" refers to a chemical transformation in which one of the substituents of a molecule is substituted by an acyl group, or the process of introduction of an acyl group into a molecule.
As used herein, "oxidizing chemical" refers to a chemical that has the capability of bleaching a textile. The oxidizing chemical is present at an amount, pH and temperature suitable for bleaching. The term includes, but is not limited to hydrogen peroxide and peracids.
As used herein, the terms "purified" and "isolated" refer to the removal of contaminants from a sample and/or to a material (e.g., a protein, nucleic acid, cell, etc.) that is removed from at least one component with which it is naturally associated. For example, these terms may refer to a material which is substantially or essentially free from components which normally accompany it as found in its native state, such as, for example, an intact biological system.
As used herein, the term "polynucleotide" refers to a polymeric form of nucleotides of any length and any three-dimensional structure and single- or multi-stranded (e.g., single-stranded, double-stranded, triple-helical, etc.), which contain deoxyribonucleotides, ribonucleotides, and/or analogs or modified forms of deoxyribonucleotides or ribonucleotides, including modified nucleotides or bases or their analogs. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the polynucleotides applied applied within the context of the present invention encode a particular amino acid sequence. Any type of modified nucleotide or nucleotide analog may be used, so long as the polynucleotide retains the desired functionality under conditions of use, including modifications that increase nuclease resistance (e.g., deoxy, 2'-0-Me, phosphorothioates, etc.). Labels may also be incorporated for purposes of detection or capture, for example, radioactive or nonradioactive labels or anchors, e.g., biotin. The term polynucleotide also includes peptide nucleic acids (PNA). Polynucleotides may be naturally occurring or non-naturally occurring. The terms "polynucleotide" and "nucleic acid" and "oligonucleotide" are used herein interchangeably. Polynucleotides of the invention may contain RNA, DNA, or both, and/or modified forms and/or analogs thereof. A sequence of nucleotides may be interrupted by non-nucleotide components. One or more phosphodiester linkages may be replaced by alternative linking groups. These alternative linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S ("thioate"), P(S)S ("dithioate"), (O)NR2 ("amidate"), P(O)R, P(O)OR', CO or CH2 ("formacetal"), in which each R or R' is independently H or substituted or unsubstituted alkyl (Ci-C2o) optionally containing an ether (-O-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. Polynucleotides may be linear or circular or comprise a combination of linear and circular portions. Suitable polynucleotides are described in WO 2005/056782.
As used herein, "polypeptide" refers to any composition comprised of amino acids and recognized as a protein by those of skill in the art. The conventional one-letter or three-letter code for amino acid residues is used herein. The terms "polypeptide" and "protein" are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation
with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
The terms "analogous sequence", "homologous protein", "wild-type or native proteins", "wild-type sequence", "native sequence", "naturally-occuring sequence", "wild-type gene", "related proteins", "derivative proteins" and "variant proteins", as used herein are familiar to those skilled in the art and are described in more detail in WO 2005/056782 on pages 12, 13 and 50 to 52, which are herein incorporated by reference. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity(ies).
Several methods are known in the art that are suitable for generating variants of the enzymes described herein, including but not limited to site-saturation mutagenesis, scanning mutagenesis, insertional mutagenesis, random mutagenesis, site-directed mutagenesis, and directed-evolution, as well as various other recombinatorial approaches.
The degree of homology between sequences may be determined using any suitable method known in the art. For example, PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. Another example of a useful algorithm is the BLAST algorithm. Useful methods and programs are referred to in WO 2005/056782 on pages 59 and 60, which are herein incorporated by reference.
The terms "substantially similar" and "substantially identical" as generally used in the context of a polynucleotide or polypeptide sequence compared to a reference (i.e., wild-type) sequence as well as methods to determine sequence identity are described in more detail in WO 2005/056782 on pages 61 and 62, which are herein incorporated by reference.
"Surfactant" refers to a substance that reduces surface tension of a liquid.
"Emulsifier" refers to a substance that promotes the suspension of one liquid in another.
"Sequestering agent" refers to a substance capable of reacting with metallic ions by forming a water-soluble complex in which the metal is held in a non-ionizable form.
The terms "size" or "sizing" refer to compounds used in the textile industry to improve weaving performance by increasing the abrasion resistance and strength of the yarn. Size is usually made of, for example, starch or starch-like compounds.
The terms "desize" or "desizing," as used herein, refer to the process of eliminating size, generally starch, from textiles usually prior to applying special finishes, dyes or bleaches.
"Desizing enzyme(s)" as used herein refer to enzymes that are used to enzymatically remove the size. Exemplary enzymes are amylases, cellulases and mannanases.
The term "scouring," as used herein, means to remove impurities, for example, much of the impurities (e.g., pectins, proteins, wax, etc.) naturally found in textile materials. In addition to the natural impurities, scouring can remove, in some embodiments, residual materials introduced by manufacturing processes, such as spinning, coning or slashing lubricants. In some embodiments, bleaching may be employed to remove impurities from textiles.
The term "bioscouring enzyme(s)" refers to an enzyme(s) capable of removing at least a portion of the impurities found in textile materials.
The term "pectinase" denotes a pectinase enzyme defined according to the art where pectinases are a group of enzymes that cleave glycosidic linkages of pectic substances mainly poly(1 ,4-alpha-D-galacturonide) and its derivatives (see Sakai et al. (1993) Advances in Applied Microbiology 39:213-294). Preferably, a pectinase useful herein is a pectinase enzyme which catalyzes the random cleavage of alpha-1 ,4-glycosidic linkages in pectic acid also called polygalacturonic acid by transelimination, such as the enzyme class polygalacturonate lyase (EC 4.2.2.2) (PGL), also known as poly(1 ,4-alpha-D-galacturonide) lyase, also known as pectate lyase.
The term "pectic substances" denotes pectate, polygalacturonic acid and pectin which may be esterified to a higher or lower degree.
The term "cutinase," as used herein, refers to as a plant, bacterial or fungal derived enzyme used in textile processing. Cutinases are lipolytic enzymes capable of hydrolyzing the substrate cutin. Cutinases can breakdown fatty acid esters and other oil-based compositions need to be removed in the processing (e.g., the scouring) of textiles. "Cutinase" means an enzyme that has significant plant cutin hydrolysis activity. Specifically, a cutinase will have hydrolytic activity on the biopolyester polymer cutin found on the leaves of plants. Suitable cutinases may be isolated from many different plant, fungal and bacterial sources.
The term "α-amylase," as used herein, refers to an enzyme that cleaves the α (1-4)glycosidic linkages of amylose to yield maltose molecules (disaccharides of α-glucose). Amylases are digestive enzymes found in saliva and are also produced by many plants. Amylases break down long-chain carbohydrates (such as starch) into smaller units. An "oxidative stable" α-amylase is an α-amylase that is resistive to degradation by oxidative means, when compared to non-oxidative stable α-amylase, especially when compared to the non-oxidative stable α-amylase form which the oxidative stable α-amylase was derived.
The term "protease" means a protein or polypeptide domain of a protein or polypeptide derived from a microorganism, e.g. a fungus, bacterium, or from a plant or animal, and that has the ability to catalyze cleavage of peptide bonds at one or more of various positions of a protein carbohydrate backbone.
"Catalase" as used herein refers to an enzyme (i.e., a polypeptide having catalytic activity) that catalyzes the decomposition of hydrogen peroxide to water and oxygen.
"Batch process" or "batchwise process" or "discontinuous process" refers to processing of textiles as lots or batches in which the whole of each batch is subjected to a process or one stage of a process at a time.
"Exhaust process" refers to a batch process in which pretreatment chemicals and/or an enzymatic pretreatment composition and dye are added simultaneously or sequentially in a single textile treatment bath.
"Liquor ratio" refers to the ratio of the weight of liquor (liquid) employed in a textile treatment process to the weight of the textile treated.
"A," "an" and "the" include plural references unless the context clearly dictates otherwise.
The enzymatic textile bleach-whitening methods described herein are particularly carried out as a discontinuous process (one-bath two-steps exhaustion method) but can also be carried out as a semi-continuous process like pad-batch or pad-roll.
The enzymatic bleaching composition used in accordance with the enzymatic textile bleach-whitening method of the present invention contain a perhydrolase enzyme, an ester substrate for the perhydrolase enzyme suitable for production of a peracid upon catalytic reaction of the perhydrolase enzyme on the substrate in the presence of a hydrogen peroxide source and/or hydrogen peroxide, a surfactant and/or an emulsifier, a peroxide stabilizer, a sequestering agent, and a buffer which maintains a pH of about 6 to about 8 during a textile bleaching process. The enzymatic bleaching composition may, optionally, further contain a bioscouring agent or enzyme and/or a desizing agent or enzyme.
In the following the components applied in accordance with the method of the present invention along with information on the quantities of these components are described in more detail. Parts (ppm) are parts by weight, unless noted otherwise.
Perhvdrolase Enzyme
One or more perhydrolase enzymes may be used in the compositions according to the methods for enzymatic textile bleach-whitening as described herein.
In some embodiments, the perhydrolase enzyme is naturally-occurring (i.e., a perhydrolase enzyme encoded by a genome of a cell). In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence of a naturally-occurring perhydrolase enzyme.
In some embodiments, the perhydrolase enzyme is a naturally-occurring M. smegmatis perhydrolase enzyme. In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of the amino acid sequence set forth in SEQ ID NO:1 or a variant or
homologue thereof. In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence set forth in SEQ ID NO:1.
The amino acid sequence of M. smegmatis perhydrolase is shown below: MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGLSARTTNID DPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIALGMSVLVTQVLTSAGG VGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTELARVYSALASFMKVPFFDAGSVI STDGVDGIHFTEANNRDLGVALAEQVRSLL (SEQ ID NO:1 ).
The corresponding polynucleotide sequence encoding M. smegmatis perhydrolase is:
5'-ATGGCCAAGCGAATTCTGTGTTTCGGTGATTCCCTGACCTGGGGCTGGGTCC
CCGTCGAAGACGGGGCACCCACCGAGCGGTTCGCCCCCGACGTGCGCTGGACCGGTG
TGCTGGCCCAGCAGCTCGGAGCGGACTTCGAGGTGATCGAGGAGGGACTGAGCGCGC
GCACCACCAACATCGACGACCCCACCGATCCGCGGCTCAACGGCGCGAGCTACCTGC
CGTCGTGCCTCGCGACGCACCTGCCGCTCGACCTGGTGATCATCATGCTGGGCACCAA
CGACACCAAGGCCTACTTCCGGCGCACCCCGCTCGACATCGCGCTGGGCATGTCGGT
GCTCGTCACGCAGGTGCTCACCAGCGCGGGCGGCGTCGGCACCACGTACCCGGCACC
CAAGGTGCTGGTGGTCTCGCCGCCACCGCTGGCGCCCATGCCGCACCCCTGGTTCCA
GTTGATCTTCGAGGGCGGCGAGCAGAAGACCACTGAGCTCGCCCGCGTGTACAGCGC
GCTCGCGTCGTTCATGAAGGTGCCGTTCTTCGACGCGGGTTCGGTGATCAGCACCGAC
GGCGTCGACGGAATCCACTTCACCGAGGCCAACAATCGCGATCTCGGGGTGGCCCTC
GCGGAACAGGTGCGGAGCCTGCTGTAA-3' (SEQ ID NO:2).
In some embodiments, the perhydrolase enzyme comprises one or more substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1. In some embodiments, the perhydrolase enzyme comprises any one or any combination of substitutions of amino acids selected from M1 , K3, R4, 15, L6, C7, D10, S11 , L12, T13, W14, W16, G15, V17, P18, V19, D21 , G22, A23, P24, T25, E26, R27, F28, A29, P30, D31 , V32, R33, W34, T35, G36, L38, Q40, Q41 , D45, L42, G43, A44, F46, E47, V48, I49, E50, E51 , G52, L53, S54, A55, R56, T57, T58, N59, I60, D61 , D62, P63, T64, D65, P66, R67, L68, N69, G70, A71 , S72, Y73, S76, C77, L78, A79, T80, L82, P83, L84, D85, L86, V87, N94, D95, T96, K97, Y99F100, R101 , R102, P104, L105, D106, 1107, A108,
L109, G1 10, M1 11. S112, V1 13, L114, V1 15, T1 16, Q1 17, V118, L119, T120, S121 , A122, G124, V125, G126, T127, T128, Y129, P146, P148, W149, F150, 1153, F154, 1194, and F196.
In some embodiments, the perhydrolase enzyme comprises one or more of the following substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12C, Q, or G; T25S, G, or P; L53H, Q, G, or S; S54V, L A, P, T, or R; A55G or T; R67T, Q, N, G, E, L, or F; K97R; V125S, G, R, A, or P; F154Y; F196G.
In some embodiments, the perhydrolase enzyme is the S54V variant of SEQ ID NO:1.
In some embodiments, the perhydrolase enzyme comprises a combination of amino acid substitutions at amino acid positions equivalent to amino acid positions in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12I S54V; L12M S54T; L12T S54V; L12Q T25S S54V; L53H S54V; S54P V125R; S54V V125G; S54V F196G; S54V K97R V125G; or A55G R67T K97R V125G.
In some embodiments, the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio of at least 1. In some embodiments, the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio greater than 1.
In some embodiments, the perhydrolase enzyme is provided in the enzymatic textile bleaching composition used according to the textile bleach-whitening method of the present invention at a concentration of about 0.5 to about 2.5 ppm, about 1.5 to about 2.0 ppm, for example, about 1.7 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Ester Substrate
The enzymatic bleaching compositions used in accordance with the method described herein include an ester which serves as a substrate for the perhydrolase enzyme for production of a peracid in the presence of hydrogen peroxide. In some embodiments, the ester substrate is an ester of an aliphatic and/or aromatic carboxylic acid. In some embodiments, the ester substrate is an ester of one or more of the following: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid. In some embodiments, glycerol triacetate, glycerol tributyrate, and other esters serve as acyl donors for peracid formation. In some embodiments, the ester substrate is selected from propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate. In some embodiments, the ester substrate is propylene glycol diacetate, ethylene glycol diacetate, or ethyl acetate. In one embodiment, the ester substrate is propylene glycol diacetate.
In some embodiments, the ester substrate, for example, propylene glycol diacetate, is provided at a concentration of about 2000 to about 4000 ppm, about 2500 to about 3500 ppm, about 2800 ppm to about 3200 ppm, or about 3000 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Hydrogen Peroxide Source
The enzymatic bleaching compositions used in accordance with the method described herein include a hydrogen peroxide source. Hydrogen peroxide can be either added directly in batch, or generated continuously "in situ" by chemical, electro-chemical, and/or enzymatic means.
In some embodiments, the hydrogen peroxide source is hydrogen peroxide. In some embodiments, the hydrogen peroxide source is a solid compound that generates hydrogen peroxide spontaneously upon addition to water. Such compounds include adducts of hydrogen peroxide with various inorganic or organic compounds, of which the most widely employed is sodium carbonate perhydrate, also referred to as sodium percarbonate.
lnorganic perhydrate salts are one embodiment of hydrogen peroxide source. Examples of inorganic perhydrate salts include perborate, percarbonate, perphosphate, persulfate and persilicate salts. The inorganic perhydrate salts are normally the alkali metal salts.
Other hydrogen peroxide adducts useful in the compositions used in accordance with the method described herein include adducts of hydrogen peroxide with zeolites, or urea hydrogen peroxide.
The hydrogen peroxide source compounds may be included as the crystalline and/or substantially pure solid without additional protection. For certain perhydrate salts however, the preferred executions of such granular compositions utilize a coated form of the material which provides better storage stability for the perhydrate salt in the granular product. Suitable coatings comprise inorganic salts such as alkali metal silicate, carbonate or borate salts or mixtures thereof, or organic materials such as waxes, oils, or fatty soaps.
In some embodiments, the hydrogen peroxide source is an enzymatic hydrogen peroxide generation system. In one embodiment, the enzymatic hydrogen peroxide generation system comprises an oxidase and its substrate. Suitable oxidase enzymes include, but are not limited to: glucose oxidase, sorbitol oxidase, hexose oxidase, choline oxidase, alcohol oxidase, glycerol oxidase, cholesterol oxidase, pyranose oxidase, carboxyalcohol oxidase, L-amino acid oxidase, glycine oxidase, pyruvate oxidase, glutamate oxidase, sarcosine oxidase, lysine oxidase, lactate oxidase, vanillyl oxidase, glycolate oxidase, galactose oxidase, uricase, oxalate oxidase, and xanthine oxidase.
The following equation provides an example of a coupled system for enzymatic production of hydrogen peroxide.
Glucose oxidase Glucose + H2O -^gluconic acid + H2O2
+
Perhydrolase H2O2 + ester substrate -> alcohol + peracid
It is not intended that the present invention be limited to any specific enzyme, as any enzyme that generates H2O2 with a suitable substrate may be used in the present invention. For
example, lactate oxidases from Lactobacillus species which are known to create H2O2 from lactic acid and oxygen may be used. One advantage of the enzymatic generation of acid (e.g., gluconic acid in the above example) is that this reduces the pH of a basic solution to the pH range in which a peracid is most effective in bleaching (i.e., at or below the pKa). Other enzymes (e.g., alcohol oxidase, ethylene glycol oxidase, glycerol oxidase, amino acid oxidase, etc.) that can generate hydrogen peroxide also may be used with ester substrates in combination with the perhydrolase enzymes of the present invention to generate peracids.
In some embodiments, the hydrogen peroxide generating oxidase is a carbohydrate oxidase.
Hydrogen peroxide may also be generated electrochemically, for example using a fuel cell fed oxygen and hydrogen gas.
In some embodiments, the hydrogen peroxide source is hydrogen peroxide provided at a concentration of about 1000 to about 3200 ppm, about 1500 to about 2800 ppm, about 2000 ppm to about 2200 ppm, or about 2100 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Surfactants and Emulsifier
The enzymatic textile bleaching compositions used in accordance with the present method contain one or more, i.e., at least one surfactant and/or at least one emulsifier. Surfactants suitable for use in practicing the present invention include, without limitation, nonionic (see, e.g., U.S. Pat. No. 4,565,647, which is herein incorporated by reference); anionic; cationic; and zwitterionic surfactants (see, e.g., U.S. Pat. No. 3,929,678 which is herein incorporated by reference). Anionic surfactants include, without limitation, linear alkylbenzenesulfonate, α-olefinsulfonate, alkyl sulfate (fatty alcohol sulfate), alcohol ethoxysulfate, secondary alkanesulfonate, alpha-sulfo fatty acid methyl ester, alkyl- or alkenylsuccinic acid, and soap. Non-ionic surfactants include, without limitation, fatty alcohol ethoxylate, isotridecanol ethoxylate, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamineoxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, polyhydroxy alkyl fatty acid amide, and N-acyl N-alkyl derivatives of glucosamine ("glucamides").
In some embodiments, the surfactant and/or emulsifier comprises a non-ionic surfactant. In one embodiment, the non-ionic surfactant is a fatty alcohol ethoxylate. In one embodiment, the non-ionic surfactant is isotridecanol ethoxylate. In one embodiment, the non-ionic surfactant is a fatty alcohol ethoxylate and isotridecanol ethoxylate.
In one embodiment, the composition used in accordance with the present method comprises a surfactant and an emulsifier.
A surfactant may be present at a concentration of about 300 ppm to about 4800 ppm, about 600 ppm to about 3600 ppm, or about 300 ppm to about 1200 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
In some embodiments, the enzymatic bleaching composition contains isotridecanol ethoxylate at a concentration of about 300 ppm to about 3600 ppm, about 600 ppm to about 3000 ppm, or about 900 ppm to about 2400 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Peroxide Stabilizer
The enzymatic bleaching compositions used in accordance with the method described herein contain a peroxide stabilizer. Examples of peroxide stabilizers include, but are not limited to, sodium silicate, sodium carbonate, acrylic polymers, magnesium salts, and phosphonic acid. In one embodiment, the peroxide stabilizer is phosphonic acid.
A peroxide stabilizer may be present in the enzymatic textile bleaching composition at a concentration of about 60 ppm to about 600 ppm, about 60 ppm to about 1200 ppm, or about 120 ppm to about 960 ppm based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Sequestering Agent
The enzymatic bleaching compositions used in accordance with the method described herein include a sequestering agent. Examples of sequestering agents include, but are not limited to, amino carboxylates, amino phosphonates, polyfunctionally-substituted aromatic chelating
agents, polyhydroxy-carboxylic acids, aminopolycarboxylic acids, polyphosphonates, and polyacrylic acids, and mixtures thereof.
Amino carboxylates useful as sequestering agents include ethylenediaminetetracetates, N-hydroxyethylethylenediaminetriacetates, nitrilotriacetates, ethylenediamine tetraproprionates, and triethylenetetraaminehexacetates.
Polyfunctionally-substituted aromatic sequestering agents are also useful in the compositions herein (see U.S. Pat. No. 3,812,044). Preferred compounds of this type in acid form are dihydroxydisulfobenzenes such as 1 ,2-dihydroxy-3,5-disulfobenzenediethylenetriamine- pentaacetates, and ethanoldiglycines, alkali metal, ammonium, and substituted ammonium salts therein and mixtures thereof.
Amino phosphonates are also suitable for use as sequestering agents in the compositions of the invention when at least low levels of total phosphorus are permitted.
A biodegradable sequestering agent suitable for use herein is ethylenediamine disuccinate ("EDDS"), especially the [S, S] isomer as described in U.S. Pat. No. 4,704,233.
In one embodiment, the sequestering agent is polyacrylic acid.
A sequestering agent may be present in the enzymatic textile bleaching composition at a concentration of about 60 ppm to about 1800 ppm, about 300 ppm to about 1200 ppm, or about 180 ppm to about 1200 ppm based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Bleaching Processor
Appropriately, at least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent are applied as a combination product containing each of at least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent. The said combination product is designated bleaching processor and is commercially available, for example, CLARITE® LTC (product of Huntsman).
A surfactant may be present at a concentration of about 5% to about 40%, about 20% to about 30%, or about 5% to about 10%, based on the total weight of the bleaching processor.
A peroxide stabilizer may be present in the bleaching processor at a concentration of about 1% to about 5%, about 1 % to about 10%, or about 2% to about 8%, based on the total weight of the bleaching processor.
A sequestering agent may be present in the bleaching processor at a concentration of about 1 % to about 15%, about 5% to about 10%, or about 3% to about 10%, based on the total weight of the bleaching processor.
In some embodiments, the bleaching processor contains isotridecanol ethoxylate at a concentration of about 5% to about 30%, about 10% to about 25%, or about 15% to about 20%, based on the total weight of the bleaching processor.
The bleaching processor is suitably provided as an aqueous composition comprising the above indicated components.
Buffer
The enzymatic bleaching composition contains a buffer that is capable of maintaining the pH of the composition at a pH of about 6 to about 8. In one embodiment, the buffer is a carbonate buffer, pH 8.
Fluorescent Whitening Agent
Suitable fluorescent whitening agents used in accordance with the method described herein are, for example, distyryl biphenyl derivatives as described in U.S. Pat. No. 3,984,399, U.S. Pat. No. 5,969,204 and U.S. Pat. No. 6,096,919 which are herein incorporated by reference.
In one embodiment the distyryl biphenyl derivatives indicated correspond to compounds of the formula
in which
M is hydrogen, lithium, sodium, potassium, ammonium or ammonium that is mono-, di-, tri- or tetra-substituted by C-i-Cβalkyl or C2-Cehydroxyalkyl which may be interrupted by an oxygen atom or a mixture thereof, and R1 and R2 independently of one another are hydrogen, d-Cβalkyl, d-Cβalkoxy or halogen.
In another embodiment the compound of the formula (1 ) corresponds to the compound of the formula (1a)
in which
M is defined as given above.
Further suitable fluorescent whitening agents are, for example, triazolyl stilbene disulfonic acid derivatives as described in U.S. Pat. No. 3,485,831 , U.S. Pat. No. 3,453,268 and U.S. Pat. No. 3,994,834 which are herein incorporated by reference.
In one embodiment the triazolyl stilbene disulfonic acid derivatives indicated correspond to the compound of the formula
(2),
in which
M is defined as given above.
Other fluorescent whitening agents which come into consideration for practising the present invention are, for example, diamino stilbene derivatives of the formula
in which
M is is defined as given above, and
R3 and R4 independently of one another are Ci-C4alkoxy, Ci-C4alkylthio, substituted or unsubstituted amino or an N-heterocycle which may contain further heteroatoms;
diphenyl pyrazoline derivatives of the formula
in which
M is defined as given above, and R5 and R6 independently of one another are hydrogen, Ci-C4alkyl, Ci-C4alkoxy or halogen;
diphenyl pyrazoline derivatives of the formula
in which
M is defined as given above;
a coumarine derivative of the formula
benzoxazole derivatives of the formula
in which
B is a radical of formula -CH=CH-, 2,5-thiophenylene or 1 ,4-naphthylene, and
R7 and R8 independently of one another are hydrogen, d-C4alkyl, d-C4alkoxy or halogen; and
dicyanstyrylbenzene derivatives of the formula
C2-C6hydroxyalkyl which may be interrupted by an oxygen atom as suitable substituent for M in the meaning of mono-, di-, tri- or tetra-substituted ammonium is suitably typically a radical of formula -CH2CH2OH, -CH2-CH(OH)-CH3, -(CH2)2-O-(CH2)2-OH, -(CH2)2-O-CH2-CH2-OH or -(CH2)2-O-CH2-CH(CH3)-OH.
CrCβalkyl as suitable substituent for M in the meaning of mono-, di-, tri- or tetra-substituted ammonium is, for example, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, isobutyl, pentyl or hexyl.
R1 and R2 defined as CrCβalkyl independently of one another are, for example, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, isobutyl, pentyl or hexyl and, preferably, Ci-C4alkyl, such as ethyl.
Ri and R2 defined as Ci-C6alkoxy independently of one another are, for example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, isobutoxy, pentyloxy or hexyloxy, preferably Ci-C4alkoxy, such as methoxy or ethoxy.
Ri, R2, Rs, Re, R7 and R8 defined as halogen independently of one another are, for example, fluorine, chlorine or bromine, preferably chlorine or bromine and in particular chlorine, the definitions and preferences also applying to the following halogen radicals.
R3 and R4 defined as Ci-C4alkylthio independently of one another are, for example, methylthio, ethylthio, n-propylthio, isopropylthio or n-butylthio, preferably ethylthio or n-propylthio.
R3, R4, R5, Re, R7 and R8 defined as Ci-C4alkoxy independently of one another are, for example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy or isobutoxy, preferably methoxy or ethoxy, the definitions and preferences also applying to the following Ci-C4alkoxy radicals.
R5, Re, R7 and R8 defined as Ci-C4alkyl independently of one another are, for example, methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl or isobutyl, the definitions and preferences also applying to the following d-C4alkyl radicals.
R3 and R4 as substituted or unsubstituted amino independently of one another are, for example, amino which is unsubstituted or substituted on the N-atom by, for example, the following radicals:
N-mono- or N,N-di-Ci-C4alkylamino, which includes both the unsubstituted radicals, for example, ethylamino or diethylamino, and the radicals substituted in the alkyl moiety by, for example, N,N-di-Ci-C4alkylamino, Ci-C4alkoxy, hydroxy, carboxy, sulfo or sulfato; C5-C7cycloalkylamino, which includes both the unsubstituted radicals and the radicals substituted in the cycloalkyl ring, for example by Ci-C4alkyl, in particular methyl; phenylamino or N-Ci-C4alkyl-N-phenylamino, which includes both the unsubstituted radicals and the radicals substituted in the phenyl ring, for example by Ci-C4alkyl which in turn may be substituted by phenyl, Ci-C4alkoxy, halogen, carbamoyl, carbamoyl which is mono- or di-substituted on the nitrogen by Ci-C4alkyl or Ci-C4hydroxyalkyl, carboxy, CrC4alkoxycarbonyl or sulfo; these radicals are preferably unsubstituted in the phenyl ring or substituted by sulfo.
R3 and R4 in the meaning of an N-heterocycle which may contain further heteroatoms independently of one another are, for example, morpholino or piperidin-1-yl.
Carboxy generally means the group -COOM; Sulfo generally means the group -SO3M, in which M is hydrogen, lithium, sodium, potassium, ammonium or ammonium that is mono-, di-, tri- or tetra-substituted by Ci-C4alkyl or Ci-C4hydroxyalkyl or a mixture thereof.
In one embodiment at least one of a distyryl biphenyl derivative and a triazolyl stilbene disulfonic acid derivative are used in accordance with the method described herein.
In another embodiment at least one of a distyryl biphenyl derivative of the formula (1 a) and a triazolyl stilbene disulfonic acid derivative of the formula (2) are used in accordance with the method described herein.
In some embodiments the fluorescent whitening agent is provided at a concentration of about 0.05 to about 0.8 %, about 0.08 to about 0.5 %, about 0.1 to about 0.4 %, based on the weight of the textile material.
Organic Acid
An organic acid is appropriately used to adjust the pH for the uptake of the fluorescent whitening agent. The organic acid is suitably oxalic acid, citric acid and acetic acid. In one embodiment the organic acid is acetic acid.
In some embodiments the organic acid is provided at a concentration of about 100 to about 4000 ppm, about 600 to about 3000 ppm, about 800 ppm to about 1600 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Appropriately, the pH is adjusted to pH 4 to 5, for example, pH 4.5.
Enzymatic Textile Bleach-Whitening Method
Appropriately, the method of the invention utilizes a liquor ratio of about 2:1 to about 50:1 , about 5:1 to about 20:1 , for example, about 20:1 or 10:1. In some embodiments, the method according to the present invention is performed in a discontinuous process, for example, as a one-bath-two-steps exhaustion method. In these embodiments the enzymatic textile bleaching is carried out in the first step and in a subsequent second step whitening is carried out by adding the fluorescent whitening agent into the same bath after adjustment of the bath to pH 4 to 5, for example, pH 4.5, during 20 minutes at about 65°C to about 95°C. In some embodiments, the method is performed in a semi-continuous process like pad-batch or pad-roll.
Textiles are contacted with the enzymatic bleaching composition at a temperature of about 55°C to about 750C, about 600C to about 700C, for a processing time of about 20 to about 60 minutes at a pH of about 6 to about 8. In one embodiment, the bleaching temperature is about 65°C and the processing time is about 50 minutes. In some embodiments, the temperature of the enzymatic bleaching composition is raised by about 2°C per minute from a starting
temperature of about 200C to about 500C, for example, about 20°C to about 400C, until the processing temperature for bleaching is reached.
In some other embodiments the whitening step is carried out in a separate bath after enzymatic textile bleaching, washing-off and neutralization (two-baths-two-steps). One or more rinsing steps are performed after treatment of the textile material with the enzymatic bleaching composition, to remove the bleaching composition. Appropriately, the textile is rinsed with an aqueous composition (water or a composition containing water). In some embodiments, the rinsing temperature is about 400C to about 600C, for example, about 500C. In some embodiments, the aqueous rinsing composition contains a catalase enzyme to catalyze the decomposition of hydrogen peroxide to water and oxygen. In one embodiment, the textile is rinsed twice with a catalase containing aqueous composition for about 10 minutes for each rinse. In one embodiment residual hydrogen peroxide is removed by rinsing twice with an aqueous composition containing catalase at about 50°C.
Appropriately, a rinsing step as described above is applied in the one-bath-two-steps method after the whitening step is finished.
Bioscouring Enzymes
In some embodiments, the methods for enzymatic textile bleach-whitening described herein include one or more bioscouring enzyme(s). One or more bioscouring enzyme(s) may be included in the enzymatic textile bleaching composition, or a textile may be treated with bioscouring enzyme(s) in a subsequent processing step after treatment in the enzymatic textile bleaching composition.
As the bioscouring enzymes there come into consideration for practicing the present invention pectinases, hemicellulases, cellulases, enzymes that hydrolyze polyester substrates, for example, cutinases or lipases and other bioscouring enzymes, for example, proteases.
Suitable pectinases, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 19 to 21 , which are herein incorporated by reference.
Suitable cellulases, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 22 and 23, which are herein incorporated by reference.
As the other bioscouring enzymes which come into consideration for practicing the present invention, may be used, for example, proteases, protease variants, and lipases. These enzymes, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 23 to 25, which are herein incorporated by reference.
As the enzymes that hydrolyze polyester substrates suitable for use in the present invention may be used, for example, cutinases or lipases. These enzymes, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 21 and 22, which are herein incorporated by reference.
In one embodiment, the bioscouring enzyme is a pectinase.
Desizing Enzymes
In some embodiments, the methods for enzymatic textile bleach-whitening described herein include one or more desizing enzyme(s). One or more desizing enzyme(s) may be included in the enzymatic textile bleaching composition, or a textile may be treated with desizing enzyme(s) in a previous processing step before treatment in the enzymatic textile bleaching composition.
Any suitable desizing enzyme may be used in the present invention. In some embodiments, the desizing enzyme is an amylolytic enzyme. Mannanases and glucoamylases may also be used. In some embodiments, the desizing enzyme is an α- or β-amylase and combinations thereof.
Suitable amylases, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 18 and 19, which are herein incorporated by reference.
The following examples are intended to illustrate, but not limit, the invention. Temperatures are in degrees Celsius, parts are parts by weight and the percentage data are percentages by weight, unless noted otherwise. Parts by weight bear the same relation to parts by volume as the kilogram to the litre.
Experimental Part
A comparison between the method of the present invention and conventional reduction bleach with sodium dithionite is performed according to the procedures given below by treating the fabric in exhaust using a Mathis AG Lab Vistacolor apparatus (ZELTEX).
Examples 1A, 2 and 3
Enzymatic bleach-whitening carried out as a one-bath-two-steps exhaustion method: Nylon 66 fabric, prescoured and heat-set at 175°C, is treated in a bath containing the bleaching processor, soda ash, the ester substrate, hydrogene peroxide and the perhydrolase enzyme in the amounts given in Table 1 using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 65°C at a rate of 2°C per minute. The bath is then held at 65°C for 30 minutes and afterwards adjusted to pH 4.5 by addition of acetic acid (80%). Subsequently, the fluorescent whitening agent in the amount given in Table 1 is added to the bath and treatment is continued at a temperature of 65°C for further 20 minutes. After draining the fabric is rinsed twice for 10 minutes each at 500C and then dried at 700C. 0.5 g/l of a 25% solution of Catalase T100 (available from Genencor) is included in each rinse.
Table 1 : Examples 1A, 2 and 3 - enzymatic bleach-whitening
1 ) CLARITE LTC (commercial product of Huntsman)
2) Propylene glycol diacetate
3) corresponds to 1.0 g/l Primagreen® EcoWhite (1x) (product of Genencor)
4) Fluorescent whitening agent of the formula (1a); [%] based on the weight of fabric
5) Fluorescent whitening agent of the formula (2); [%] based on the weight of fabric
6) Mixture of 0.00025% of Benzo phenazinium, 7-phenyl-5,9-bis(phenylamino)-4,10-disulfo-, hydroxide, inner salt, monosodium salt and 0.00019% of Benzo phenazinium, 7-phenylsulfo-5- [(4-sulfophenyl)amino]-, hydroxide, inner salt, monosodium salt; [%] based on the weight of fabric
Comparative Examples 1 to 3
Conventional reduction bleach with sodium dithionite:
Nylon 66 fabric, prescoured and heat-set at 175°C, is treated in a bath containing the components in the amounts given in Table 2 using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 95°C at a rate of 2°C per minute. The bath is then held at 95°C for 30 minutes. After draining the fabric is rinsed twice for 10 minutes each at 500C and subsequently dried at 700C.
Table 2: Comparative Examples 1 to 3 - reduction bleach with sodium dithionite
1 ) INVADINE DA or ULTRAVON EL (commercial wetting agents available from Huntsman)
2) Stabilized
3) Fluorescent whitening agent of the formula (1a); [%] based on the weight of fabric
4) Fluorescent whitening agent of the formula (2); [%] based on the weight of fabric
5) Mixture of 0.00025% of Benzo phenazinium, 7-phenyl-5,9-bis(phenylamino)-4,10-disulfo-, hydroxide, inner salt, monosodium salt and 0.00019% of Benzo phenazinium, 7-phenylsulfo-5- [(4-sulfophenyl)amino]-, hydroxide, inner salt, monosodium salt; [%] based on the weight of fabric
Example 1 B
Enzymatic bleach-whitening carried out as a two-baths-two-steps exhaustion method:
(i) Nylon 66 fabric, prescoured and heat-set at 175°C, is treated in a bath containing
0.9 g/l of a bleaching processor as given in Table 1 ,
2.0 g/l of sodium carbonate buffer,
3.0 g/l of an ester substrate (propylene glycol diacetate),
6.0 ml/l of hydrogene peroxide 35%, and
1.7 mg/l of the perhydrolase enzyme which corresponds to 1.0 g/l of Primagreen® EcoWhite (1x)
(product of Genencor) using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 65°C at a rate of 2°C per minute. The bath is then held at 65°C for 50 minutes.
After draining the fabric is rinsed twice for 10 minutes each at 500C and subsequently dried at
700C. 0.5 g/l of a 25% solution of Catalase T100 (product of Genencor) is included in each rinse.
(ii) In a separate bath containing
1.0 g/l of a wetting agent as given in Table 2,
0.4 % of the fluorescent whitening agent of the formula (1 a), and sufficient acetic acid (80%) to adjust the bath to pH 4.5,
the dried fabric obtained according to step (i) is treated using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 95°C at a rate of 2°C per minute. The bath is then held at 95°C for 30 minutes. After draining the fabric is rinsed twice for 10 minutes each at 500C and subsequently dried at 700C.
Example 4
Enzymatic bleach-whitening carried out as a one-bath-two-steps exhaustion method:
Nylon 6 texturized knitgood, prescoured and heat-set at 175°C, is treated in a bath containing
0.9 g/l of a bleaching processor as given in Table 1 ,
2.0 g/l of sodium carbonate buffer,
3.0 g/l of an ester substrate (propylene glycol diacetate),
6.0 ml/l hydrogene peroxide 35%, and
1.7 mg/l of the perhydrolase enzyme which corresponds to 1.0 g/l of Primagreen® EcoWhite (1x)
(product of Genencor), using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 65°C at a rate of 2°C per minute. The bath is then held at 65°C for 30 minutes and afterwards adjusted to pH 4.5 by addition of acetic acid (80%). Subsequently, 0.4 % of the fluorescent whitening agent of the formula (1 a) is added to the bath and treatment is continued at a temperature of 65°C for further 20 minutes. After draining the fabric is rinsed twice for 10 minutes each at 500C and subsequently dried at 700C. 0.5 g/l of a 25% solution of Catalase
T100 (product of Genencor) is included in each rinse.
Comparative Example 4
Conventional reduction bleach with sodium dithionite:
Nylon 6 texturized knitgood, prescoured and heat-set at 175°C is treated in a bath containing the components as given in Table 2 for Comparative Example 1 using a liquor ratio of 20:1. The temperature is raised from ambient temperature to a target temperature of 95°C at a rate of 2°C per minute. The bath is then held at 95°C for 30 minutes. After draining the fabric is rinsed twice for 10 minutes each at 500C and subsequently dried at 700C.
Results
The degree of whiteness of the fabrics obtained according to the Examples and the Comparative Examples is determined according to the method described by Ganz (Journal of Color and Appearance 1_, No. 5 (1972)). Differences in Whiteness above 5 units Ganz are visually significant. The results are given in Tables 3 to 6.
Table 3: Degree of whiteness
The enzymatic bleach at 65°C clearly improves the base white of Nylon 66 fibers, the bleaching effect being more efficient than the bleaching effect achieved by conventional reduction bleach. Superiorfull white effects (with fluorescence) are achieved when the fabric is treated according to the enzymatic bleach-whitening method when compared to a fabric treated in accordance with the conventional bleach-whitening method. One-bath-two-steps bleach-whitening allows to achieve highest full white effects.
Table 4: Degree of whiteness
Superior full white effects are achieved when the fabric is treated in accordance with the enzymatic bleach-whitening method when compared to the fabric treated in accordance with the conventional method.
Table 5: Degree of whiteness
Superior full white effects are achieved when the fabric is treated in accordance with the enzymatic bleach-whitening method when compared to the fabric treated in accordance with the conventional method.
Table 6: Degree of whiteness
Superior full white effects are achieved when the fabric is treated in accordance with the enzymatic bleach-whitening method when compared to the fabric treated in accordance with the conventional method.
Claims
1. A method for bleach-whitening of synthetic textile material comprising contacting said textile material with
(a) an enzymatic textile bleaching composition comprising (i) a perhydrolase enzyme,
(ii) an ester substrate for said perhydrolase enzyme,
(iii) a hydrogen peroxide source,
(iv) a surfactant and/or an emulsifier,
(v) a peroxide stabilizer,
(vi) a sequestering agent,
(vii) a buffer which maintains a pH of about 6 to about 8, and
(b) at least one fluorescent whitening agent, and, optionally,
(c) at least one acid or disperse shading dye for shaded variations of white, for a length of time and under conditions suitable to permit measurable whitening of the textile material, thereby producing a bleached-whitened textile material.
2. A method according to claim 1 , wherein said perhydrolase enzyme comprises the amino acid sequence set forth in SEQ ID NO:1 or a variant or homolog thereof.
3. A method according to either claim 1 or 2, wherein said perhydrolase enzyme is the S54V variant of SEQ ID NO:1.
4. A method according to any one of claims 1 to 3, wherein said perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio greater than 1.
5. A method according to any one of claims 1 to 4, wherein said ester substrate is selected from propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate, for example, propylene glycol diacetate.
6. A method according to any one of claims 1 to 5, wherein said hydrogen peroxide source is hydrogen peroxide.
7. A method according to any one of claims 1 to 6, wherein said surfactant and/or emulsifier comprises a non-ionic surfactant, for example, a fatty alcohol ethoxylate or isotridecanol ethoxylate.
8. A method according to any one of claims 1 to 7, wherein said peroxide stabilizer is phosphonic acid.
9. A method according to any one of claims 1 to 8, wherein said sequestering agent is polyacrylic acid.
10. A method according to any one of claims 1 to 9, wherein the fluorescent whitening agent is selected from the group comprising: a distyryl biphenyl derivative of the formula
in which
M is hydrogen, lithium, sodium, potassium, ammonium or ammonium that is mono-, di-, tri- or tetra-substituted by Ci-C6alkyl or C2-C6hydroxyalkyl which may be interrupted by an oxygen atom or a mixture thereof, and
Ri and R2 independently of one another are hydrogen, d-C6alkyl, d-C6alkoxy or halogen; a triazolyl stilbene disulfonic acid derivative of the formula
in which
M is defined as given above; a diamino stilbene derivative of the formula in which
M is is defined as given above, and
R3 and R4 independently of one another are CrC4alkoxy, Ci-C4alkylthio, substituted or unsubstituted amino or an N-heterocycle which may contain further heteroatoms; a diphenyl pyrazoline derivative of the formula
in which
M is defined as given above, and
R5 and R6 independently of one another are hydrogen, Ci-C4alkyl, Ci-C4alkoxy or halogen; a diphenyl pyrazoline derivative of the formula
in which
M is defined as given above; a coumarine derivative of the formula a benzoxazole derivative of the formula
in which
B is a radical of formula -CH=CH-, 2,5-thiophenylene or 1 ,4-naphthylene, and
R7 and Rs independently of one another are hydrogen, Ci-C4alkyl, Ci-C4alkoxy or halogen; and a dicyanstyrylbenzene derivative of the formula
1 1. A method according to any one of claims 1 to 10, wherein the fluorescent whitening agent is selected from the group of a distyryl biphenyl derivative of the formula
in which M is hydrogen, lithium, sodium, potassium, ammonium or ammonium that is mono-, di-, tri- or tetra-substituted by C-i-Cβalkyl or C2-Cehydroxyalkyl which may be interrupted by an oxygen atom or a mixture thereof; and a triazolyl stilbene disulfonic acid derivative of the formula
in which
M is defined as given above.
12. A method according to any one of claims 1 to 1 1 , further comprising hydrolyzing said hydrogen peroxide with a catalase enzyme after said bleached textile is produced.
13. A method according to any one of claims 1 to 12, wherein the liquor ratio is about 20:1 or 10:1.
14. A method according to any one of claims 1 to 13, wherein said method is performed in a process selected from a batch process, an exhaust process, and a discontinuous process.
15. A method according to any one of claims 1 to 14, wherein the textile material is contacted with the enzymatic textile bleaching composition at a bleaching temperature of about 600C to about 700C, for example 65°C, for a processing time of about 40 to about 60 minutes, for example 50 minutes.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP10705848A EP2403990A2 (en) | 2009-03-06 | 2010-02-17 | Enzymatic textile bleach-whitening methods |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09154519 | 2009-03-06 | ||
| PCT/EP2010/051953 WO2010100028A2 (en) | 2009-03-06 | 2010-02-17 | Enzymatic textile bleach-whitening methods |
| EP10705848A EP2403990A2 (en) | 2009-03-06 | 2010-02-17 | Enzymatic textile bleach-whitening methods |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2403990A2 true EP2403990A2 (en) | 2012-01-11 |
Family
ID=42710049
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP10705848A Withdrawn EP2403990A2 (en) | 2009-03-06 | 2010-02-17 | Enzymatic textile bleach-whitening methods |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20110302724A1 (en) |
| EP (1) | EP2403990A2 (en) |
| CN (1) | CN102333914A (en) |
| BR (1) | BRPI1013219A2 (en) |
| CO (1) | CO6362055A2 (en) |
| MX (1) | MX2011008656A (en) |
| TW (1) | TW201035407A (en) |
| WO (1) | WO2010100028A2 (en) |
Families Citing this family (258)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FI20085345A7 (en) * | 2008-04-22 | 2009-10-23 | Kemira Oyj | Method for reducing light-induced yellowing of lignin-containing material |
| CN103957929B (en) | 2011-11-25 | 2017-06-30 | 诺维信公司 | Polypeptides having lysozyme activity and polynucleotides encoding said polypeptides |
| CN110777016A (en) | 2011-12-29 | 2020-02-11 | 诺维信公司 | Detergent compositions with lipase variants |
| CN104350149A (en) | 2012-01-26 | 2015-02-11 | 诺维信公司 | Use of polypeptides having protease activity in animal feed and detergents |
| CN107988181A (en) | 2012-04-02 | 2018-05-04 | 诺维信公司 | Lipase Variant and the polynucleotides for encoding it |
| AR090971A1 (en) | 2012-05-07 | 2014-12-17 | Novozymes As | POLYPEPTIDES THAT HAVE XANTANE DEGRADATION ACTIVITY AND POLYCINOCYLODES THAT CODE THEM |
| US20150132831A1 (en) | 2012-05-16 | 2015-05-14 | Novozymes A/S | Compositions Comprising Lipase and Methods of Use Thereof |
| BR112014031882A2 (en) | 2012-06-20 | 2017-08-01 | Novozymes As | use of an isolated polypeptide, polypeptide, composition, isolated polynucleotide, nucleic acid construct or expression vector, recombinant expression host cell, methods for producing a polypeptide, for enhancing the nutritional value of an animal feed, and for the treatment of protein, use of at least one polypeptide, animal feed additive, animal feed, and detergent composition |
| PT3553172T (en) | 2012-08-16 | 2023-01-27 | Novozymes As | Method for treating textile with endoglucanase |
| TR201910918T4 (en) | 2012-12-07 | 2019-08-21 | Novozymes As | Prevention of bacterial adhesion. |
| EP2934177B1 (en) | 2012-12-21 | 2017-10-25 | Novozymes A/S | Polypeptides having protease activiy and polynucleotides encoding same |
| EP2941485B1 (en) | 2013-01-03 | 2018-02-21 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
| WO2014147127A1 (en) | 2013-03-21 | 2014-09-25 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
| CN103194890A (en) * | 2013-04-24 | 2013-07-10 | 太仓市其盛化纤厂 | Pretreatment method of cotton fabric |
| EP4717756A2 (en) | 2013-05-14 | 2026-04-01 | Novozymes A/S | Lipase variants and detergent compositions |
| CN105209613A (en) | 2013-05-17 | 2015-12-30 | 诺维信公司 | Polypeptides having alpha amylase activity |
| EP3004315A2 (en) | 2013-06-06 | 2016-04-13 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
| US10378001B2 (en) | 2013-06-27 | 2019-08-13 | Novozymes A/S | Subtilase variants and compositions comprising same |
| US20160145596A1 (en) | 2013-06-27 | 2016-05-26 | Novozymes A/S | Subtilase Variants and Polynucleotides Encoding Same |
| RU2015156280A (en) | 2013-07-04 | 2017-08-09 | Новозимс А/С | POLYEPEPTIDES HAVING AN EFFECT AGAINST RESETITATION AND POLYNUCLEOTIDES CODING THEM |
| WO2015004102A1 (en) | 2013-07-09 | 2015-01-15 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
| WO2015014803A1 (en) | 2013-07-29 | 2015-02-05 | Novozymes A/S | Protease variants and polynucleotides encoding same |
| CN105358686A (en) | 2013-07-29 | 2016-02-24 | 诺维信公司 | Protease variants and polynucleotides encoding same |
| WO2015049370A1 (en) | 2013-10-03 | 2015-04-09 | Novozymes A/S | Detergent composition and use of detergent composition |
| EP3453757B1 (en) | 2013-12-20 | 2020-06-17 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
| US10208297B2 (en) | 2014-01-22 | 2019-02-19 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same for cleaning |
| EP3097174A1 (en) * | 2014-01-22 | 2016-11-30 | The Procter & Gamble Company | Method of treating textile fabrics |
| EP3097175B1 (en) * | 2014-01-22 | 2018-10-17 | The Procter and Gamble Company | Fabric treatment composition |
| CN106062271A (en) | 2014-03-05 | 2016-10-26 | 诺维信公司 | Compositions and methods for improving properties of cellulosic textile materials with xyloglucan endotransglycosylase |
| WO2015134729A1 (en) | 2014-03-05 | 2015-09-11 | Novozymes A/S | Compositions and methods for improving properties of non-cellulosic textile materials with xyloglucan endotransglycosylase |
| EP3521434A1 (en) | 2014-03-12 | 2019-08-07 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
| US20170015950A1 (en) | 2014-04-01 | 2017-01-19 | Novozymes A/S | Polypeptides having alpha amylase activity |
| MX376770B (en) | 2014-04-11 | 2025-03-07 | Novozymes As | Detergent composition |
| WO2015158237A1 (en) | 2014-04-15 | 2015-10-22 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
| WO2017186943A1 (en) | 2016-04-29 | 2017-11-02 | Novozymes A/S | Detergent compositions and uses thereof |
| WO2015181118A1 (en) | 2014-05-27 | 2015-12-03 | Novozymes A/S | Methods for producing lipases |
| AR100606A1 (en) | 2014-05-27 | 2016-10-19 | Novozymes As | VARIANTS OF LIPASES AND POLINUCLEOTIDES CODING THEM |
| WO2015189371A1 (en) | 2014-06-12 | 2015-12-17 | Novozymes A/S | Alpha-amylase variants and polynucleotides encoding same |
| US10550381B2 (en) | 2014-07-04 | 2020-02-04 | Novozymes A/S | Variant proteases and amylases having enhanced storage stability |
| EP3739029A1 (en) | 2014-07-04 | 2020-11-18 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
| WO2016079110A2 (en) | 2014-11-19 | 2016-05-26 | Novozymes A/S | Use of enzyme for cleaning |
| WO2016079305A1 (en) | 2014-11-20 | 2016-05-26 | Novozymes A/S | Alicyclobacillus variants and polynucleotides encoding same |
| CA2963331C (en) | 2014-12-04 | 2024-09-10 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
| US10260024B2 (en) | 2014-12-04 | 2019-04-16 | Novozymes A/S | Liquid cleaning compositions comprising protease variants |
| WO2016087401A1 (en) | 2014-12-05 | 2016-06-09 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
| EP4530348A3 (en) | 2014-12-15 | 2025-08-06 | Basf Se | Detergent composition comprising subtilase variants |
| CN107002049A (en) | 2014-12-16 | 2017-08-01 | 诺维信公司 | Polypeptide with N acerylglucosamine oxidase actives |
| US11518987B2 (en) | 2014-12-19 | 2022-12-06 | Novozymes A/S | Protease variants and polynucleotides encoding same |
| US10400230B2 (en) | 2014-12-19 | 2019-09-03 | Novozymes A/S | Protease variants and polynucleotides encoding same |
| WO2016164596A2 (en) | 2015-04-07 | 2016-10-13 | Novozymes A/S | Methods for selecting enzymes having lipase activity |
| CN107636134A (en) | 2015-04-10 | 2018-01-26 | 诺维信公司 | Detergent composition |
| US20180112156A1 (en) | 2015-04-10 | 2018-04-26 | Novozymes A/S | Laundry method, use of polypeptide and detergent composition |
| EP3298121B1 (en) | 2015-05-19 | 2019-03-20 | Novozymes A/S | Odor reduction |
| US10858637B2 (en) | 2015-06-16 | 2020-12-08 | Novozymes A/S | Polypeptides with lipase activity and polynucleotides encoding same |
| EP3310688A1 (en) | 2015-06-17 | 2018-04-25 | Novozymes A/S | Container |
| EP3106508B1 (en) | 2015-06-18 | 2019-11-20 | Henkel AG & Co. KGaA | Detergent composition comprising subtilase variants |
| EP4071244A1 (en) | 2015-06-18 | 2022-10-12 | Novozymes A/S | Subtilase variants and polynucleotides encoding same |
| CN107922896A (en) | 2015-06-30 | 2018-04-17 | 诺维信公司 | Laundry detergent composition, for washing method and composition purposes |
| MX394221B (en) | 2015-07-01 | 2025-03-24 | Novozymes As | ODOR REDUCTION METHODS. |
| EP3950939A3 (en) | 2015-07-06 | 2022-06-08 | Novozymes A/S | Lipase variants and polynucleotides encoding same |
| US11053486B2 (en) | 2015-09-17 | 2021-07-06 | Henkel Ag & Co. Kgaa | Detergent compositions comprising polypeptides having xanthan degrading activity |
| CA2991114A1 (en) | 2015-09-17 | 2017-03-23 | Novozymes A/S | Polypeptides having xanthan degrading activity and polynucleotides encoding same |
| EP3359657B1 (en) | 2015-10-07 | 2020-04-01 | Novozymes A/S | Polypeptides |
| EP3362558A1 (en) | 2015-10-14 | 2018-08-22 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
| EP4324919A3 (en) | 2015-10-14 | 2024-05-29 | Novozymes A/S | Polypeptide variants |
| CN108291178B (en) | 2015-10-28 | 2020-08-04 | 诺维信公司 | Detergent compositions comprising amylase and protease variants |
| WO2017089366A1 (en) | 2015-11-24 | 2017-06-01 | Novozymes A/S | Polypeptides having protease activity and polynucleotides encoding same |
| WO2017093318A1 (en) | 2015-12-01 | 2017-06-08 | Novozymes A/S | Methods for producing lipases |
| WO2017162836A1 (en) | 2016-03-23 | 2017-09-28 | Novozymes A/S | Use of polypeptide having dnase activity for treating fabrics |
| EP3440180B1 (en) | 2016-04-08 | 2020-11-11 | Novozymes A/S | Detergent compositions and uses of the same |
| CN109715792A (en) | 2016-06-03 | 2019-05-03 | 诺维信公司 | Subtilase variants and the polynucleotides that it is encoded |
| EP3475404A1 (en) | 2016-06-23 | 2019-05-01 | Novozymes A/S | Use of enzymes, composition and method for removing soil |
| US11203732B2 (en) | 2016-06-30 | 2021-12-21 | Novozymes A/S | Lipase variants and compositions comprising surfactant and lipase variant |
| WO2018002261A1 (en) | 2016-07-01 | 2018-01-04 | Novozymes A/S | Detergent compositions |
| US10662417B2 (en) | 2016-07-05 | 2020-05-26 | Novozymes A/S | Pectate lyase variants and polynucleotides encoding same |
| WO2018007573A1 (en) | 2016-07-08 | 2018-01-11 | Novozymes A/S | Detergent compositions with galactanase |
| CA3027272C (en) | 2016-07-13 | 2022-06-21 | The Procter & Gamble Company | Bacillus cibi dnase variants and uses thereof |
| EP3485008B1 (en) | 2016-07-18 | 2024-01-31 | Novozymes A/S | Lipase variants, polynucleotides encoding same and the use thereof |
| US11512300B2 (en) | 2016-08-24 | 2022-11-29 | Novozymes A/S | Xanthan lyase variants and polynucleotides encoding same |
| CN109563498A (en) | 2016-08-24 | 2019-04-02 | 汉高股份有限及两合公司 | Detergent composition comprising xanthan lyase variant I |
| WO2018037065A1 (en) | 2016-08-24 | 2018-03-01 | Henkel Ag & Co. Kgaa | Detergent composition comprising gh9 endoglucanase variants i |
| CA3031609A1 (en) | 2016-08-24 | 2018-03-01 | Novozymes A/S | Gh9 endoglucanase variants and polynucleotides encoding same |
| CN110023474A (en) | 2016-09-29 | 2019-07-16 | 诺维信公司 | Purposes, washing methods and utensil washing composition of the enzyme for washing |
| US20210284933A1 (en) | 2016-10-25 | 2021-09-16 | Novozymes A/S | Detergent compositions |
| CN110072986B (en) | 2016-11-01 | 2023-04-04 | 诺维信公司 | Multi-core particles |
| MX2019006425A (en) | 2016-12-01 | 2019-08-14 | Basf Se | Stabilization of enzymes in compositions. |
| EP3551740B1 (en) | 2016-12-12 | 2021-08-11 | Novozymes A/S | Use of polypeptides |
| US11149233B2 (en) | 2017-03-31 | 2021-10-19 | Novozymes A/S | Polypeptides having RNase activity |
| WO2018177936A1 (en) | 2017-03-31 | 2018-10-04 | Novozymes A/S | Polypeptides having dnase activity |
| US11208639B2 (en) | 2017-03-31 | 2021-12-28 | Novozymes A/S | Polypeptides having DNase activity |
| CN110651040A (en) | 2017-03-31 | 2020-01-03 | 诺维信公司 | Polypeptides with DNase activity |
| EP3607040A1 (en) | 2017-04-04 | 2020-02-12 | Novozymes A/S | Polypeptide compositions and uses thereof |
| EP3607039A1 (en) | 2017-04-04 | 2020-02-12 | Novozymes A/S | Polypeptides |
| CN114480034A (en) | 2017-04-04 | 2022-05-13 | 诺维信公司 | Glycosyl hydrolase |
| ES2728758T3 (en) | 2017-04-05 | 2019-10-28 | Henkel Ag & Co Kgaa | Detergent compositions comprising bacterial mannanas |
| EP3385362A1 (en) | 2017-04-05 | 2018-10-10 | Henkel AG & Co. KGaA | Detergent compositions comprising fungal mannanases |
| US20200190438A1 (en) | 2017-04-06 | 2020-06-18 | Novozymes A/S | Cleaning compositions and uses thereof |
| WO2018185269A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
| EP3607044B1 (en) | 2017-04-06 | 2024-11-13 | Novozymes A/S | Cleaning compositions and uses thereof |
| WO2018184816A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
| MX2019011764A (en) | 2017-04-06 | 2019-11-28 | Novozymes As | Cleaning compositions and uses thereof. |
| WO2018184818A1 (en) | 2017-04-06 | 2018-10-11 | Novozymes A/S | Cleaning compositions and uses thereof |
| EP3478811B1 (en) | 2017-04-06 | 2019-10-16 | Novozymes A/S | Cleaning compositions and uses thereof |
| EP3967756B1 (en) | 2017-04-06 | 2025-03-05 | Novozymes A/S | Detergent compositions and uses thereof |
| WO2018202846A1 (en) | 2017-05-05 | 2018-11-08 | Novozymes A/S | Compositions comprising lipase and sulfite |
| WO2018206535A1 (en) | 2017-05-08 | 2018-11-15 | Novozymes A/S | Carbohydrate-binding domain and polynucleotides encoding the same |
| EP3401385A1 (en) | 2017-05-08 | 2018-11-14 | Henkel AG & Co. KGaA | Detergent composition comprising polypeptide comprising carbohydrate-binding domain |
| US20210130744A1 (en) | 2017-08-24 | 2021-05-06 | Henkel Ag & Co. Kgaa | Detergent composition comprising xanthan lyase variants ii |
| US11624059B2 (en) | 2017-08-24 | 2023-04-11 | Henkel Ag & Co. Kgaa | Detergent compositions comprising GH9 endoglucanase variants II |
| CA3070749A1 (en) | 2017-08-24 | 2019-02-28 | Novozymes A/S | Gh9 endoglucanase variants and polynucleotides encoding same |
| US11359188B2 (en) | 2017-08-24 | 2022-06-14 | Novozymes A/S | Xanthan lyase variants and polynucleotides encoding same |
| WO2019057758A1 (en) | 2017-09-20 | 2019-03-28 | Novozymes A/S | Use of enzymes for improving water absorption and/or whiteness |
| EP3684899A1 (en) | 2017-09-22 | 2020-07-29 | Novozymes A/S | Novel polypeptides |
| EP4567094A3 (en) | 2017-09-27 | 2026-01-07 | Novozymes A/S | Lipase variants and microcapsule compositions comprising such lipase variants |
| JP7114697B2 (en) | 2017-09-27 | 2022-08-08 | ザ プロクター アンド ギャンブル カンパニー | Detergent composition containing lipase |
| EP3697881B1 (en) | 2017-10-16 | 2024-12-18 | Novozymes A/S | Low dusting granules |
| WO2019076800A1 (en) | 2017-10-16 | 2019-04-25 | Novozymes A/S | Cleaning compositions and uses thereof |
| CN111542589A (en) | 2017-10-16 | 2020-08-14 | 诺维信公司 | Low powdering particles |
| HUE057832T2 (en) | 2017-10-27 | 2022-06-28 | Procter & Gamble | Detergent compositions comprising polypeptide variants |
| EP3701017A1 (en) | 2017-10-27 | 2020-09-02 | Novozymes A/S | Dnase variants |
| EP3704240A1 (en) | 2017-11-01 | 2020-09-09 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
| DE102017125558A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANING COMPOSITIONS CONTAINING DISPERSINE I |
| EP3704220B1 (en) | 2017-11-01 | 2026-04-15 | Novozymes A/S | Methods for cleaning medical devices |
| DE102017125559A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANSING COMPOSITIONS CONTAINING DISPERSINE II |
| WO2019086530A1 (en) | 2017-11-01 | 2019-05-09 | Novozymes A/S | Polypeptides and compositions comprising such polypeptides |
| DE102017125560A1 (en) | 2017-11-01 | 2019-05-02 | Henkel Ag & Co. Kgaa | CLEANSING COMPOSITIONS CONTAINING DISPERSINE III |
| CN111465680A (en) | 2017-11-29 | 2020-07-28 | 巴斯夫欧洲公司 | Compositions, their preparation and use |
| CN111670248A (en) | 2017-12-04 | 2020-09-15 | 诺维信公司 | Lipase variants and polynucleotides encoding the same |
| JP7309718B2 (en) | 2017-12-20 | 2023-07-18 | ビーエーエスエフ ソシエタス・ヨーロピア | Laundry formulation for removing fatty compounds with a melting temperature above 30° C. on textiles |
| US20210102184A1 (en) | 2018-02-23 | 2021-04-08 | Henkel Ag & Co. Kgaa | Detergent composition comprising xanthan lyase and endoglucanase variants |
| WO2019180111A1 (en) | 2018-03-23 | 2019-09-26 | Novozymes A/S | Subtilase variants and compositions comprising same |
| EP3781660A1 (en) | 2018-04-17 | 2021-02-24 | Novozymes A/S | Polypeptides comprising carbohydrate binding activity in detergent compositions and their use in reducing wrinkles in textile or fabric |
| CN111989389A (en) | 2018-04-19 | 2020-11-24 | 巴斯夫欧洲公司 | Compositions and polymers useful in the compositions |
| EP3781680A1 (en) | 2018-04-19 | 2021-02-24 | Novozymes A/S | Stabilized cellulase variants |
| CN118460512A (en) | 2018-04-19 | 2024-08-09 | 诺维信公司 | Stabilized cellulase variants |
| CN108914542A (en) * | 2018-05-15 | 2018-11-30 | 周晓东 | A kind of fabric bleaching agent |
| WO2019238761A1 (en) | 2018-06-15 | 2019-12-19 | Basf Se | Water soluble multilayer films containing wash active chemicals and enzymes |
| EP3814472A1 (en) | 2018-06-28 | 2021-05-05 | Novozymes A/S | Detergent compositions and uses thereof |
| WO2020002255A1 (en) | 2018-06-29 | 2020-01-02 | Novozymes A/S | Subtilase variants and compositions comprising same |
| EP3814473A1 (en) | 2018-06-29 | 2021-05-05 | Novozymes A/S | Detergent compositions and uses thereof |
| US12012573B2 (en) | 2018-07-02 | 2024-06-18 | Novozymes A/S | Cleaning compositions and uses thereof |
| EP3818138B1 (en) | 2018-07-03 | 2025-05-14 | Henkel AG & Co. KGaA | Cleaning compositions and uses thereof |
| EP3818140A1 (en) | 2018-07-06 | 2021-05-12 | Novozymes A/S | Cleaning compositions and uses thereof |
| WO2020008024A1 (en) | 2018-07-06 | 2020-01-09 | Novozymes A/S | Cleaning compositions and uses thereof |
| WO2020030623A1 (en) | 2018-08-10 | 2020-02-13 | Basf Se | Packaging unit comprising a detergent composition containing an enzyme and at least one chelating agent |
| WO2020070063A2 (en) | 2018-10-01 | 2020-04-09 | Novozymes A/S | Detergent compositions and uses thereof |
| WO2020070014A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition comprising anionic surfactant and a polypeptide having rnase activity |
| WO2020070209A1 (en) | 2018-10-02 | 2020-04-09 | Novozymes A/S | Cleaning composition |
| EP3861094A1 (en) | 2018-10-02 | 2021-08-11 | Novozymes A/S | Cleaning composition |
| WO2020070199A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same |
| WO2020070249A1 (en) | 2018-10-03 | 2020-04-09 | Novozymes A/S | Cleaning compositions |
| CN112805377A (en) | 2018-10-05 | 2021-05-14 | 巴斯夫欧洲公司 | Compounds for stabilizing amylases in liquids |
| US20210395651A1 (en) | 2018-10-05 | 2021-12-23 | Basf Se | Compounds stabilizing hydrolases in liquids |
| EP3677676A1 (en) | 2019-01-03 | 2020-07-08 | Basf Se | Compounds stabilizing amylases in liquids |
| BR112021005412A2 (en) | 2018-10-05 | 2021-06-15 | Basf Se | enzyme preparation, process for making a stable enzyme preparation, methods for reducing loss of proteolytic activity, for preparing a detergent formulation, for removing stains and for increasing the storage stability of a liquid detergent formulation, uses of a compound and of enzyme preparation, and, detergent formulation |
| EP3864122A1 (en) | 2018-10-09 | 2021-08-18 | Novozymes A/S | Cleaning compositions and uses thereof |
| EP3864123A1 (en) | 2018-10-09 | 2021-08-18 | Novozymes A/S | Cleaning compositions and uses thereof |
| CN112996894A (en) | 2018-10-11 | 2021-06-18 | 诺维信公司 | Cleaning composition and use thereof |
| EP3647397A1 (en) | 2018-10-31 | 2020-05-06 | Henkel AG & Co. KGaA | Cleaning compositions containing dispersins iv |
| EP3647398B1 (en) | 2018-10-31 | 2024-05-15 | Henkel AG & Co. KGaA | Cleaning compositions containing dispersins v |
| WO2020104231A1 (en) | 2018-11-19 | 2020-05-28 | Basf Se | Powders and granules containing a chelating agent and an enzyme |
| CN113302270A (en) | 2018-12-03 | 2021-08-24 | 诺维信公司 | Low pH powder detergent compositions |
| EP3891277A1 (en) | 2018-12-03 | 2021-10-13 | Novozymes A/S | Powder detergent compositions |
| CN113366103A (en) | 2018-12-21 | 2021-09-07 | 诺维信公司 | Polypeptides having peptidoglycan degrading activity and polynucleotides encoding same |
| EP3898919A1 (en) | 2018-12-21 | 2021-10-27 | Novozymes A/S | Detergent pouch comprising metalloproteases |
| EP3702452A1 (en) | 2019-03-01 | 2020-09-02 | Novozymes A/S | Detergent compositions comprising two proteases |
| CN113544246A (en) | 2019-03-08 | 2021-10-22 | 巴斯夫欧洲公司 | Cationic surfactants and their use in laundry detergent compositions |
| JP7725365B2 (en) | 2019-03-21 | 2025-08-19 | ノボザイムス アクティーゼルスカブ | α-Amylase variants and polynucleotides encoding same |
| CN110042647B (en) * | 2019-04-02 | 2022-02-18 | 嘉兴学院 | High-whiteness low-temperature bleaching method for cashmere or wool |
| WO2020201403A1 (en) | 2019-04-03 | 2020-10-08 | Novozymes A/S | Polypeptides having beta-glucanase activity, polynucleotides encoding same and uses thereof in cleaning and detergent compositions |
| US12247237B2 (en) | 2019-04-10 | 2025-03-11 | Novozymes A/S | Polypeptide variants |
| WO2020208056A1 (en) | 2019-04-12 | 2020-10-15 | Novozymes A/S | Stabilized glycoside hydrolase variants |
| WO2020229480A1 (en) | 2019-05-14 | 2020-11-19 | Basf Se | Compounds stabilizing hydrolases in liquids |
| EP3997202A1 (en) | 2019-07-12 | 2022-05-18 | Novozymes A/S | Enzymatic emulsions for detergents |
| CN114787329A (en) | 2019-08-27 | 2022-07-22 | 诺维信公司 | Detergent composition |
| WO2021037878A1 (en) | 2019-08-27 | 2021-03-04 | Novozymes A/S | Composition comprising a lipase |
| EP4031644A1 (en) | 2019-09-19 | 2022-07-27 | Novozymes A/S | Detergent composition |
| WO2021064068A1 (en) | 2019-10-03 | 2021-04-08 | Novozymes A/S | Polypeptides comprising at least two carbohydrate binding domains |
| BR112022006082A2 (en) | 2019-10-18 | 2022-06-21 | Basf Se | Enzyme preparation, detergent formulation, and use of at least one diol |
| WO2021105336A1 (en) | 2019-11-29 | 2021-06-03 | Basf Se | Compositions comprising polymer and enzyme |
| WO2021115912A1 (en) | 2019-12-09 | 2021-06-17 | Basf Se | Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes |
| AU2020405786A1 (en) | 2019-12-20 | 2022-08-11 | Henkel Ag & Co. Kgaa | Cleaning compositions comprising dispersins IX |
| WO2021122120A2 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning compositions comprising dispersins viii |
| US20220411773A1 (en) | 2019-12-20 | 2022-12-29 | Novozymes A/S | Polypeptides having proteolytic activity and use thereof |
| WO2021122117A1 (en) | 2019-12-20 | 2021-06-24 | Henkel Ag & Co. Kgaa | Cleaning composition coprising a dispersin and a carbohydrase |
| KR20220119609A (en) | 2019-12-20 | 2022-08-30 | 헨켈 아게 운트 코. 카게아아 | Cleaning Composition Comprising Dispersin VI |
| EP4077617B1 (en) | 2019-12-20 | 2026-03-18 | Novozymes A/S | Stabilized liquid boron-free enzyme compositions |
| WO2021130167A1 (en) | 2019-12-23 | 2021-07-01 | Novozymes A/S | Enzyme compositions and uses thereof |
| WO2021148364A1 (en) | 2020-01-23 | 2021-07-29 | Novozymes A/S | Enzyme compositions and uses thereof |
| WO2021152120A1 (en) | 2020-01-31 | 2021-08-05 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| EP4097227A1 (en) | 2020-01-31 | 2022-12-07 | Novozymes A/S | Mannanase variants and polynucleotides encoding same |
| EP3892708A1 (en) | 2020-04-06 | 2021-10-13 | Henkel AG & Co. KGaA | Cleaning compositions comprising dispersin variants |
| WO2021204838A1 (en) | 2020-04-08 | 2021-10-14 | Novozymes A/S | Carbohydrate binding module variants |
| US20230167384A1 (en) | 2020-04-21 | 2023-06-01 | Novozymes A/S | Cleaning compositions comprising polypeptides having fructan degrading activity |
| EP4158011A1 (en) | 2020-05-26 | 2023-04-05 | Novozymes A/S | Subtilase variants and compositions comprising same |
| EP4172298A1 (en) | 2020-06-24 | 2023-05-03 | Novozymes A/S | Use of cellulases for removing dust mite from textile |
| EP3936593A1 (en) | 2020-07-08 | 2022-01-12 | Henkel AG & Co. KGaA | Cleaning compositions and uses thereof |
| WO2022008732A1 (en) | 2020-07-10 | 2022-01-13 | Basf Se | Enhancing the activity of antimicrobial preservatives |
| EP4204551B1 (en) | 2020-08-25 | 2025-09-17 | Novozymes A/S | Variants of a family 44 xyloglucanase |
| WO2022043563A1 (en) | 2020-08-28 | 2022-03-03 | Novozymes A/S | Polyester degrading protease variants |
| MX2023003275A (en) | 2020-09-22 | 2023-04-12 | Basf Se | Improved combination of protease and protease inhibitor with secondary enzyme. |
| US20250346879A1 (en) | 2020-10-07 | 2025-11-13 | Novozymes A/S | Alpha-amylase variants |
| WO2022084303A2 (en) | 2020-10-20 | 2022-04-28 | Novozymes A/S | Use of polypeptides having dnase activity |
| WO2022090320A1 (en) | 2020-10-28 | 2022-05-05 | Novozymes A/S | Use of lipoxygenase |
| JP2023547450A (en) | 2020-10-29 | 2023-11-10 | ノボザイムス アクティーゼルスカブ | Lipase variants and compositions comprising such lipase variants |
| EP4244325A1 (en) | 2020-11-13 | 2023-09-20 | Novozymes A/S | Detergent composition comprising a lipase |
| WO2022106400A1 (en) | 2020-11-18 | 2022-05-27 | Novozymes A/S | Combination of immunochemically different proteases |
| WO2022106404A1 (en) | 2020-11-18 | 2022-05-27 | Novozymes A/S | Combination of proteases |
| EP4032966A1 (en) | 2021-01-22 | 2022-07-27 | Novozymes A/S | Liquid enzyme composition with sulfite scavenger |
| US20240124805A1 (en) | 2021-01-28 | 2024-04-18 | Novozymes A/S | Lipase with low malodor generation |
| EP4039806A1 (en) | 2021-02-04 | 2022-08-10 | Henkel AG & Co. KGaA | Detergent composition comprising xanthan lyase and endoglucanase variants with im-proved stability |
| EP4291646A2 (en) | 2021-02-12 | 2023-12-20 | Novozymes A/S | Alpha-amylase variants |
| US20250075152A1 (en) | 2021-02-12 | 2025-03-06 | Novozymes A/S | Stabilized biological detergents |
| EP4305146A1 (en) | 2021-03-12 | 2024-01-17 | Novozymes A/S | Polypeptide variants |
| EP4060036A1 (en) | 2021-03-15 | 2022-09-21 | Novozymes A/S | Polypeptide variants |
| WO2022194673A1 (en) | 2021-03-15 | 2022-09-22 | Novozymes A/S | Dnase variants |
| WO2022199418A1 (en) | 2021-03-26 | 2022-09-29 | Novozymes A/S | Detergent composition with reduced polymer content |
| EP4359518A1 (en) | 2021-06-23 | 2024-05-01 | Novozymes A/S | Alpha-amylase polypeptides |
| CN118871559A (en) | 2021-12-21 | 2024-10-29 | 诺维信公司 | Composition comprising lipase and a enhancer |
| EP4206309A1 (en) | 2021-12-30 | 2023-07-05 | Novozymes A/S | Protein particles with improved whiteness |
| EP4234664A1 (en) | 2022-02-24 | 2023-08-30 | Evonik Operations GmbH | Composition comprising glucolipids and enzymes |
| US20250179393A1 (en) | 2022-03-02 | 2025-06-05 | Novozymes A/S | Use of xyloglucanase for improvement of sustainability of detergents |
| WO2023165950A1 (en) | 2022-03-04 | 2023-09-07 | Novozymes A/S | Dnase variants and compositions |
| EP4504885A1 (en) | 2022-04-08 | 2025-02-12 | Novozymes A/S | Hexosaminidase variants and compositions |
| DE102022205593A1 (en) | 2022-06-01 | 2023-12-07 | Henkel Ag & Co. Kgaa | DETERGENT AND CLEANING AGENTS WITH IMPROVED ENZYME STABILITY |
| DE102022205591A1 (en) | 2022-06-01 | 2023-12-07 | Henkel Ag & Co. Kgaa | DETERGENT AND CLEANING AGENTS WITH IMPROVED ENZYME STABILITY |
| DE102022205588A1 (en) | 2022-06-01 | 2023-12-07 | Henkel Ag & Co. Kgaa | DETERGENT AND CLEANING AGENTS WITH IMPROVED ENZYME STABILITY |
| EP4544015A2 (en) | 2022-06-24 | 2025-04-30 | Novozymes A/S | Lipase variants and compositions comprising such lipase variants |
| EP4324900A1 (en) | 2022-08-17 | 2024-02-21 | Henkel AG & Co. KGaA | Detergent composition comprising enzymes |
| DE102022131732A1 (en) | 2022-11-30 | 2024-06-06 | Henkel Ag & Co. Kgaa | Improved washing performance through the use of a protease fused with a special adhesion promoter peptide |
| EP4630529A1 (en) | 2022-12-05 | 2025-10-15 | Novozymes A/S | A composition comprising a lipase and a peptide |
| JP2026508744A (en) | 2022-12-05 | 2026-03-12 | ノボザイムス アクティーゼルスカブ | Protease variants and the polynucleotides that encode them |
| CN120265743A (en) | 2022-12-14 | 2025-07-04 | 诺维信公司 | Improved lipase (GCL1) variants |
| CN120344647A (en) | 2022-12-23 | 2025-07-18 | 诺维信公司 | Detergent composition comprising catalase and amylase |
| EP4655371A1 (en) | 2023-01-23 | 2025-12-03 | Novozymes A/S | Cleaning compositions and uses thereof |
| EP4410938A1 (en) | 2023-02-02 | 2024-08-07 | AMSilk GmbH | Automatic dishwashing composition comprising a structural polypeptide |
| EP4683990A1 (en) | 2023-03-21 | 2026-01-28 | Novozymes A/S | Detergent compositions based on biosurfactants |
| WO2024213513A1 (en) | 2023-04-12 | 2024-10-17 | Novozymes A/S | Compositions comprising polypeptides having alkaline phosphatase activity |
| EP4461795A1 (en) | 2023-05-10 | 2024-11-13 | Novozymes A/S | Detergent composition comprising laccase |
| EP4461796A1 (en) | 2023-05-10 | 2024-11-13 | Novozymes A/S | Detergent composition comprising laccase |
| WO2025002934A1 (en) | 2023-06-28 | 2025-01-02 | Novozymes A/S | Detergent composition comprising lipases |
| WO2025036643A1 (en) | 2023-08-15 | 2025-02-20 | Evonik Operations Gmbh | Biosurfactant for washing wool |
| WO2025088003A1 (en) | 2023-10-24 | 2025-05-01 | Novozymes A/S | Use of xyloglucanase for replacement of optical brightener |
| WO2025103765A1 (en) | 2023-11-17 | 2025-05-22 | Novozymes A/S | Lytic polysaccharide monooxygenases and their use in detergent |
| WO2025114053A1 (en) | 2023-11-30 | 2025-06-05 | Novozymes A/S | Biopolymers for use in detergent |
| CN117535993B (en) * | 2023-12-19 | 2026-03-27 | 青岛海森林发制品集团股份有限公司 | A non-toxic bio-enzyme bleaching process for wig fibers |
| WO2025132258A1 (en) | 2023-12-20 | 2025-06-26 | Basf Se | Stabilized enzyme composition comprising a protease |
| WO2025153046A1 (en) | 2024-01-19 | 2025-07-24 | Novozymes A/S | Detergent compositions and uses thereof |
| EP4624572A1 (en) | 2024-03-27 | 2025-10-01 | Basf Se | Polypeptides having protease activity for use in detergent compositions |
| WO2025202379A1 (en) | 2024-03-27 | 2025-10-02 | Basf Se | Polypeptides having protease activity for use in detergent compositions |
| WO2025202370A1 (en) | 2024-03-27 | 2025-10-02 | Basf Se | Polypeptides having protease activity for use in detergent compositions |
| WO2025202372A1 (en) | 2024-03-27 | 2025-10-02 | Basf Se | Polypeptides having protease activity for use in detergent compositions |
| WO2025202374A1 (en) | 2024-03-27 | 2025-10-02 | Basf Se | Polypeptides having protease activity for use in detergent compositions |
| WO2025202369A1 (en) | 2024-03-27 | 2025-10-02 | Basf Se | Polypeptides having protease activity for use in detergent compositions |
| WO2025257254A1 (en) | 2024-06-12 | 2025-12-18 | Novozymes A/S | Lipases and lipase variants and the use thereof |
| WO2026017636A1 (en) | 2024-07-17 | 2026-01-22 | Novozymes A/S | Compositions comprising combination of enzymes |
| WO2026046881A1 (en) | 2024-08-26 | 2026-03-05 | Novozymes A/S | Compositions comprising a hexosaminidase and a protease |
| WO2026068782A1 (en) | 2024-09-30 | 2026-04-02 | Novozymes A/S | Protease variants and polynucleotides encoding same |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BE68134A (en) | 1965-05-20 | |||
| DE1287550B (en) | 1966-01-18 | 1969-01-23 | Bayer Ag | Whitening agents |
| CH554848A (en) | 1967-10-03 | 1974-10-15 | Ciba Geigy Ag | PROCESS FOR PRODUCING NEW STILBENE DERIVATIVES. |
| US3812044A (en) | 1970-12-28 | 1974-05-21 | Procter & Gamble | Detergent composition containing a polyfunctionally-substituted aromatic acid sequestering agent |
| DE2248820C3 (en) | 1972-10-05 | 1978-11-02 | Bayer Ag, 5090 Leverkusen | Dipotassium 4,4'-bis (4-phenyl-2-vtriazolyl) -stilbene-2,2'-disulfonate, its production and use as an optical brightener |
| DE2437090A1 (en) | 1974-08-01 | 1976-02-19 | Hoechst Ag | CLEANING SUPPLIES |
| US4565647B1 (en) | 1982-04-26 | 1994-04-05 | Procter & Gamble | Foaming surfactant compositions |
| US4704233A (en) | 1986-11-10 | 1987-11-03 | The Procter & Gamble Company | Detergent compositions containing ethylenediamine-N,N'-disuccinic acid |
| CA2268911A1 (en) * | 1996-10-15 | 1998-04-23 | The Procter & Gamble Company | Asymmetrical bleach activators and compositions employing the same |
| GB9626554D0 (en) | 1996-12-20 | 1997-02-05 | Ciba Geigy Ag | Process |
| DE69906181D1 (en) | 1998-05-13 | 2003-04-30 | Ciba Sc Holding Ag | Process for the preparation of sulfonated distyrylbiphenyl compounds |
| CN103333870A (en) | 2003-12-03 | 2013-10-02 | 丹尼斯科美国公司 | Perhydrolase enzyme |
| US8518675B2 (en) * | 2005-12-13 | 2013-08-27 | E. I. Du Pont De Nemours And Company | Production of peracids using an enzyme having perhydrolysis activity |
| US7964378B2 (en) * | 2005-12-13 | 2011-06-21 | E.I. Du Pont De Nemours And Company | Production of peracids using an enzyme having perhydrolysis activity |
| PT2007942E (en) * | 2006-04-14 | 2014-10-07 | Danisco Us Inc | One-step treatment of textiles |
-
2010
- 2010-02-17 BR BRPI1013219A patent/BRPI1013219A2/en not_active IP Right Cessation
- 2010-02-17 EP EP10705848A patent/EP2403990A2/en not_active Withdrawn
- 2010-02-17 WO PCT/EP2010/051953 patent/WO2010100028A2/en not_active Ceased
- 2010-02-17 CN CN2010800096945A patent/CN102333914A/en active Pending
- 2010-02-17 US US13/138,455 patent/US20110302724A1/en not_active Abandoned
- 2010-02-17 MX MX2011008656A patent/MX2011008656A/en active IP Right Grant
- 2010-03-04 TW TW099106262A patent/TW201035407A/en unknown
-
2011
- 2011-08-17 CO CO11104425A patent/CO6362055A2/en active IP Right Grant
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2010100028A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102333914A (en) | 2012-01-25 |
| US20110302724A1 (en) | 2011-12-15 |
| MX2011008656A (en) | 2011-09-06 |
| TW201035407A (en) | 2010-10-01 |
| WO2010100028A3 (en) | 2011-01-27 |
| CO6362055A2 (en) | 2012-01-20 |
| BRPI1013219A2 (en) | 2016-03-29 |
| WO2010100028A2 (en) | 2010-09-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20110302724A1 (en) | Enzymatic textile bleach-whitening methods | |
| AU2010255863B2 (en) | Enzymatic textile colour modification | |
| AU2009291795B2 (en) | Enzymatic textile bleaching compositions and methods of use thereof | |
| EP2064385B1 (en) | Enzymatic treatment of textiles using a pectate lyase from bacillus subtilis | |
| CN1221648C (en) | Inhibits redeposition or backstaining during stonewashing processes | |
| CA2150563A1 (en) | Enhancement of enzyme reactions | |
| BRPI0709978A2 (en) | one-step treatment of textile products | |
| CN103476985A (en) | Color modification of sized fabric | |
| WO1999001604A1 (en) | A method of treating polyester fabrics | |
| US20120149269A1 (en) | Combined Textile Abrading And Color Modification | |
| EP3668960B1 (en) | Method of treating fabrics | |
| EP2403809B1 (en) | Method of oxidative decolorization of dyes with enzymatically generated peracid | |
| EP2553160B1 (en) | Treatment of keratinous fibers with an enzyme having perhydrolase activity | |
| HK1159155B (en) | Enzymatic textile bleaching compositions and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20110815 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO SE SI SK SM TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20150901 |