EP2145003A2 - Polynucleotides and polypeptides involved in gestational malaria, and biological applications - Google Patents
Polynucleotides and polypeptides involved in gestational malaria, and biological applicationsInfo
- Publication number
- EP2145003A2 EP2145003A2 EP08737901A EP08737901A EP2145003A2 EP 2145003 A2 EP2145003 A2 EP 2145003A2 EP 08737901 A EP08737901 A EP 08737901A EP 08737901 A EP08737901 A EP 08737901A EP 2145003 A2 EP2145003 A2 EP 2145003A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- polypeptide
- parasites
- malaria
- placental
- polynucleotide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/44—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
- C07K14/445—Plasmodium
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
- A61P33/06—Antimalarials
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/20—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans from protozoa
- C07K16/205—Plasmodium
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to novel antigens involved in gestational malaria and more particularly to polynucleotide and polypeptide sequences, conjugates, cloning vectors comprising said sequences for the production of immunogenic compositions and vaccines, antibodies and their use for the treatment of gestational malaria.
- the invention also relates to methods and diagnostic kits.
- Malaria also called malaria, is transmitted mainly by the parasite Plasmodium falciparum, inoculated during the bite of an anopheles mosquito. Once introduced into the blood, the parasite enters the liver where it matures before circulating again in the blood, infecting red blood cells (erythrocytes) and multiplying.
- Plasmodium falciparum Plasmodium falciparum
- the parasite Once introduced into the blood, the parasite enters the liver where it matures before circulating again in the blood, infecting red blood cells (erythrocytes) and multiplying.
- Gestational malaria also called placental malaria or malaria associated with pregnancy
- the placenta contains many infected erythrocytes. This has adverse effects on the growth of the fetus, since it disrupts the exchange between the mother and the fetus, resulting in a decrease in the weight of the child at birth.
- 3 to 5% of infant deaths at birth can be attributed to gestational malaria.
- gestational malaria In addition, it also presents a real danger for the mother.
- the clinical severity of malaria due to Plasmodium falciparum is partly related to alterations in infected erythrocytes.
- erythrocytes are exported to the surface of erythrocytes during the development phase in the blood.
- Some of these surface proteins, encoded by parasites confer new cytoadherence properties on erythrocytes, resulting in their subtraction from the bloodstream.
- the erythrocytes are then able to attach to the inner wall of the blood vessels, thereby preventing the transport of the erythrocyte to the purifying organs of the immune system, one of whose roles is to destroy the recognized cells. as abnormal.
- the surface proteins expressed by the parasites may also undergo antigenic variation, which is believed to contribute to the fact that the parasites escape the immune system.
- VSA surface variant antigens
- the present invention thus relates to novel polynucleotides and polypeptides involved in gestational malaria, as well as to their biological applications as sequences encoding antigens.
- Isolated or purified polynucleotides comprising a sequence selected from the group consisting of:
- SEQ ID NO. 1 corresponds to the nucleotide sequence of the hypothetical protein "PFI1785w”, described during the complete sequencing of the genome of the P. falciparum clone 3D7. However, no function has been associated with this hypothetical protein.
- sequence SEQ ID No. 2 thus corresponds to the peptide sequence of the hypothetical protein "PFI1785w".
- the invention relates more particularly to polynucleotides having a sequence chosen from the group consisting of:
- SEQ ID NO. 3 corresponds to the nucleotide sequence fragment studied by the inventors and used when carrying out a particular embodiment of the invention (see FIG. Example 1). This sequence encodes a protein designated "NP561" by the inventors.
- the invention also relates to the polypeptides corresponding to the abovementioned polynucleotides and more particularly to the isolated or purified polypeptides encoded by the above polynucleotides, as well as the isolated or purified polypeptides comprising a sequence chosen from the group consisting of:
- the invention also covers recombinant or chimeric polypeptides comprising at least one polypeptide according to the invention.
- polypeptides and polynucleotides according to the invention are particularly suitable for use as medicaments.
- the polypeptides according to the invention constitute antigens of gestational malaria.
- polynucleotides encode antigenic proteins of this specific malaria. As such, they can be used as such or in modified form as vaccines.
- An appropriate modification of the polypeptides according to the invention corresponds to the production of conjugates. These comprise at least one polypeptide according to the invention, bound to a support.
- the conjugates can be obtained by coupling via a covalent bond between a polypeptide and a physiologically acceptable, non-toxic, natural or synthetic carrier, capable, for example, of increasing the immunogenic nature of said polypeptide.
- a physiologically acceptable, non-toxic, natural or synthetic carrier capable, for example, of increasing the immunogenic nature of said polypeptide.
- the preferred supports according to the invention are chosen from viral particles, lipids, for example lipids of the C16-C18 type, polylysines, poly (DL-alanine) -poly (-Lysine) s, nitrocellulose and microparticles. of polystyrene, latex ball microparticles, biodegradable polymers, polyphosphoglycan microparticles, carrier proteins such as OPMC
- OPMC outer membrane protein complex of Neisseria meningitidis
- BSA bovine serum albumin
- TT tetanus toxoid
- ovalbumin KLH (keyhole limpet hemocyanm)
- THY bovine thyroglobulin
- l Hepatitis B virus HBsAg and HBcAg rotavirus capsid proteins
- human papillomavirus LI protein virus type particle 6, 11 and 16, tuberculin PPD (purified protein de ⁇ vative) ...
- the invention also provides a cloning or expression vector comprising at least one polynucleotide sequence according to the invention.
- the vectors targeted by the invention may be phages, plasmids, cosmids, viruses.
- the vector according to the invention may advantageously comprise a promoter and / or an element for regulating the expression in the host cell.
- the vectors may comprise sequences capable of increasing the immunogecity of the polynucleotides and polypeptides according to the invention, for example CpG sequences, the GMCSF gene (Granulocyte Macrophage Colony Stimulating Factor) or genes of cytokines or chemokines.
- Transformed (or recombinant) host cells comprising at least one polynucleotide or vector according to the invention are also within the scope of the invention.
- These cells may be chosen from bacteria, yeasts, insect or mammalian cells.
- conjugates and cloning vectors according to the invention may advantageously be used as medicaments, especially in immunogenic compositions or vaccines.
- the cloning vector can be used as a drug in the context of a DNA vaccination. It is indeed known that the injection of DNA (naked or inserted into a vector) in the body can allow the expression of the corresponding proteins and lead to an immune response.
- the polynucleotides according to the invention may advantageously be inserted into a plasmid of the DNA-CSP type, Nyvac pf7, VR1020, VR1012 ...
- the invention proposes immunogenic, pharmaceutical or gestational malaria vaccines comprising at least one element selected from polynucleotides, polypeptides, conjugates or vectors according to the invention, in association with an acceptable pharmaceutical carrier.
- the immunogenic compositions and vaccines can be advantageously used to immunize animals for the purpose of obtaining antibodies, or to immunize humans as part of a preventive treatment of gestational malaria.
- the composition or the vaccine may be adjuvanted by one or more adjuvants used in combination.
- adjuvants such as Montanide and / or Alum may be used.
- other adjuvants such as QS21, SBAS2, MF59, mLT, PHL, CpG DNA, calcium phosphate, dehydrated calcium sulfate, PLG, CT, LTB, CT / LT, AS02A are also suitable.
- the immunogenic compositions and vaccines according to the invention may also comprise at least one specific antigen of P.
- falciparum selected from var2csa pre-erythrocyte stage antigens (CSP, TRAP, LSA-I, LSA-3, SALSA, STARP, EXP - 1), asexual erythrocytes (MSP-I, MSP-3, AMA-I, EBA-175, GLURP, MSP-2, MSP-4, MSP-5, RAP-2, RESA, sera, PfEMP-I, toxin Synthetic GPI) or sexed (PfS25).
- CSP pre-erythrocyte stage antigens
- TRAP pre-erythrocyte stage antigens
- LSA-I LSA-I
- LSA-3 LSA-3
- SALSA SALSA
- STARP STARP
- EXP - 1 asexual erythrocytes
- the immunogenic composition or vaccine may be formulated for intradermal or intramuscular administration.
- an advantageous dosage is from 1 to 100 ⁇ g of immunogen per injection, preferably 5 to 50 ⁇ g.
- the invention also provides monoclonal, polyclonal or anti-sera antibodies specifically recognizing at least one of the polypeptides and / or conjugates according to the invention.
- these antibodies will be recombinant, humanized or chimerized antibodies, in particular when they will be used as medicaments, in the context, for example, of passive immunotherapy of gestational malaria.
- the invention particularly covers the use of at least one element selected from polynucleotides, polypeptides, conjugates, vectors, antibodies according to the invention, for the manufacture of a medicament for the treatment of placental malaria. It also provides in vitro diagnostic methods for placental malaria in a woman who may be infected with P. falciparum.
- a first method it comprises the following steps: a) bringing into contact, under conditions allowing an immunological reaction, a tissue and / or a biological fluid taken from the woman likely to be infected, with an antibody according to the invention, to allow the formation of immune complexes; and, b) detecting said potentially formed immune complexes.
- a diagnostic kit that can advantageously be used in the context of the method above, is also proposed. It includes the following elements:
- reagents allowing the detection of antigen-antibody complexes produced by said binding, these reagents being able to carry a marker capable of being recognized by a second detection reagent.
- the diagnostic method comprises the following steps: a) bringing into contact, under conditions allowing an immunological reaction, a tissue and / or a biological fluid taken from the woman likely to be infected with at least one member selected from the polypeptides, the conjugates according to the invention, to allow the formation of immune complexes with the antibodies possibly present in said tissue and / or said biological fluid; and, b) detecting said potentially formed immune complexes.
- the invention also covers the polynucleotide and polypeptide sequences of the proteins
- Figure 1 relates to the transcription characteristics of placental isolates.
- the points indicate the Iog2 of the log ratio of the expression (M) and the mean intensity (A) for each group of isolates in comparison with the control (strain 3D7). Only statistically significant data according to the Bonferroni correction are indicated.
- a single dominant var gene (var2csa) was detected in placental isolates of all examined groups (red dots). Over-expressed or under-regulated genes are indicated in black when the same difference is present in the three groups, in green when it is present in 2 groups out of 3 (2/3) and in blue when this one is present in 1 in 3 groups (1/3).
- Figure 2 shows the transcription levels of the genes identified in P. falciparum.
- PW primary publical malaria
- C asymptomatic children
- NPW Non-pregnant symptomatic women
- FIG. 2 shows the transcription levels of the genes identified in P. falciparum.
- PW primary publical malaria
- C asymptomatic children
- NPW Non-pregnant symptomatic women
- 3D7 black diamonds
- FCR3 red triangles
- Hb3 yellow diamonds
- NF54 green squares.
- Each of these 4 strains was used after selection or non-selection by the CSA link using soluble CSA (3D7), BeWo cells (FCR3 and Hb3) or anti-VAR2CSA IgGs (NF54).
- Figure 3 illustrates the ELISA recognition of NP561 by sera from individuals exposed to malaria.
- the test ELISA was conducted on plates covered by the NP561, DBL5- ⁇ , VAR2CSA and GLURP protectors.
- the high, low and mid sticks lines correspond to the 75 th percentile, 25 th percentile and 50 th percentile (median), respectively.
- the upper and lower marks extend to the 90 th and the io th percentile.
- Plasma concentrations of anti-VAR2CSA and anti-NP561 IgG were significantly higher in pregnant women.
- Figure 4 depicts the immunoblot-detected reactivity of rabbit anti-NP561 IgG against SDS lysates of P. falciparum-infected erythrocytes (PI: placental isolate, Ch: child isolate).
- the arrows indicate the expected size of the protein corresponding to PFI1785w.
- Figure 5 shows a flow cytometry and confocal microscopy analysis of erythrocytes labeled with anti-NP561 IgG or with irrelevant control antibody.
- A Labeling of uninfected red blood cells with anti-NP561 IgG and control of PBS-FCS on placental parasites.
- B
- Figures 6A and 6B show the splice structure of PFI1785w.
- Figure 7 the alignments respectively, sequences determined from the gDNA strain 3D7; gDNA of placental isolates; the cDNA of strain 3D7; the cDNA of the Senegalese placental isolate N42; the cDNA of the Senegalese placental isolate N14; the sequence predicted in plasmo DB from the cDNA of strain 3D7; and the consensus sequence.
- Example 1 Identification of New Genes with Specificity for Placental Tropism
- the red blood cells of the peripheral blood were washed 3 times and incubated in RPMI medium at 37 ° C in a candle bell (microaerophilic atmosphere) for 18-2Oh allowing the maturation of the ring stages in trophozoites.
- RPMI medium 37 ° C in a candle bell (microaerophilic atmosphere) for 18-2Oh allowing the maturation of the ring stages in trophozoites.
- a thick blood smear was prepared for microscopic examination from placenta appositions.
- P. falciparum-infected erythrocytes were isolated from positive placentas by infusion of said placentas with 0.1% heparin sodium in PBS (phosphate buffer saline).
- PBS phosphate buffer saline
- venous blood samples were collected from non-symptomatic infected children in a parallel cross-sectional study in the Thiebenegal. The samples were collected according to the same protocols described above.
- Bovine CSA (Sigma) and human chondroitin sulfate proteoglycans (CSPGs) were deposited as circular tasks in Falcon Petri dishes (Becton Dickmson) and the level of adherence to CSA and CSPG of Placental parasites were quantified according to the number of infected erythrocytes observed per square millimeter, estimated by examination of 20 fields under a high magnification microscope (20 times).
- Strains of P. falciparum were grown according to previously described protocols (Trager and Jensen, 1976).
- the strain 3D7 was synchronized with sorbitol 4 times with an interval of 8 hours in order to obtain particularly well synchronized development stages.
- Strains FCR3 and HB3 were selected according to their adhesion to CD36 or Bewo cells.
- the strain NF54 was selected using antibodies specific for the PfEMP1 protein encoded by the var2csa gene.
- the strain 3D7 was also selected according to its adhesion to the immobilized CSA. After selection, the parasites were cultured for 5-6 cycles to generate sufficient parasite density. The enrichment in mature cells is carried out by Macs purification as previously described (Staalsoe et al.
- the parasites are allowed to re-contaminate new red blood cells and are then recovered at 18, 36 and 44 hours after the invasion. Gender-specific recognition of the selected parasites was measured by flow cytometry using plasma samples from pregnant women and adult men from endemic areas, as well as samples of non-immune Danish volunteers (control).
- Genomic DNA was extracted from Whatman's paper deposits using the Chelex procedure
- RNA from placenta-infected erythrocytes and mature peripheral blood containing trophozoite / schizont stage parasites was prepared with Trizol. The quality of the RNA has been verified with the Agilent 2100 Bioanalyzer.
- Genotyping msp-2 The parasites were genotyped by analysis of the central msp-2 domain.
- the PCR amplification was carried out as previously described (Jafary et al., 2004) using primers fw (SEQ ID No. 15): 5'-GAAGGTAATTAAAACATTGTC-3 '(5' being fluorescein labeled) and rv (SEQ ID No. 16): 5'-GACACCTCGTCGTTGTAGGGAG-3 '.
- the amplification products are passed to the ABI Prism 310 Genetic Analyzer (Perkin Elmer Applied Biosystems) to enumerate and quantify the fluorescent fragments.
- RNA samples from 18 women were assembled into three groups and the control (3D7) consisted of a mixture of different stages of parasite development was prepared (Table 1). The integrity of the RNA transcripts of each sample was verified with the Agilent 2100 Bioanalyzer. The labeling and hybridization of the RNA samples were performed according to previously described protocols (Ralph et al., 2005).
- RNA extraction in t ⁇ zol is followed by a 15 min treatment with DNase 1 (Sigma) at 37 ° C.
- DNase 1 Sigma
- the absence of DNA contaminant in the preparation was verified using 40 cycles of real-time PCR using primers specific for a conserved housekeeping gene (f ructose-biphosphate aldolase).
- DNA-free RNA has was transcribed by reverse transcription using random primers with the enzyme Superscript II (Invitrogen) at 25 ° C for 10 min, then at 42 ° C for 50 min followed by a cycle at 70 0 C for 15 min.
- the PlasmoDB predicted protein encoded by the PFI1785w gene of the P. falciparum clone 3D7 genome was selected to be expressed as a soluble protein.
- the product of this gene is a protein of 332 amino acids with a transmembrane domain extending from amino acid 41 to amino acid 69 and a pexel motif located between amino acids 86 and 92.
- the sequence from base pair 391 to base pair 967 is amplified from 3D7 gDNA using the following primers, which include EcoRI and NotI restriction sites at 5 'and 3' respectively: Fw ( SEQ ID No.
- NP561 corresponding to approximately 70% of the complete size of the PFI1785w protein, was used as an immunogen in this study.
- Specific rabbit antibodies were induced as described previously (Salanti et al., 2004) and affinity purified using a column where the recombinant NP561 was fixed. Briefly, NP561 was covalently coupled via primary amino groups to a HiTrap TM NHS-activated Sepharose column and the rabbit antibodies were purified according to the manufacturer's instructions.
- Plasma levels of P. falciparum specific IgG were measured by ELISA using recombinant proteins VAR2CSA and NP561 as antigens.
- the recombinant GLURP protein was used as a control antigen.
- Antibody levels are expressed as optical density (OD) values. Characterization of antibodies by immunodetection by electrophoretic transfer (Iinmunoblot).
- the polyclonal antibodies against NP561 are affinity purified from hyperimmune rabbit sera and a group of plasma samples from women suffering from of placental infection and their reactivity was tested on the surface of mature infected erythrocytes from childhood isolates and placental isolates from Africa. The reactivity of the antibodies with the surface of infected erythrocytes in the liquid phase was then verified by confocal microscopy, using an LSM5 microscope (Carl Zeiss Microlmagming, Inc.).
- RNAs from different stages of development of strain 3D7 have been grouped together to mimic the distribution stages in placental isolates.
- the RNA sample pools were fluorescently labeled and hybridized with a high density oligonucleotide array (Ralph et al., 2005).
- a reversal of the markers is performed. Bonferroni's method, the most recent one, showed that 183 genes were overexposed in placental parasites and 261 genes were under-expelled.
- 99 belong to group 1, 67 to group 2 and 85 to group 3. The majority of these genes (108 out of 183) correspond to hypothetical proteins. 20 of them have a pexel pattern.
- RNAs corresponding to the 19 genes differentially expressed with level variations as estimated by the oligonucleotide network were carried out.
- the genes were chosen from the abundance of their transcripts, which varies from strong to weak. Additional criteria include: 1) be overexposed steadily to 2 of the 3 groups, n) have at least one TM, pexel and / or signal sequence, m) be also present in another biochip analysis using laboratory isolates selected for their specific phenotype.
- the abundance of transcripts from the 19 selected genes was determined by real - time PCR in parasites associated with different clinical presentations of malaria infection. Parasites were collected from asymptomatic children and non-pregnant women with symptoms, living in a geographical area close to western Senegal on a short time interval compared to placental samples. The abundance of transcripts corresponding to the 19 genes was measured on parasites having reached a degree of maturation and development approximately identical to those of parasites derived from placentas. The abundance of transcripts of the 19 genes was also measured on laboratory-adapted parasite lines selected for their phenotype capable of binding to the CSA or not.
- var2csa has a specific PAM profile in the isolates as well as a marked specificity for the laboratory isolates selected for their binding to the CSA (Salanti et al., 2003), (Fig. 2, right panel).
- Fig. 2B m) high expression in parasites from women with symptoms and pregnant women but no asymptomatic children (shown in Fig. 2C), iv) no difference in expression among all groups of parasites in vivo (not shown)
- the protein has a surface expression with a short N-terminal domain.
- PF10_0350 which is highly transcribed in non-PAM parasites with respect to placental parasites.
- the product of this gene is predicted to have surface expression, since it has a transmembrane domain, but no pexel motif targeting red cell surface targeting.
- PfEMP1 variants as the major mediator of the antigenic variation and adhesion properties of infected erythrocytes.
- Tuikue Ndam et al., 2005 demonstrated that VAR2CSA PfEMPl is responsible for the binding to CSA of infected erythrocytes from the placenta.
- the present study has identified differences in gene expression compared to the parasites in the 3D7 laboratory control strain, using a biochip analysis of the entire genome of the parasites. Placental P. falciparum.
- placental parasites which along with var2csa, includes genes considered likely to encode surface proteins that may play a role in the biological process associated with placental tropism. parasites.
- var2csa genes considered likely to encode surface proteins that may play a role in the biological process associated with placental tropism. parasites.
- RNA expression were minimized by (1) sampling of patients of the same ethnic group, living in the same geographic area and having the same type of disease (placental infection), (2) grouping of samples according to a distribution relative to the stage of development of the parasite, the analysis of homogeneous parasites being richer in information with regard to commonly shared properties.
- NP561 Part of the protein encoded by PFI1785w was expressed in recombinant baculovirus-infected sf9 insect cells with the PFI1785w gene sequence, and the product (NP561) was purified as a protein with a secreted histidine tail. NP561 has been recognized in tests
- IFA infected erythrocytes derived from placenta.
- PfEMP rabbit antisera directed against other previously characterized PfEMPs against uninfected erythrocytes, erythrocytes infected with laboratory strains and infected fresh erythrocytes from children.
- recombinant NP561 specific rabbit antibodies were able to specifically mark the surface of parasitized red blood cells derived from placenta but not that of red blood cells infected with strains of laboratory parasites or that of infected erythrocytes from children (Fig. 5).
- the surface location of the protein corresponding to PFI1785w is clearly demonstrated by confocal microscopy after IFA.
- the protein is specifically located on the surface of infected erythrocytes derived from placenta.
- PFI1785w has a clearly defined profile, similar to that of var2csa, suggesting its specificity to PAM.
- no evidence of a possible relationship to a CSA binding phenotype was observed in biologically-selected in vitro parasite lines for binding to CSA.
- CSA binding properties represent a major specific phenotype of MAP parasites, it appears that all parasite characteristics PAM managers can not be reproduced in laboratory-adapted parasite lines.
- Further work to characterize PFI1785w revealed that the protein encoded by this gene is expressed by placental isolates as demonstrated by western blot analyzes.
- NP561 Compared to VAR2CSA, the corresponding recombinant protein (NP561) is better recognized by serum samples from pregnant women living in endemic areas of malaria suggesting that the product of this gene is targeted by the immune response, although its relationship to genus less important.
- specific antibodies directed against NP561 specifically mark the surface of PAM parasites as demonstrated by flow cytometry and IFA. This proves an obvious implication of this parasitic protein in PAM mechanism.
- PFI1785w is a gene with a unique copy that encodes a small protein that is predicted to express a single molecule on the surface of erythrocytes. This new immunoreactive antigen identified has interesting evidence of its involvement in the mechanism governing placental tropism of P. falciparum, and thus appears as a new priority antigen for evaluations aimed at developing an effective vaccine against MAP. .
- Figure 7 gives comparisons between genomic or cDNA sequences of a Plasmodium strain or placental isolates.
- the predicted sequence of PlasmoB which is obtained from the 3D7 cDNA, comprises a "stop" bead.
- the region Corresponding text is not translated. This sequence is therefore truncated, the bases 555 to 647 being missing.
- This sequence can be translated from gDNA (3D7 DNA and gDNA from a Ghana isolate).
- the cDNAs of isolates N42 and N14 have no mtrons.
- PF10_0350 and PF10_0351 are contiguous and in the same orientation on chromosome 10. It is interesting to note that one is over-regulated while the other is under-regulated in placental samples. Since there is only 1.3 kb between the "stop" codon of PF10_0350 and the "start” codon of PF10_0351, it can be assumed that the attachment of the activating zone on the promoter region of PF10 0351 interferes with the enhancer. the 5 'region of PF10 0350.
- PF10_0351 belongs to the family of paralogs of MSP3 (merozoite surface protein 3). H103, the protein encoded by PF10_0351, has been shown to be expressed on the surface of merozoites (Pearce et al., 2005). Overexpression of this protein in placental parasites may indicate that H103 acts as a virulence factor. In the present study, the differences between the in vivo parasites and the in vitro parasite cultures are clearly evidenced by the transcription of genes such as PFCOI10w (Clag 3.2), PF10_0344 (glutamate-rich protein) and PF14_0010 (antigen relative to the glycophenic binding protein). PFC0120w that codes for a different member of the CLAG family
- clag 3.1 (asexual cytoadherence gene), clag 3.1, is, however, underregulated in placental parasites, probably indicating that the latter is not involved in the in vivo pathogenesis of PAM parasites.
- subfamily clag genes (dag3) have been described as playing a possible role in erythrocyte binding during the invasion process, recent studies show that clag 3.2 transcripts, unlike those of clag 3.1, can not be detected in some laboratory-adapted strains, such as Dd2 parasites, which is consistent with this study.
- ⁇ D shows the PCR products confirming the splicing of intron 1 and not intron 2 in 3D7 and a placental isolate cDNA.
- the 3 primers represented by arrows in Fig. B were used to amplify a short fragment and a complete fragment from the 3D7 genomic DNA (lines 2 and 5), the 3D7 cDNA (lines
- Line 1 shows a molecular weight marker of
- ⁇ D (B) represents the pattern of the exon / mtron structure from the predicted gene and mRNA / cDNA.
- the black bars represent the predicted exons.
- the white and striped bars represent intron 1 and intron 2, respectively, according to the genome sequence of 3D7.
- the mRNA / cDNA pattern corresponds to the structure observed experimentally.
- Rabbit antibodies specific for these recombinant proteins were able to specifically mark the surface of parasitized red blood cells derived from placenta but not that of red blood cells infected with strains of laboratory parasites or that of infected erythrocytes from children.
- the surface localization of the proteins corresponding to PFA0700c, PF14_0757, PFB0105c, PF10_0351 and PF10_0350 was verified by confocal microscopy after IFA.
- Antibodies specific for each of the above proteins were used in immunoprecipitation on parasitized and desequered red blood cell lysates of placentas. Protein complexes were dissociated and analyzed by mass spectrometry. The combination of all these methods allowed us to confirm the expression, the export to the surface of the parasitized red blood cell and the antigenicity of new parasite proteins involved in the pathogenesis of gestational malaria. These proteins are therapeutic and vaccine targets of great interest.
- Rabbits are immunized with incomplete / complete Freund's adjuvant. This adjuvant helps to induce the production of reactive antibodies directed against NP561.
- the levels of NP561 specific IgGs are detected by ELISA and increase as immunizations proceed and reach a maximum after 5 immunizations (Barfod et al., 2006).
- the polyclonal antibodies against NP561 are affinity purified from sera of human rabbits. References
- Plasmodium falciparum dihydrofolate reductase polymerase chain reaction methods for surveillance in Africa. Am J Trop Med Hyg 52: 565-568.
- VAR2CSA Plasmodium falciparum-infected erythrocytes.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Tropical Medicine & Parasitology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Polynucléotides et polypeptides impliqués dans le paludisme gestationnel, et applications biologiques. Polynucleotides and polypeptides involved in gestational malaria, and biological applications.
La présente invention est relative à de nouveaux antigènes impliqués dans le paludisme gestationnel et plus particulièrement à des séquences polynucléotidiques et polypeptidiques, des conjugués, des vecteurs de clonages comportant lesdites séquences en vue de la réalisation de compositions immunogènes et vaccins, d'anticorps et à leurs utilisation pour le traitement du paludisme gestationnel. L'invention vise également des méthodes et des kits de diagnostic.The present invention relates to novel antigens involved in gestational malaria and more particularly to polynucleotide and polypeptide sequences, conjugates, cloning vectors comprising said sequences for the production of immunogenic compositions and vaccines, antibodies and their use for the treatment of gestational malaria. The invention also relates to methods and diagnostic kits.
Le paludisme, appelé également malaria, est transmis principalement par le parasite Plasmodium falciparum, inoculé lors de la piqûre d'un moustique, l'anophèle. Une fois introduit dans le sang, le parasite pénètre dans le foie où il mâture avant de circuler à nouveau dans le sang, d' infecter les globules rouges (érythrocytes) et de se multiplier.Malaria, also called malaria, is transmitted mainly by the parasite Plasmodium falciparum, inoculated during the bite of an anopheles mosquito. Once introduced into the blood, the parasite enters the liver where it matures before circulating again in the blood, infecting red blood cells (erythrocytes) and multiplying.
Le paludisme gestationnel (appelé également paludisme placentaire ou paludisme associé à la grossesse) est observé chez la femme enceinte. En effet, chez la femme enceinte impaludée, le placenta contient de nombreux érythrocytes infectés. Ceci a des effets néfastes sur la croissance du fœtus, puisqu'il perturbe les échanges entre la mère et le fœtus, entraînant une diminution du poids de l'enfant à la naissance. Dans les zones d'Afrique où le paludisme est endémique, 3 à 5% des décès des nourrissons à la naissance peuvent être imputés au paludisme gestationnel. En outre, il présente également un réel danger pour la mère. La sévérité clinique du paludisme due à Plasmodium falciparum est liée en partie à des altérations des érythrocytes infectés. Ces altérations sont induites par les protéines du parasite qui sont exportées à la surface des érythrocytes durant la phase de développement dans le sang. Certaines de ces protéines de surface, codées par les parasites, confèrent des nouvelles propriétés de cytoadhérence aux érythrocytes, ayant pour conséquence leur soustraction à la circulation sanguine. En effet, les érythrocytes sont alors capables de se fixer à la paroi interne des vaisseaux sanguins, empêchant par la même l'acheminement de 1' érythrocyte vers les organes épurateurs du système immunitaire, dont l'un des rôles est de détruire les cellules reconnues comme anormales . Les protéines de surface exprimées par les parasites peuvent également subir une variation antigénique, phénomène qui est supposé contribuer au fait que les parasites échappent au système immunitaire.Gestational malaria (also called placental malaria or malaria associated with pregnancy) is observed in pregnant women. In fact, in the pregnant woman who is malarious, the placenta contains many infected erythrocytes. This has adverse effects on the growth of the fetus, since it disrupts the exchange between the mother and the fetus, resulting in a decrease in the weight of the child at birth. In areas of Africa where malaria is endemic, 3 to 5% of infant deaths at birth can be attributed to gestational malaria. In addition, it also presents a real danger for the mother. The clinical severity of malaria due to Plasmodium falciparum is partly related to alterations in infected erythrocytes. These alterations are induced by parasite proteins that are exported to the surface of erythrocytes during the development phase in the blood. Some of these surface proteins, encoded by parasites, confer new cytoadherence properties on erythrocytes, resulting in their subtraction from the bloodstream. In fact, the erythrocytes are then able to attach to the inner wall of the blood vessels, thereby preventing the transport of the erythrocyte to the purifying organs of the immune system, one of whose roles is to destroy the recognized cells. as abnormal. The surface proteins expressed by the parasites may also undergo antigenic variation, which is believed to contribute to the fact that the parasites escape the immune system.
Dans les zones où le paludisme est endémique, les adultes sont souvent résistants aux infections dues à Plasmodium falciparum. Ceci résulte de l'acquisition progressive d'une immunité vis-à-vis d'un large répertoire d'antigènes variants de surface (VSA) du parasite. En dépit de l'acquisition de cette immunité a l'âge adulte, la prévalence du paludisme augmente lors de la grossesse, spécialement parmi les femmes primigestes. Les femmes enceintes de leur premier enfant manquent d'anticorps dirigés contre les VSA exprimés par les parasites adhérant aux tissus placentaires, ce qui suggère que ces parasites expriment des nouveaux VSA (VSAPAM) auxquels ces femmes n'ont jamais été exposées auparavant. Les parasites du paludisme gestationnel (PAM) présentent un tropisme placentaire et adhèrent à la chondroitine sulfate A (CSA) exprimée à la surface de la couche de syncytiotrophoblastes . Les femmes deviennent par la suite résistantes au paludisme car elles acquièrent des anticorps spécifiques contre les VSAPAM qui inhibent la liaison du parasite à la CSA durant les grossesses suivantes. Ces observations ont conduit les inventeurs à étudier la mise au point d'un vaccin contre cette forme du paludisme.In areas where malaria is endemic, adults are often resistant to Plasmodium falciparum infections. This results from the gradual acquisition of immunity to a broad repertoire of surface variant antigens (VSA) of the parasite. Despite the acquisition of this immunity in adulthood, the prevalence of malaria increases during pregnancy, especially among primigillous women. Pregnant women in their first child lack antibodies to VSA expressed by placental tissue parasites, suggesting that these parasites express new VSA ( PAM VSA) to which these women have never been exposed before. The parasites of gestational malaria (PAM) have a placental tropism and adhere to the chondroitin sulfate A (CSA) expressed on the surface of the syncytiotrophoblast layer. The women eventually become resistant to malaria because they acquire specific antibodies against the VSA PAM that inhibit binding of the parasite to the CSA during subsequent pregnancies. These observations led the inventors to study the development of a vaccine against this form of malaria.
L'étude d'isolats frais, collectés directement à partir de placentas de femmes à l'accouchement, a permis aux inventeurs d' identifier et d' isoler de nouveaux gènes présentant une spécificité pour les parasites au tropisme placentaire.The study of fresh isolates, collected directly from placentas of women at delivery, allowed the inventors to identify and isolate new genes with specificity for parasites in the placental tropism.
La présente invention se rapporte donc à de nouveaux polynucléotides et polypeptides impliqués dans le paludisme gestationnel, ainsi qu'à leurs applications biologiques en tant que séquences codant pour des antigènes.The present invention thus relates to novel polynucleotides and polypeptides involved in gestational malaria, as well as to their biological applications as sequences encoding antigens.
Les polynucléotides isolés ou purifiés comprenant une séquence choisie parmi le groupe consistant en :Isolated or purified polynucleotides comprising a sequence selected from the group consisting of:
(a) Une séquence ayant au moins 80% d'identité avec SEQ ID(a) A sequence with at least 80% identity with SEQ ID
NO. 1, (b) Une sous-séquence de (a) avec une longueur minimum deNO. 1, (b) A subsequence of (a) with a minimum length of
30 acides nucléiques, ont été étudiés .30 nucleic acids, were studied.
SEQ ID NO. 1 correspond à la séquence nucléotidique de la protéine hypothétique « PFI1785w », décrite lors du séquençage complet du génome du clone 3D7 de P. falciparum. Cependant, aucune fonction n'a été associée à cette protéine hypothétique .SEQ ID NO. 1 corresponds to the nucleotide sequence of the hypothetical protein "PFI1785w", described during the complete sequencing of the genome of the P. falciparum clone 3D7. However, no function has been associated with this hypothetical protein.
La séquence SEQ ID NO.2 correspond donc à la séquence peptidique de la protéine hypothétique « PFI1785w ». L'invention vise plus particulièrement les polynucléotides ayant une séquence choisie dans le groupe consistant en :The sequence SEQ ID No. 2 thus corresponds to the peptide sequence of the hypothetical protein "PFI1785w". The invention relates more particularly to polynucleotides having a sequence chosen from the group consisting of:
(a) SEQ ID NO. 3,(a) SEQ ID NO. 3
(b) Une séquence ayant au moins 80% d'identité avec (a),(b) A sequence having at least 80% identity with (a),
(c) Une sous-séquence de (a) avec une longueur minimum de 30 acides nucléiques.(c) A subsequence of (a) with a minimum length of 30 nucleic acids.
SEQ ID NO. 3 correspond au fragment de séquence nucléotidique étudié par les inventeurs et mis en œuvre lors de la réalisation d'un mode particulier de l'invention (voir l'exemple 1) . Cette séquence code pour une protéine désignée sous l'appellation « NP561 » par les inventeurs.SEQ ID NO. 3 corresponds to the nucleotide sequence fragment studied by the inventors and used when carrying out a particular embodiment of the invention (see FIG. Example 1). This sequence encodes a protein designated "NP561" by the inventors.
L'invention vise également les polypeptides correspondant aux polynucléotides susmentionnés et plus particulièrement, les polypeptides isolés ou purifiés codés par les polynucléotides ci-avant, ainsi que les polypeptides isolés ou purifiés comprenant une séquence choisie parmi le groupe consistant en :The invention also relates to the polypeptides corresponding to the abovementioned polynucleotides and more particularly to the isolated or purified polypeptides encoded by the above polynucleotides, as well as the isolated or purified polypeptides comprising a sequence chosen from the group consisting of:
(a) SEQ ID NO. 4, qui correspond à la séquence de la protéine NP561,(a) SEQ ID NO. 4, which corresponds to the sequence of the NP561 protein,
(b) Une séquence ayant au moins 80% d'identité avec (a),(b) A sequence having at least 80% identity with (a),
(c) Une sous-séquence de (a) ou (b) avec une longueur minimum de 10 acides aminés.(c) A subsequence of (a) or (b) with a minimum length of 10 amino acids.
L' invention couvre également les polypeptides recombinants ou chimériques comportant au moins un polypeptide selon 1' invention .The invention also covers recombinant or chimeric polypeptides comprising at least one polypeptide according to the invention.
Les polypeptides et les polynucléotides selon l'invention sont particulièrement adéquats pour une utilisation comme médicaments. En effet, les polypeptides selon l'invention constituent des antigènes du paludisme gestationnel . De même, les polynucléotides codent pour des protéines antigéniques de ce paludisme spécifique. A ce titre, ils peuvent être utilisés comme tels ou sous une forme modifiée en tant que vaccins. Une modification appropriée des polypeptides selon l'invention correspond à la réalisation de conjugues. Ceux-ci comportent au moins un polypeptide selon l'invention, lié (s) à un support.The polypeptides and polynucleotides according to the invention are particularly suitable for use as medicaments. Indeed, the polypeptides according to the invention constitute antigens of gestational malaria. Similarly, polynucleotides encode antigenic proteins of this specific malaria. As such, they can be used as such or in modified form as vaccines. An appropriate modification of the polypeptides according to the invention corresponds to the production of conjugates. These comprise at least one polypeptide according to the invention, bound to a support.
Les conjugues peuvent être obtenus par couplage via une liaison covalente entre un polypeptide et un support physiologiquement acceptable, non toxique, naturel ou synthétique, susceptible par exemple d'accroître le caractère immunogene dudit polypeptide. Concernant les conjugués, on citera à titre d'exemple, la demande WO 2006/124712, qui décrit des méthodes de préparation de conjugués comportant une pluralité de peptides antigéniques de P. falciparum liés à une protéine support améliorant 1 ' immunogémcité desdits antigènes.The conjugates can be obtained by coupling via a covalent bond between a polypeptide and a physiologically acceptable, non-toxic, natural or synthetic carrier, capable, for example, of increasing the immunogenic nature of said polypeptide. As regards the conjugates, mention may be made, by way of example, of the application WO 2006/124712, which describes methods for preparing conjugates comprising a plurality of antigenic peptides of P. falciparum bound to a carrier protein improving the immunogecity of said antigens.
Les supports préférés selon l'invention sont choisis parmi les particules virales, des lipides, par exemple des lipides de type C16-C18, les polylysines, les poly (DL-alanine) -poly (-Lysine) s, la nitrocellulose, les microparticules de polystyrène, les microparticules de billes de latex, les polymères biodégradables, les microparticules de polyphosphoglycanes, les protéines supports telles que l'OPMCThe preferred supports according to the invention are chosen from viral particles, lipids, for example lipids of the C16-C18 type, polylysines, poly (DL-alanine) -poly (-Lysine) s, nitrocellulose and microparticles. of polystyrene, latex ball microparticles, biodegradable polymers, polyphosphoglycan microparticles, carrier proteins such as OPMC
(outer membrane protein complex of Neisseria meningitidis) ou l'OPMC amélioré, la BSA (bovine sérum albumin) , le TT (tetanus toxoid) , l' ovalbumine, la KLH (keyhole limpet hemocyanm) , la THY (bovine thyroglobulin) , l 'HbSAg et l 'HBcAg du virus de l'hépatite B, les protéines capsides rotavirus, la protéine Ll du virus papillome humain, la VLP (virus like particle) de type 6, 11 et 16, le tuberculin PPD (purified protein deπvative) ...(outer membrane protein complex of Neisseria meningitidis) or improved OPMC, BSA (bovine serum albumin), TT (tetanus toxoid), ovalbumin, KLH (keyhole limpet hemocyanm), THY (bovine thyroglobulin), l Hepatitis B virus HBsAg and HBcAg, rotavirus capsid proteins, human papillomavirus LI protein, virus type particle 6, 11 and 16, tuberculin PPD (purified protein deπvative) ...
L'invention vise également un vecteur de clonage ou d'expression comprenant au moins une séquence polynucléotidique selon l'invention. Les vecteurs visés par l'invention peuvent être des phages, des plasmides, des cosmides, des virus.The invention also provides a cloning or expression vector comprising at least one polynucleotide sequence according to the invention. The vectors targeted by the invention may be phages, plasmids, cosmids, viruses.
Le vecteur selon l'invention peut comporter avantageusement un promoteur et/ou un élément de régulation de l'expression dans la cellule hôte. En particulier, les vecteurs pourront comporter des séquences capables d'augmenter l' immunogémcité des polynucléotides et polypeptides selon l'invention, par exemple des séquences CpG, le gène du GMCSF (Granulocyte Macrophage Colony Stimulating Factor) ou des gènes des cytokmes ou de chemokines. Les cellules hôtes transformées (ou recombinantes) comprenant au moins un polynucléotide ou vecteur selon l'invention entrent également dans le champ de l'invention.The vector according to the invention may advantageously comprise a promoter and / or an element for regulating the expression in the host cell. In particular, the vectors may comprise sequences capable of increasing the immunogecity of the polynucleotides and polypeptides according to the invention, for example CpG sequences, the GMCSF gene (Granulocyte Macrophage Colony Stimulating Factor) or genes of cytokines or chemokines. . Transformed (or recombinant) host cells comprising at least one polynucleotide or vector according to the invention are also within the scope of the invention.
Ces cellules peuvent être choisies parmi les bactéries, les levures, les cellules d'insectes ou de mammifères.These cells may be chosen from bacteria, yeasts, insect or mammalian cells.
Les conjugués et les vecteurs de clonage selon l'invention peuvent être avantageusement utilisés comme médicaments, notamment dans des compositions immunogènes ou des vaccins.The conjugates and cloning vectors according to the invention may advantageously be used as medicaments, especially in immunogenic compositions or vaccines.
En effet, le vecteur de clonage peut être utilisé comme médicament dans le cadre d'une vaccination par ADN. Il est en effet connu que l'injection d'ADN (nu ou inséré dans un vecteur) dans l'organisme peut permettre l'expression des protéines correspondantes et conduire à une réponse immunitaire. Dans ce cas, les polynucléotides selon l'invention peuvent être avantageusement insérés dans un plasmide de type DNA-CSP, Nyvac pf7, VR1020, VR1012...Indeed, the cloning vector can be used as a drug in the context of a DNA vaccination. It is indeed known that the injection of DNA (naked or inserted into a vector) in the body can allow the expression of the corresponding proteins and lead to an immune response. In this case, the polynucleotides according to the invention may advantageously be inserted into a plasmid of the DNA-CSP type, Nyvac pf7, VR1020, VR1012 ...
L'invention propose en effet des compositions immunogènes, pharmaceutiques ou des vaccins contre le paludisme gestationnel comprenant au moins un élément choisi parmi les polynucléotides, les polypeptides, les conjugués ou les vecteurs selon l'invention, en association avec un véhicule pharmaceutique acceptable.The invention proposes immunogenic, pharmaceutical or gestational malaria vaccines comprising at least one element selected from polynucleotides, polypeptides, conjugates or vectors according to the invention, in association with an acceptable pharmaceutical carrier.
Les compositions immunogènes et les vaccins peuvent avantageusement être utilisés pour immuniser des animaux aux fins d'obtention d'anticorps, ou pour immuniser des êtres humains dans le cadre d'une thérapie préventive du paludisme gestationnel .The immunogenic compositions and vaccines can be advantageously used to immunize animals for the purpose of obtaining antibodies, or to immunize humans as part of a preventive treatment of gestational malaria.
Selon un mode de réalisation préférentiel, la composition ou le vaccin peut être adjuvé par un ou plusieurs adjuvants utilisés en combinaison. Des adjuvants classiques tels que le Montanide et/ou l'Alum peuvent être utilisés. Cependant, d'autres adjuvants tels que QS21, SBAS2, MF59, mLT, PHL, CpG DNA, phosphate de calcium, sulfate de calcium déshydraté, PLG, CT, LTB, CT/LT, AS02A sont également appropriés. Les compositions immunogènes et vaccins selon l'invention peuvent comporter en outre au moins un antigène spécifique de P. falciparum choisi parmi var2csa, antigènes des stades pré- érythrocytaires (CSP, TRAP, LSA-I, LSA-3, SALSA, STARP, EXP- 1), érythrocytaires asexués (MSP-I, MSP-3, AMA-I, EBA-175, GLURP, MSP-2, MSP-4, MSP-5, RAP-2, RESA, SERA, PfEMP-I, toxine GPI synthétique) ou sexués (PfS25) .According to a preferred embodiment, the composition or the vaccine may be adjuvanted by one or more adjuvants used in combination. Conventional adjuvants such as Montanide and / or Alum may be used. However, other adjuvants such as QS21, SBAS2, MF59, mLT, PHL, CpG DNA, calcium phosphate, dehydrated calcium sulfate, PLG, CT, LTB, CT / LT, AS02A are also suitable. The immunogenic compositions and vaccines according to the invention may also comprise at least one specific antigen of P. falciparum selected from var2csa, pre-erythrocyte stage antigens (CSP, TRAP, LSA-I, LSA-3, SALSA, STARP, EXP - 1), asexual erythrocytes (MSP-I, MSP-3, AMA-I, EBA-175, GLURP, MSP-2, MSP-4, MSP-5, RAP-2, RESA, sera, PfEMP-I, toxin Synthetic GPI) or sexed (PfS25).
De préférence, la composition immunogène ou le vaccin peut être formulé pour être administré par voie intradermique ou intramusculaire. Dans ce cas, une posologie avantageuse est de 1 a lOOμg d' immunogène par injection, de préférence 5 à 50μg.Preferably, the immunogenic composition or vaccine may be formulated for intradermal or intramuscular administration. In this case, an advantageous dosage is from 1 to 100 μg of immunogen per injection, preferably 5 to 50 μg.
L'invention propose également des anticorps monoclonaux, polyclonaux ou des anti-sera reconnaissant spécifiquement au moins un des polypeptides et/ou des conjugués selon l'invention. Avantageusement, ces anticorps seront des anticorps recombinants, humanisés ou chimérisés, en particulier lorsque ceux-ci seront utilisés comme médicaments, dans le cadre, par exemple, d'une immunothérapie passive du paludisme gestationnel . L'invention couvre en particulier l'utilisation d'au moins un élément choisi parmi les polynucléotides, les polypeptides, les conjugués, les vecteurs, les anticorps selon l'invention, pour la fabrication d'un médicament destiné au traitement du paludisme placentaire. Elle propose également des méthodes de diagnostic in vitro du paludisme placentaire chez une femme susceptible d'être infectée par P. falciparum.The invention also provides monoclonal, polyclonal or anti-sera antibodies specifically recognizing at least one of the polypeptides and / or conjugates according to the invention. Advantageously, these antibodies will be recombinant, humanized or chimerized antibodies, in particular when they will be used as medicaments, in the context, for example, of passive immunotherapy of gestational malaria. The invention particularly covers the use of at least one element selected from polynucleotides, polypeptides, conjugates, vectors, antibodies according to the invention, for the manufacture of a medicament for the treatment of placental malaria. It also provides in vitro diagnostic methods for placental malaria in a woman who may be infected with P. falciparum.
Selon une première méthode, celle-ci comprend les étapes suivantes : a) la mise en contact, dans des conditions permettant une réaction immunologique, d'un tissu et/ou d'un fluide biologique prélevé chez la femme susceptible d'être infectée, avec un anticorps selon l'invention, afin de permettre la formation de complexe immuns ; et, b) la détection desdits complexes immuns potentiellement formes .According to a first method, it comprises the following steps: a) bringing into contact, under conditions allowing an immunological reaction, a tissue and / or a biological fluid taken from the woman likely to be infected, with an antibody according to the invention, to allow the formation of immune complexes; and, b) detecting said potentially formed immune complexes.
Un kit de diagnostic pouvant avantageusement être utilisé dans le cadre de la méthode ci-avant, est également proposé. Il comprend les éléments suivants :A diagnostic kit that can advantageously be used in the context of the method above, is also proposed. It includes the following elements:
- au moins un anticorps selon l'invention,at least one antibody according to the invention,
- des réactifs pour la constitution d'un milieu propice à une réaction de liaison entre un échantillon à tester et au moins un desdits anticorps, et,reagents for the constitution of a medium conducive to a binding reaction between a test sample and at least one of said antibodies, and
- des réactifs permettant la détection de complexes antigènes-anticorps produits par ladite liaison, ces réactifs pouvant porter un marqueur susceptible d'être reconnu par un second réactif de détection.reagents allowing the detection of antigen-antibody complexes produced by said binding, these reagents being able to carry a marker capable of being recognized by a second detection reagent.
Selon une méthode alternative, la méthode de diagnostic comprend les étapes suivantes : a) la mise en contact, dans des conditions permettant une réaction immunologique, d'un tissu et/ou d'un fluide biologique prélevé chez la femme susceptible d'être infectée, avec au moins un élément choisi parmi les polypeptides, les conjugués selon l'invention, afin de permettre la formation de complexe immuns avec les anticorps éventuellement présents dans ledit tissu et/ou ledit fluide biologique; et, b) la détection desdits complexes immuns potentiellement formés .According to an alternative method, the diagnostic method comprises the following steps: a) bringing into contact, under conditions allowing an immunological reaction, a tissue and / or a biological fluid taken from the woman likely to be infected with at least one member selected from the polypeptides, the conjugates according to the invention, to allow the formation of immune complexes with the antibodies possibly present in said tissue and / or said biological fluid; and, b) detecting said potentially formed immune complexes.
Enfin, l'invention couvre également les séquences polynucléotidiques et polypeptidiques des protéinesFinally, the invention also covers the polynucleotide and polypeptide sequences of the proteins
« PFA0700C » (SEQ ID No. 5 et 6), « PF14_0757 » (SEQ ID No. 7 et 8), « PFB0105C » (SEQ ID No. 9 et 10), « PF10_0351 » (SEQ"PFA0700C" (SEQ ID No. 5 and 6), "PF14_0757" (SEQ ID No. 7 and 8), "PFB0105C" (SEQ ID No. 9 and 10), "PF10_0351" (SEQ ID No.
ID No. 11 et 12) et « PFlO 0350 » (SEQ ID No. 13 et 14), leurs séquences homologues et leurs applications comme médicament dans le traitement du paludisme gestationnel .ID Nos. 11 and 12) and "PF10 0350" (SEQ ID Nos. 13 and 14), their homologous sequences and their applications as a drug in the treatment of gestational malaria.
D'autres caractéristiques et avantages de la présente invention ressortiront de la description faite ci-après en référence aux dessins annexés.Other features and advantages of the present invention will become apparent from the description given hereinafter with reference to the accompanying drawings.
La figure 1 est relative aux caractéristiques de transcription des isolats placentaires. Les points indiquent le Iog2 du ratio des log de l'expression (M) et de l'intensité moyenne (A) pour chaque groupe d' isolats en comparaison avec le contrôle (souche 3D7) . Seules les données statistiquement significatives selon la correction de Bonferroni sont indiquées. Un unique gène var dominant (var2csa) a été détecté dans les isolats placentaires de tous les groupes examinés (points rouges) . Les gènes surexpπmés ou sous-régulés sont indiqués en noir quand la même différence est présente dans les trois groupes, en vert quand celle-ci est présente dans 2 groupes sur 3 (2/3) et en bleu quand celle-ci est présente dans 1 groupe sur 3 (1/3) .Figure 1 relates to the transcription characteristics of placental isolates. The points indicate the Iog2 of the log ratio of the expression (M) and the mean intensity (A) for each group of isolates in comparison with the control (strain 3D7). Only statistically significant data according to the Bonferroni correction are indicated. A single dominant var gene (var2csa) was detected in placental isolates of all examined groups (red dots). Over-expressed or under-regulated genes are indicated in black when the same difference is present in the three groups, in green when it is present in 2 groups out of 3 (2/3) and in blue when this one is present in 1 in 3 groups (1/3).
La figure 2 présente les niveaux de transcription des gènes identifiés dans P. falciparum. Sont indiqués, sur le panneau de droite, les niveaux de transcription par 22 parasites isolés de placentas de femmes présentant un paludisme gestationnel (PW), 9 parasites issus d'enfants asymptomatiques (C) de moyenne d'âge 12 ans et 4 parasites de femmes symptomatiques non enceintes (NPW) vivant dans la même région. Sur le panneau de gauche, sont indiqués les niveaux de transcription des souches in vitro de P. falciparum 3D7 (losanges noirs) , FCR3 (triangles rouges) , Hb3 (losanges jaunes) et NF54 (carrés verts) . Chacune de ces 4 souches a été utilisée après sélection ou non sélection par la liaison CSA en utilisant de la CSA soluble (3D7), des cellules BeWo (FCR3 et Hb3) ou des IgGs anti-VAR2CSA (NF54) .Figure 2 shows the transcription levels of the genes identified in P. falciparum. On the right panel are the transcription levels of 22 isolated parasites of placentas of women with gestational malaria (PW), 9 parasites from asymptomatic children (C) with an average age of 12 years, and 4 parasites of Non-pregnant symptomatic women (NPW) living in the same area. On the left panel are the transcription levels of the in vitro strains of P. falciparum 3D7 (black diamonds), FCR3 (red triangles), Hb3 (yellow diamonds) and NF54 (green squares). Each of these 4 strains was used after selection or non-selection by the CSA link using soluble CSA (3D7), BeWo cells (FCR3 and Hb3) or anti-VAR2CSA IgGs (NF54).
La figure 3 illustre la reconnaissance par test ELISA, de NP561 par des sera d'individus exposés au paludisme. Le test ELISA a été mené sur des plaques couvertes par les protérnes NP561, DBL5-ε de VAR2CSA et GLURP. Les niveaux d' IgG, exprimés en densité optique, sont présentés pour des hommes Ghanéens exposés (n=30) et des femmes enceintes (n=30). Les lignes hautes, basses et au milieu des bâtons correspondent au 75ieme centile, 25ieme centile et 50ieme centile (médiane), respectivement. Les marques supérieures et inférieures s'étendent jusqu'au 90ieme et au ioieme centile. Les concentrations plasmatiques d' IgG anti-VAR2CSA et anti-NP561 sont significativement plus élevées chez la femme enceinte.Figure 3 illustrates the ELISA recognition of NP561 by sera from individuals exposed to malaria. The test ELISA was conducted on plates covered by the NP561, DBL5-ε, VAR2CSA and GLURP protectors. IgG levels, expressed as optical density, are presented for exposed Ghanaian men (n = 30) and pregnant women (n = 30). The high, low and mid sticks lines correspond to the 75 th percentile, 25 th percentile and 50 th percentile (median), respectively. The upper and lower marks extend to the 90 th and the io th percentile. Plasma concentrations of anti-VAR2CSA and anti-NP561 IgG were significantly higher in pregnant women.
La figure 4 décrit la réactivité détectée par immunoblot, d' IgG anti-NP561 de lapin vis-à-vis de lysats SDS d' érythrocytes infectés par P. falciparum (PI : isolât placentaire, Ch : isolât d'enfant). Les flèches indiquent la taille attendue de la protéine correspondant à PFI1785w.Figure 4 depicts the immunoblot-detected reactivity of rabbit anti-NP561 IgG against SDS lysates of P. falciparum-infected erythrocytes (PI: placental isolate, Ch: child isolate). The arrows indicate the expected size of the protein corresponding to PFI1785w.
La figure 5 présente une analyse par cytométrie en flux et microscopie confocale d' érythrocytes marqués avec l'IgG anti- NP561 ou avec un anticorps de contrôle non pertinent. (A) Marquage de globules rouges non infectés avec l'IgG anti-NP561 et contrôle du PBS-FCS sur les parasites placentaires. (B)Figure 5 shows a flow cytometry and confocal microscopy analysis of erythrocytes labeled with anti-NP561 IgG or with irrelevant control antibody. (A) Labeling of uninfected red blood cells with anti-NP561 IgG and control of PBS-FCS on placental parasites. (B)
Marquage des parasites placentaires avec l'IgG anti-NP561Marking placental parasites with anti-NP561 IgG
(ligne verte) et comparaison avec le contrôle négatif (PBS contenant 10% de FCS). (C) Microscopie confocale d'un érythrocyte placentaire infecté marqué avec un anticorps anti- NP561.(green line) and comparison with the negative control (PBS containing 10% FCS). (C) Confocal microscopy of an infected placental erythrocyte labeled with anti-NP561 antibody.
Les figures 6A et 6B représentent la structure de l'épissage de PFI1785w.Figures 6A and 6B show the splice structure of PFI1785w.
La figure 7, les alignements respectivement, des séquences déterminées à partir de l'ADNg de la souche 3D7 ; l'ADNg d'isolats placentaires ; l'ADNc de la souche 3D7 ; l'ADNc de l'isolât placentaire Sénégalais N42 ; l'ADNc de l' isolât placentaire Sénégalais N14 ; la séquence prédite dans plasmo DB à partir de l'ADNc de la souche 3D7 ; et la séquence consensus . Exemple 1 : Identification de nouveaux gènes présentant une spécificité pour le tropisme placentaireFigure 7, the alignments respectively, sequences determined from the gDNA strain 3D7; gDNA of placental isolates; the cDNA of strain 3D7; the cDNA of the Senegalese placental isolate N42; the cDNA of the Senegalese placental isolate N14; the sequence predicted in plasmo DB from the cDNA of strain 3D7; and the consensus sequence. Example 1 Identification of New Genes with Specificity for Placental Tropism
Matériels et méthodesMaterials and methods
Patients, collecte d'échantillons et conservation. Les échantillons ont été collectés en Novembre 2003 à Guediawaye, dans la banlieue de Dakar, Sénégal. Les directives sur les expérimentations humaines des gouvernements français et sénégalais ont été suivies. Cette étude a été approuvée par le comité d'éthique du Ministère de la Santé, Sénégal. La nature du projet a été expliquée aux femmes et leur consentement éclairé a été obtenu par oral. Des femmes enceintes ont été admises pour l'accouchement et celles dont les tests par frottis épais sanguin et/ou par immuno-chromatographie étaient positifs pour P. falciparum, ont été enrôlées. Des femmes non enceintes qui présentaient de la fièvre et dont le frottis sanguin était positif pour P. falciparum, ont également été enrôlées en tant que contrôle. Les données cliniques ont été enregistrées et 1OmL de sang périphérique ont été collectés dans de l'héparine sodique. Les globules rouges du sang périphérique ont été lavés 3 fois et incubés dans un milieu RPMI à 37°C dans une cloche à bougie (atmosphère microaérophile) pendant 18-2Oh permettant la maturation des stades anneaux en trophozoites . A l'accouchement, un frottis sanguin épais a été préparé pour un examen microscopique à partir d'appositions réalisées sur le placenta. Les érythrocytes infectés par P. falciparum ont été isolés des placentas positifs par perfusion desdits placentas avec 0,1% d'héparine sodique dans du PBS (solution saline de tampon phosphate) . Les parasites ont été conservés dans du TrizolPatients, sample collection and preservation. Samples were collected in November 2003 in Guediawaye, a suburb of Dakar, Senegal. The human experimentation guidelines of the French and Senegalese governments were followed. This study was approved by the Ethics Committee of the Ministry of Health, Senegal. The nature of the project was explained to women and their informed consent was obtained orally. Pregnant women were admitted for delivery and those whose blood smear tests and / or immuno-chromatography were positive for P. falciparum were enrolled. Non-pregnant women with fever who had a blood smear positive for P. falciparum were also enrolled as controls. Clinical data were recorded and 10mL of peripheral blood was collected in heparin sodium. The red blood cells of the peripheral blood were washed 3 times and incubated in RPMI medium at 37 ° C in a candle bell (microaerophilic atmosphere) for 18-2Oh allowing the maturation of the ring stages in trophozoites. At delivery, a thick blood smear was prepared for microscopic examination from placenta appositions. P. falciparum-infected erythrocytes were isolated from positive placentas by infusion of said placentas with 0.1% heparin sodium in PBS (phosphate buffer saline). The parasites were kept in Trizol
(Invitrogen) et entreposé à -800C ou ont été déposés sur papier Whatman, séchés et entreposés à température ambiante, jusqu'aux extractions d'ARN et d'ADN. Le plasma a été séparé du sang périphérique et entreposé à -20°C jusqu'à utilisation.(Invitrogen) and stored at -80 0 C or deposited on Whatman paper, dried and stored at room temperature, to RNA and DNA extractions. Plasma was separated from peripheral blood and stored at -20 ° C until use.
Durant la même période, des échantillons de sang veineux ont été collectés à partir d'enfants infectés ne présentant pas de symptômes, et ceci dans le cadre d'une étude transversale menée en parallèle dans les environs de Thiès, au Sénégal. Les échantillons ont été collectés selon les mêmes protocoles ci- avant décrits .During the same period, venous blood samples were collected from non-symptomatic infected children in a parallel cross-sectional study in the Thiès area of Senegal. The samples were collected according to the same protocols described above.
Tests de cytoadhésion. De la CSA bovine (Sigma) et des protéoglycanes à chondroitine sulfate (CSPG) humaines ont été déposés sous forme de tâches circulaires dans des boîtes de Pétri de type Falcon (Becton Dickmson) et le niveau d'adhésion à la CSA et au CSPG des parasites placentaires a été quantifié selon le nombre d' érythrocytes infectés observé par millimètre carré, estimé par l'examen de 20 champs au microscope fort grossissement (20 fois) .Cytoadhesive tests. Bovine CSA (Sigma) and human chondroitin sulfate proteoglycans (CSPGs) were deposited as circular tasks in Falcon Petri dishes (Becton Dickmson) and the level of adherence to CSA and CSPG of Placental parasites were quantified according to the number of infected erythrocytes observed per square millimeter, estimated by examination of 20 fields under a high magnification microscope (20 times).
Culture des parasites et sélection de phénotypes particuliers .Culture of parasites and selection of particular phenotypes.
Les souches de P. falciparum ont été cultivées selon les protocoles précédemment décrits (Trager et Jensen, 1976). La souche 3D7 a été synchronisée au sorbitol 4 fois avec un intervalle de 8 heures afin d'obtenir des stades de développement particulièrement bien synchronisés. Les souches FCR3 et HB3 ont été sélectionnées en fonction de leur adhésion au CD36 ou aux cellules Bewo . La souche NF54 a été sélectionnée à l'aide d'anticorps spécifiques de la protéine PfEMPl codée par le gène var2csa. La souche 3D7 a également été sélectionnée selon son adhésion à la CSA immobilisée. Après sélection, les parasites ont été cultivés durant 5 à 6 cycles pour générer une densité de parasites suffisante. L'enrichissement en cellules matures est effectué par purification Macs telle que décrit précédemment (Staalsoe et al., 1999) . Les parasites sont autorisés à contaminer une nouvelle fois de nouveaux globules rouges et sont ensuite récupérés à 18, 36 et 44h après l'invasion. La reconnaissance sexospécifique des parasites sélectionnés a été mesurée par cytométrie en flux en utilisant des échantillons de plasma issus de femmes enceintes et d'hommes adultes originaires de zone endémique, ainsi que des échantillons de volontaires danois non immuns (contrôle) .Strains of P. falciparum were grown according to previously described protocols (Trager and Jensen, 1976). The strain 3D7 was synchronized with sorbitol 4 times with an interval of 8 hours in order to obtain particularly well synchronized development stages. Strains FCR3 and HB3 were selected according to their adhesion to CD36 or Bewo cells. The strain NF54 was selected using antibodies specific for the PfEMP1 protein encoded by the var2csa gene. The strain 3D7 was also selected according to its adhesion to the immobilized CSA. After selection, the parasites were cultured for 5-6 cycles to generate sufficient parasite density. The enrichment in mature cells is carried out by Macs purification as previously described (Staalsoe et al. al., 1999). The parasites are allowed to re-contaminate new red blood cells and are then recovered at 18, 36 and 44 hours after the invasion. Gender-specific recognition of the selected parasites was measured by flow cytometry using plasma samples from pregnant women and adult men from endemic areas, as well as samples of non-immune Danish volunteers (control).
Extractions ADN et ARN totaux. L'ADN génomique a été extrait des dépôts sur papier Whatman à l'aide de la procédure ChelexTotal DNA and RNA extractions. Genomic DNA was extracted from Whatman's paper deposits using the Chelex procedure
(Plowe et al., 1995). L'ARN total issu d' érythrocytes infectés de placenta et de sang périphérique mature, contenant des parasites aux stades trophozoites/schizontes, a été préparé avec du Trizol. La qualité de l'ARN a été vérifiée avec le Bioanalyseur Agilent 2100.(Plowe et al., 1995). Total RNA from placenta-infected erythrocytes and mature peripheral blood containing trophozoite / schizont stage parasites was prepared with Trizol. The quality of the RNA has been verified with the Agilent 2100 Bioanalyzer.
Génotypage msp-2. Les parasites ont été génotypes par analyse du domaine central de msp-2. L'amplification par PCR a été menée comme décrit précédemment (Jafary et al., 2004) en utilisant les amorces fw (SEQ ID No. 15) :5'- GAAGGTAATTAAAACATTGTC-3' (5' étant marqué à la fluorescéme) et rv (SEQ ID No. 16) : 5' -GACACCTCGTCGTTGTAGGGAG-3' . Les produits d'amplification sont passés à l'analyseur ABI Prism 310 Genetic (Perkin Elmer Applied Biosystems) pour énumérer et quantifier les fragments fluorescents.Genotyping msp-2. The parasites were genotyped by analysis of the central msp-2 domain. The PCR amplification was carried out as previously described (Jafary et al., 2004) using primers fw (SEQ ID No. 15): 5'-GAAGGTAATTAAAACATTGTC-3 '(5' being fluorescein labeled) and rv (SEQ ID No. 16): 5'-GACACCTCGTCGTTGTAGGGAG-3 '. The amplification products are passed to the ABI Prism 310 Genetic Analyzer (Perkin Elmer Applied Biosystems) to enumerate and quantify the fluorescent fragments.
Biopuces. Les biopuces utilisées dans cette étude sont décrites dans Ralph et al., 2005. En résumé, la bibliothèque d' oligonucléotides comporte 8870 70-mers provenant du Malaria Oligo Set (Qiagen-Operon) et des oligonucléotides personnalisés, couvrant la plupart des gènes de P. falciparum. Des échantillons d'ARN de 18 femmes ont été assemblés en trois groupes et le contrôle (3D7) constitué d'un mélange de différents stades de développement des parasites a été préparé (tableau 1). L' intégrité des transcrits d'ARN de chaque échantillon a été vérifiée avec le Bioanalyseur Agilent 2100. Le marquage et l'hybridation des échantillons d'ARN ont été réalisés selon des protocoles décrits précédemment (Ralph et al., 2005) .Biochips. The biochips used in this study are described in Ralph et al., 2005. In summary, the oligonucleotide library comprises 8870 70-mers from the Malaria Oligo Set (Qiagen-Operon) and custom oligonucleotides, covering most of the P. falciparum. RNA samples from 18 women were assembled into three groups and the control (3D7) consisted of a mixture of different stages of parasite development was prepared (Table 1). The integrity of the RNA transcripts of each sample was verified with the Agilent 2100 Bioanalyzer. The labeling and hybridization of the RNA samples were performed according to previously described protocols (Ralph et al., 2005).
Tableau 1Table 1
% anneaux % trophozoïtes % schizontes nombre d'isolats groupe 1 <5 70 >25 3 groupe 2 <5 >25 70 7 groupe 3 15 0 >95 8% rings% trophozoites% schizonts number of isolates group 1 <5 70> 25 3 group 2 <5> 25 70 7 group 3 15 0> 95 8
Contrôle (3D7) 10 45 45Control (3D7) 10 45 45
Données relatives aux isolats placentaires et 3D7 examines par biopuces : pourcentage de l'état de développement de chaque parasite en fonction du groupe d'ARNData on placental and 3D7 isolates examined by biochips: Percentage of the state of development of each parasite according to the RNA group
Pour chaque ensemble de parasites placentaires, une inversion des marqueurs (dye-swap) a été réalisée sur deux répétitions techniques et deux répétitions biologiques afin de compenser l'effet des marqueurs et pour vérifier la reproductibilité technique et biologique, fournissant ainsi quatre lames hybπdées . Chaque répétition biologique a été analysée séparément en utilisant la fonction R (The R project) et le kit « Bioconductor package » (Gentleman et al., 2004) comme décrit précédemment (Ralph et al., 2005) . Après normalisation, un test t de Student apparié a ete utilisé pour vérifier les points exprimes différentiellement et les valeurs de p ont ensuite été corrigées a l'aide de la méthode Bonferroni avec une erreur de type 1 de 0,05. Tous les Iog2 des ratios des intensités de fluorescence sont présentes de la manière suivante : ensemble des parasites placentaires versus ensemble contrôle 3D7. Elaboration des amorces et rt-PCR quantitative en temps réel.For each set of placental parasites, a dye-swap was performed on two technical repeats and two biological replicates to compensate for the effect of the markers and to verify the technical and biological reproducibility, thus providing four hybbed blades. Each biological repeat was analyzed separately using the R function (The R project) and the "Bioconductor package" kit (Gentleman et al., 2004) as previously described (Ralph et al., 2005). After normalization, a paired Student's t test was used to check the differentially expressed points and the p values were then corrected using the Bonferroni method with a Type I error of 0.05. All IOG 2 ratios of the fluorescence intensities are present as follows: all placental parasites versus all 3D7 control. Elaborate primers and quantitative RT-PCR in real time.
Les gènes qui ont été exprimés dif f erentiellement m vivo sont comparés à l'expression d'un contrôle (souche in vitro 3Ol) , ce contrôle étant composé d'un mélange de parasites différents stades de développement mimant la distribution des isolats.Genes that have been expressed differentially in vivo are compared to the expression of a control (in vitro strain 301), this control being composed of a mixture of parasites of different developmental stages mimicking the distribution of the isolates.
Pour les 19 gènes sélectionnés en premier lieu en fonction du taux des produits de transcription (tableau 2) , des sondes pour PCR en temps réel spécifiques des gènes ont été élaborées à partir des séquences de la lignée 3D7. L'efficacité de l'amplification spécifique par les amorces a été testée sur des dilutions en série d'ADNg de 3 isolats de laboratoire (3D7, FCR3 et HB3) et 3 isolats de terrains différents. La spécificité a ensuite été confirmée par analyse de la courbe de dénaturation thermique et électrophorèse sur gel d'agarose. Les sondes spécifiques de var2csa précédemment décrites ont été utilisées (Tuikue Ndam et al., 2005) .For the 19 genes initially selected based on the level of the transcripts (Table 2), gene-specific real-time PCR probes were developed from the sequences of the 3D7 line. The efficiency of the specific amplification by the primers was tested on serial dilutions of gDNA from 3 laboratory isolates (3D7, FCR3 and HB3) and 3 different field isolates. Specificity was then confirmed by analysis of the thermal denaturation curve and agarose gel electrophoresis. The previously described var2csa-specific probes have been used (Tuikue Ndam et al., 2005).
Tableau 2Table 2
Nombre total de gènes qui sont exprimes diff erentiellement dans des isolats de parasites m vivo en comparaison avec le contrôle m vitro 3D7 compose de mélange similaire de parasites a différents stades de développement. Le nombre d'oligonucleotides utilises et le nombre de gènes codant pour des protéines hypothétiques sont également indiques.Total number of genes that are differentially expressed in isolates of parasites in vivo compared to 3D7 in vitro control composed of a similar mixture of parasites at different stages of development. The number of oligonucleotides used and the number of genes encoding hypothetical proteins are also indicated.
Pour la PCR en temps réel, l'extraction d'ARN en tπzol est suivie par un traitement de 15 min par la DNase 1 (Sigma) à 37°C. L'absence de contaminant ADN dans la préparation a été vérifiée a l'aide de 40 cycles de PCR en temps réel en utilisant des amorces spécifiques d'un gène domestique conserve (f ructose-biphosphate aldolase) . L'ARN libre d'ADN a été transcrit par transcription inverse en utilisant des amorces aléatoires avec l'enzyme Superscript II (Invitrogen) à 25°C pendant 10 min, puis a 42°C pendant 50 min suivi d'un cycle à 700C pendant 15 min.For real-time PCR, RNA extraction in tπzol is followed by a 15 min treatment with DNase 1 (Sigma) at 37 ° C. The absence of DNA contaminant in the preparation was verified using 40 cycles of real-time PCR using primers specific for a conserved housekeeping gene (f ructose-biphosphate aldolase). DNA-free RNA has was transcribed by reverse transcription using random primers with the enzyme Superscript II (Invitrogen) at 25 ° C for 10 min, then at 42 ° C for 50 min followed by a cycle at 70 0 C for 15 min.
La PCR quantitative en temps réel a été réalisée sur de l'ADNc en utilisant le système Rotorgene thermocycler (Corbett Research) (Salanti et al., 2003) . Les réactions ont été faites dans des volumes de 20 μL en utilisant Quantitect SYBR Green PCR Master Mix (Qiagen) et 0,5 mM d'amorces (Salanti et al., 2003) . L'analyse quantitative du niveau de gène a été effectuée à l'aide du logiciel Rotorgene version 4.6. Les taux des produits de transcription ont été comparés à l'aide des valeurs de ΔCt calculées en utilisant le niveau de transcription du gène fructose-biphosphate aldolase comme contrôle endogène.Real-time quantitative PCR was performed on cDNA using the Rotorgene thermocycler system (Corbett Research) (Salanti et al., 2003). Reactions were made in 20 μL volumes using Quantitect SYBR Green Master PCR Mix (Qiagen) and 0.5 mM primers (Salanti et al., 2003). Quantitative gene level analysis was performed using the Rotorgene version 4.6 software. Rates of transcripts were compared using ΔCt values calculated using the transcription level of the fructose-bisphosphate aldolase gene as an endogenous control.
Les différences entre les groupes d'échantillons étudiés par rt-PCR en temps réel ont été vérifiées par un test non paramétrique (test de la somme des rangs de deux échantillons de Mann-Whitney ou test des rangs appliqués au cas d'échantillons appariés de Wilcoxon) . Les corrélations ont été vérifiées par le test de la somme des rangs de Spearman. La limite significative est P=O, 05. Le logiciel STATA (version 7.0, STATA Corporation) a été utilisé.The differences between the groups of samples studied by rt-PCR in real time were verified by a nonparametric test (test of the sum of the ranks of two samples of Mann-Whitney or test of ranks applied to the case of samples paired with Wilcoxon). Correlations were verified by Spearman's rank sum test. The significant limit is P = 0.05. The STATA software (version 7.0, STATA Corporation) was used.
Protéines recombinantes et immunisation.Recombinant proteins and immunization.
La protéine prédite par PlasmoDB codée par le gène PFI1785w du génome du clone 3D7 de P. falciparum, a été sélectionnée pour être exprimée en tant que protéine soluble. Le produit de ce gène est une protéine de 332 acides aminés avec un domaine transmembranaire s' étendant de l'acide aminé 41 à l'acide aminé 69 et un motif pexel localisé entre les acides aminés 86 et 92. Après exclusion du domaine transmembranaire, la séquence allant de la paire de bases 391 à la paire de bases 967 est amplifiée à partir de l'ADNg de 3D7 en utilisant les amorces suivantes, qui incluent les sites de restriction EcoRl et Notl en 5' et en 3' respectivement : Fw (SEQ ID No. 17) : cggaattcCAATCAAGATATAATAGATCA ; Rv (SEQ ID No. 18): atttgcggccgcCGGTTTTACCCTTATAATG . L' insert est clone dans le plasmide pGEX-4T-l (Amersham Biosciences, Danemark) pour la production de protéine recombinante glutathion S-transférase-marquée dans la souche Escherichia coli BL21. La même séquence est également sous- clonée dans les sites de restriction Notl et EcoRl du vecteur pBAD-TOPO conçu au laboratoire (Barfod et al., 2006) et les protéines recombinantes sont produites dans des cellules d' insectes infectées avec le baculovirus et sont ensuite purifiées comme décrit précédemment (Salanti et al., 2004). La protéine recombinante purifiée appelée NP561, correspondant environ à 70% de la taille complète de la protéine PFI1785w, a été utilisée comme immunogène dans cette étude. Des anticorps de lapin spécifiques ont été induits comme décrit précédemment (Salanti et al., 2004) et purifiés par affinité à l'aide de colonne où a été fixée le recombinant NP561. En bref, NP561 a été couplée de manière covalente via des groupes aminés primaires à une colonne HiTrap™ NHS-activé sépharose et les anticorps de lapin ont été purifiés selon les instructions du fabricant.The PlasmoDB predicted protein encoded by the PFI1785w gene of the P. falciparum clone 3D7 genome was selected to be expressed as a soluble protein. The product of this gene is a protein of 332 amino acids with a transmembrane domain extending from amino acid 41 to amino acid 69 and a pexel motif located between amino acids 86 and 92. After exclusion of the transmembrane domain, the sequence from base pair 391 to base pair 967 is amplified from 3D7 gDNA using the following primers, which include EcoRI and NotI restriction sites at 5 'and 3' respectively: Fw ( SEQ ID No. 17): cggaattcCAATCAAGATATAATAGATCA; Rv (SEQ ID No. 18): atttgcggccgcCGGTTTTACCCTTATAATG. The insert is cloned into plasmid pGEX-4T-1 (Amersham Biosciences, Denmark) for the production of recombinant glutathione S-transferase-labeled protein in Escherichia coli strain BL21. The same sequence is also subcloned into the NotI and EcoR1 restriction sites of the pBAD-TOPO vector designed in the laboratory (Barfod et al., 2006) and the recombinant proteins are produced in baculovirus-infected insect cells and are then purified as previously described (Salanti et al., 2004). The purified recombinant protein designated NP561, corresponding to approximately 70% of the complete size of the PFI1785w protein, was used as an immunogen in this study. Specific rabbit antibodies were induced as described previously (Salanti et al., 2004) and affinity purified using a column where the recombinant NP561 was fixed. Briefly, NP561 was covalently coupled via primary amino groups to a HiTrap ™ NHS-activated Sepharose column and the rabbit antibodies were purified according to the manufacturer's instructions.
Dosage d'anticorps plasmatiques vis-à-vis de NP561 par test ELISA.Assay of plasma antibodies against NP561 by ELISA test.
Les niveaux plasmatiques d' IgG spécifiques de P. falciparum ont été mesurés par test ELISA utilisant les protéines recombinantes VAR2CSA et NP561 comme antigènes. La protéine recombinante GLURP a été utilisée comme antigène de contrôle. Les niveaux d' anticorps sont exprimés en valeur de densité optique (OD) . Caractérisation des anticorps par immunodétection par transfert électrophorétique (Iinmunoblot) .Plasma levels of P. falciparum specific IgG were measured by ELISA using recombinant proteins VAR2CSA and NP561 as antigens. The recombinant GLURP protein was used as a control antigen. Antibody levels are expressed as optical density (OD) values. Characterization of antibodies by immunodetection by electrophoretic transfer (Iinmunoblot).
Les échantillons utilisés dans cette étude ont été collectés à l'hôpital de district de Korogwe, en Tanzanie, en Juin 2006, en suivant les mêmes protocoles que ceux décrit ci-avant. Après maturation des parasites isolés du sang périphérique d'enfants, les érythrocytes infectés par des parasites de stades schizontes ou trophozoites tardifs sont enrichis par purification sur colonne magnétique (Macs) (Staalsoe et al., 1999) . Des extraits protéiques d' érythrocytes infectés ont été préparés dans du PBS comportant 2% de SDS et un inhibiteur complet de protéases (Roche, Bâle, Suisse) . Les protéines issues des isolats ont été révélées à l'aide de gels pré- coulés NuPAGE à gradient 4-12% en SDS (Invitrogen, Tâstrup,The samples used in this study were collected at District Hospital Korogwe, Tanzania, in June 2006, following the same protocols as described above. After maturation of parasites isolated from peripheral blood of children, erythrocytes infected with schizont stage parasites or late trophozoites are enriched by magnetic column purification (Macs) (Staalsoe et al., 1999). Protein extracts of infected erythrocytes were prepared in PBS containing 2% SDS and a complete protease inhibitor (Roche, Basel, Switzerland). Proteins from the isolates were revealed using NuPAGE gradient 4-12% gradient SDS gels (Invitrogen, Tastrup,
Danemark) avec un tampon de migration NuPAGE MOPS SDSDenmark) with NuPAGE MOPS SDS migration buffer
(Invitrogen) en utilisant des marqueurs colorés de poids moléculaires à large spectre (BioRad, Herlev, Danemark) . Après électrotransfert à sec sur membrane polyvinylidène difluorure (PVDF) en présence d'un tampon comportant 20% de méthanol, 25mM de Tris et 192 mM de glycine à un pH de 8,4, les membranes sont bloquées avec 5% de lait demi-écrémé en poudre diluée dans un tampon TBS-T. Les membranes sont incubées avec les anticorps de lapin dirigés contre NP561 ou contre une protéine PfEMPl VAR4 , obtenue avant et après purification par affinité, cette incubation étant suivie par une deuxième incubation avec un deuxième anticorps conjugué à la peroxydase et dirigé contre les IgG de lapin (Sigma, MO, USA) et révélé à l'aide d'une solution de 3-ammo-9-éthylcarbazole .(Invitrogen) using broad-spectrum molecular weight color markers (BioRad, Herlev, Denmark). After dry electrotransfer on a polyvinylidene difluoride (PVDF) membrane in the presence of a buffer comprising 20% methanol, 25 mM Tris and 192 mM glycine at a pH of 8.4, the membranes are blocked with 5% of half-weight milk. skimmed powder diluted in TBS-T buffer. The membranes are incubated with the rabbit antibodies directed against NP561 or against a PfEMP1 VAR4 protein, obtained before and after affinity purification, this incubation being followed by a second incubation with a second antibody conjugated to peroxidase and directed against rabbit IgG. (Sigma, MO, USA) and revealed using a solution of 3-ammo-9-ethylcarbazole.
Dosage d' iinmunofluorescence et cytométrie de flux. Les anticorps polyclonaux dirigés contre NP561 sont purifiés par affinité à partir de sérums de lapins hyperimmuns et d'un groupe d'échantillons de plasma issus de femmes souffrant d' infection placentaire et leur réactivité a été testée sur la surface d' erythrocytes infectés matures issus d'isolats d'enfant et d'isolats placentaires de Tanzanie. La réactivité des anticorps avec la surface d' erythrocytes infectés en phase liquide a été ensuite vérifiée par microscopie confocale, à l'aide d'un microscope LSM5 (Cari Zeiss Microlmagming, Inc.)Immunofluorescence assay and flow cytometry. The polyclonal antibodies against NP561 are affinity purified from hyperimmune rabbit sera and a group of plasma samples from women suffering from of placental infection and their reactivity was tested on the surface of mature infected erythrocytes from childhood isolates and placental isolates from Tanzania. The reactivity of the antibodies with the surface of infected erythrocytes in the liquid phase was then verified by confocal microscopy, using an LSM5 microscope (Carl Zeiss Microlmagming, Inc.).
(Salanti et al., 2004). Les anticorps purifies ont également été étudiés par cytométπe en flux (Staalsoe et al., 1999) en fonction de la réactivité des IgG avec la surface d' erythrocytes infectés intacts et non-immobilisés, isolés à partir de placenta et de sang périphérique d'un enfant de(Salanti et al., 2004). Purified antibodies were also studied by flow cytometry (Staalsoe et al., 1999) as a function of IgG reactivity with the surface of intact and non-immobilized infected erythrocytes isolated from placenta and peripheral blood. a child of
Tanzanie .Tanzania.
RésultatsResults
Identification de gènes transcrits différentiellement dans les parasites PAM et comparaison avec le contrôle 3D7.Identification of differentially transcribed genes in PAM parasites and comparison with 3D7 control.
Afin d'évaluer l'équilibre dynamique des niveaux d'expression des ARNm de P. falciparum infectant des femmes enceintes, des parasites ont été collectés à partir de placentas de femmes accouchant au Sénégal, comme décrit précédemment (Tuikue Ndam et al., 2005) . Des examens microscopiques ont montré la prédominance de globules rouges infectés par des stades tardifs dans tous les isolats, avec des stades anneaux précoces représentant généralement moins de 5% de la population totale. A cause de la distribution variable des stades tardifs (trophozoites et schizontes) dans les différents isolats, les échantillons ont été séparés en trois groupes comme indiqués dans le tableau 1. L'ARN total a été isolé individuellement de chaque échantillon. Les ARN correspondant à tous les échantillons d'un même groupe ont été regroupés en mélangeant des quantités égales d'ARN. De manière similaire, les ARN issus de différents stades de développement de la souche 3D7 ont été regroupés pour mimer la distribution des stades dans les isolats placentaires. Les groupements d'échantillons d'ARN ont été marqués par fluorescence et soumis à hybridation avec un réseau d' oligonucléotides haute densité (Ralph et al., 2005). Pour chaque groupement de parasites placentaires, une inversion des marqueurs est réalisée. La méthode de Bonferroni, la plus stπngente, a montre que 183 gènes étaient surexpπmés dans les parasites placentaires et 261 gènes étaient sous-expπmés . Parmi les gènes surexpπmés dans les parasites PAM, 99 appartiennent au groupe 1, 67 au groupe 2 et 85 au groupe 3. La majorité de ces gènes (108 sur 183) correspond à des protéines hypothétiques. 20 d'entre eux comportent un motif pexel.In order to evaluate the dynamic balance of expression levels of P. falciparum mRNAs infecting pregnant women, parasites were collected from placentas of women delivering in Senegal, as previously described (Tuikue Ndam et al., 2005). ). Microscopic examinations showed the predominance of late-stage red blood cells in all isolates, with early ring stages generally accounting for less than 5% of the total population. Due to the variable distribution of late stages (trophozoites and schizonts) in the different isolates, the samples were separated into three groups as shown in Table 1. The total RNA was isolated individually from each sample. The RNAs corresponding to all the samples of the same group were pooled by mixing equal amounts of RNA. Similarly, RNAs from different stages of development of strain 3D7 have been grouped together to mimic the distribution stages in placental isolates. The RNA sample pools were fluorescently labeled and hybridized with a high density oligonucleotide array (Ralph et al., 2005). For each group of placental parasites, a reversal of the markers is performed. Bonferroni's method, the most recent one, showed that 183 genes were overexposed in placental parasites and 261 genes were under-expelled. Of the genes overexpressed in PAM parasites, 99 belong to group 1, 67 to group 2 and 85 to group 3. The majority of these genes (108 out of 183) correspond to hypothetical proteins. 20 of them have a pexel pattern.
En dépit des différences de distribution des stades tardifs de développement des parasites entre les 3 groupes d'échantillons d'ARN, certains gènes présentent de manière constante le même profil d'expression différentielle dans les trois groupesDespite differences in the distribution of late stages of parasite development between the 3 groups of RNA samples, some genes consistently exhibit the same differential expression pattern in all three groups
(surexpπmés N = 18 ; sous-exprimés N = 16) . Ces gènes étaient généralement ceux présentant les transcrits les plus abondants, détectés à la fois dans les échantillons analysés et dans le contrôle 3D7. Pour certains transcrits, l'expression différentielle a ete détectée dans deux des trois groupes (surexpπmés N = 20 ; sous-exprimés N = 30). Cependant, la présente analyse a démontré que bien que d'autres gènes var aient été également détectés (notamment varCS2) , var2csa était le transcrit prédominant surexpπmé dans les trois groupes. Comme exemplifié par la transcription spécifique et cohérente de var∑csa, les gènes qui sont surexprimes dans plus d'un groupe, sont plus susceptibles d'être associés avec des éléments biologiques avantageux présents spécifiquement dans les parasites étudiés. Ces gènes(overexpressed N = 18, under-expressed N = 16). These genes were generally those with the most abundant transcripts, detected both in the analyzed samples and in the 3D7 control. For some transcripts, the differential expression was detected in two of the three groups (overexposed N = 20, subdexed N = 30). However, the present analysis demonstrated that although other var genes were also detected (notably varCS2), var2csa was the predominant transcript overexposed in all three groups. As exemplified by the specific and consistent transcription of varΣcsa, genes that are overexpressed in more than one group, are more likely to be associated with beneficial biological elements present specifically in the parasites being studied. These genes
(surexprimes N = 38 ; sous-exprimés N = 46) sont présentés dans le tableau 2. Pour un grand nombre de gènes identifiés(overexpressed N = 38, under-expressed N = 46) are shown in Table 2. For a large number of identified genes
(PAM-surexpπmés N = 153 ; 3D7-surexpπmés N = 234), une différence significative a seulement été observée pour un groupe (Fig. 1). La plupart des différences observées dans cette catégorie rend peut être compte d'un regroupement des expressions entre les différents stades de développement, favorisé par le contrôle utilisé, étant donné que de nombreux gènes surexpπmés dans le PAM ont été trouves dans le groupe 1 (prédominance de trophozoites) alors que la plupart des gènes surexpπmés dans 3D7 ont été identifiés dans le groupe 3 (schizontes) , leur profil d'expression pouvant aussi présenter une certaine spécificité aux procédés biologiques m vivo et in vitro. Par exemple, la surexpression spécifique par des parasites placentaires de gènes codant pour des antigènes asexués tels que AMAl, MSPl, MSP3, MSP5, MSP6, EBA140 qui sont supposés être impliqués dans l'invasion des globules rouges, tombe dans cette catégorie.(PAM-overexpanded N = 153, 3D7-overexpressed N = 234), a significant difference was only observed for one group (Fig. 1). Most of the differences observed in this category may account for a grouping of expressions between different stages of development, favored by the control used, since many genes overexpressed in MAP were found in group 1 (predominance while most genes overexposed in 3D7 have been identified in group 3 (schizonts), their expression profile may also have some specificity to biological processes in vivo and in vitro. For example, specific overexpression by placental parasites of genes encoding asexual antigens such as AMA1, MSP1, MSP3, MSP5, MSP6, EBA140 that are thought to be involved in the invasion of red blood cells falls into this category.
Validation des résultats sur biopuces par PCR en temps réelValidation of results on biochips by PCR in real time
Afin de confirmer la pertinence des résultats sur biopuces, la quantification relative des ARN correspondant aux 19 gènes exprimés différentiellement avec des variations de niveau tels qu'estimés par le réseau d' oligonucléotides, a été effectuée.In order to confirm the relevance of the results on microarrays, the relative quantification of the RNAs corresponding to the 19 genes differentially expressed with level variations as estimated by the oligonucleotide network, was carried out.
Les gènes ont été choisis a partir de l'abondance de leur transcrits, qui varie de forte à faible. Des critères additionnels comprennent : î) être surexpπmé de manière constante sur 2 des 3 groupes, n) comporter au moins un motif TM, pexel et/ou séquence signal, m) être également présent dans une autre analyse par biopuce utilisant des isolats du laboratoire sélectionnés pour leur phénotype spécifique.The genes were chosen from the abundance of their transcripts, which varies from strong to weak. Additional criteria include: 1) be overexposed steadily to 2 of the 3 groups, n) have at least one TM, pexel and / or signal sequence, m) be also present in another biochip analysis using laboratory isolates selected for their specific phenotype.
Les gènes surexpπmés dans les parasites PAM ont été hiérarchisés (voir tableau 2) . Une PCR en temps réel a été réalisée sur des cDNA synthétisés à partir des ARN totaux de chaque groupe d'échantillons et à partir de chaque échantillon individuel de parasite compris dans le groupe. Dans l'ensemble, la PCR en temps réel a confirmé les données obtenues sur les biopuces, puisqu'une bonne corrélation entre les résultats a été obtenue. Test de corrélation de Spearman après transformation logarithmique des données : r=0,78, p<0,0001) comme indiqué dans le tableau 3 ci-dessous :Genes overexpressed in PAM parasites were prioritized (see Table 2). Real-time PCR was performed on cDNAs synthesized from the total RNAs of each group of samples and from each individual sample of parasite included in the group. Overall, real-time PCR confirmed the data obtained on the biochips, since a good correlation between the results was obtained. Spearman correlation test after logarithmic transformation of the data: r = 0.78, p <0.0001) as shown in Table 3 below:
Tableau 3Table 3
Confirmation par PCR quantitative en temps réel de l'expression m vivo des ADNc pour les 19 gènes différents. Les valeurs sont exprimées en ratio par rapport au contrôle (souche m vitro 3D7) compose d'un mélange de parasite a différents stades de développement afin de mimer celui des isolats.Real-time quantitative PCR confirmation of m vivo expression of cDNAs for the 19 different genes. The values are expressed as a ratio relative to the control (in vitro strain 3D7) composed of a mixture of parasite at different stages of development in order to mimic that of the isolates.
Validation biologique des résultats sur biopucesBiological Validation of Biochip Results
Afin de vérifier la pertinence biologique des résultats, l'abondance des transcrits des 19 gènes sélectionnés a été déterminée par PCR en temps réel dans des parasites associés à différentes présentations cliniques d' infection par le paludisme. Les parasites ont été collectés à partir d'enfants asymptomatiques et de femmes non enceintes présentant des symptômes, vivant dans une zone géographique proche de l'Ouest du Sénégal sur un intervalle de temps court par rapport aux échantillons placentaires. L'abondance des transcrits correspondant aux 19 gènes a été mesurée sur des parasites ayant atteint un degré de maturation et de développement approximativement identique à ceux des parasites issus des placentas. L'abondance des transcrits des 19 gènes a également été mesurée sur des lignées de parasites adaptées au laboratoire et sélectionnées pour leur phénotype capable de se lier ou non à la CSA. Comme escompté, var2csa présente un profil spécifique de PAM dans les isolats ainsi qu'une spécificité marquée pour les isolats de laboratoire sélectionnés pour leur liaison à la CSA (Salanti et al., 2003), (Fig. 2, panneau de droite) . En examinant les profils de transcription des parasites de différents syndromes de paludisme, 4 catégories de profil de transcription ont pu être définies : î) forte expression dans les parasites PAM (montrés enTo verify the biological relevance of the results, the abundance of transcripts from the 19 selected genes was determined by real - time PCR in parasites associated with different clinical presentations of malaria infection. Parasites were collected from asymptomatic children and non-pregnant women with symptoms, living in a geographical area close to western Senegal on a short time interval compared to placental samples. The abundance of transcripts corresponding to the 19 genes was measured on parasites having reached a degree of maturation and development approximately identical to those of parasites derived from placentas. The abundance of transcripts of the 19 genes was also measured on laboratory-adapted parasite lines selected for their phenotype capable of binding to the CSA or not. As expected, var2csa has a specific PAM profile in the isolates as well as a marked specificity for the laboratory isolates selected for their binding to the CSA (Salanti et al., 2003), (Fig. 2, right panel). By examining the transcription patterns of parasites of different malaria syndromes, 4 categories of transcription profiles could be defined: (i) high expression in PAM parasites (shown in
Fig. 2A), n) forte expression dans les parasites non-PAM (montrés enFig. 2A), n) strong expression in non-PAM parasites (shown in
Fig. 2B), m) forte expression dans les parasites provenant de femmes présentant des symptômes et de femmes enceintes mais pas d'enfants asymptomatiques (montrés en Fig. 2C), îv) aucune différence dans l'expression parmi tous les groupes de parasites m vivo (non montrés) .Fig. 2B), m) high expression in parasites from women with symptoms and pregnant women but no asymptomatic children (shown in Fig. 2C), iv) no difference in expression among all groups of parasites in vivo (not shown)
Pour tous les gènes se regroupant dans la première catégorie sauf var2csa, la transcription spécifique ne peut être associée avec des propriétés de liaison à la CSA présentées par les lignées parasites sélectionnées m vitro au laboratoire (Fig. 2, panneau de droite) . Cependant, un gène, PFI1785w, codant pour une protéine hypothétique présente un profil clairement spécifique de PAM, similaire à celui de var2csa . De manière surprenante, aucune différence n'a été observée dans les différentes lignées in vitro adaptées au laboratoire sélectionnées pour leurs phénotypes spécifiques de liaison, contrairement à var2csa (Fig. 2, panneau de droite) . PFI1785w code pour une protéine de 39,4 kD dont il est prédit qu'elle exprime une molécule unique comportant un domaine TM et une séquence pexel qui dirige la protéine vers l' export. Il est également prédit que la protéine a une expression de surface avec un domaine N-terminal court. La surexpression spécifique de ce gène par des isolats placentaires et non par des parasites non-PAM, ni par des lignées de laboratoire in vitro sélectionnées pour leur adhérence à la CSA, soulève un intérêt particulier pour une caractéπsation plus poussée. D'un autre côté, un profil spécifique clair et opposé a été observé pour PF10_0350, qui est fortement transcrit dans des parasites non-PAM par rapport aux parasites placentaires. Le produit de ce gène est prédit comme ayant une expression de surface, puisqu'il possède un domaine transmembranaire, mais aucun motif pexel qui vise un ciblage à la surface des globules rouges.For all genes in the first category except var2csa, specific transcription can not be associated with CSA binding properties presented by parasite lines selected in vitro in the laboratory (Fig. 2, right panel). However, a gene, PFI1785w, encoding a hypothetical protein has a clearly specific PAM profile, similar to that of var2csa. Surprisingly, no difference was observed in the different laboratory-adapted in vitro lines selected for their specific binding phenotypes, in contrast to var2csa (Fig. 2, right panel). PFI1785w encodes a 39.4 kD protein that is predicted to express a single molecule with a TM domain and a pexel sequence that directs the protein to export. It is also predicted that the protein has a surface expression with a short N-terminal domain. The specific overexpression of this gene by placental isolates and not by non-PAM parasites or by in vitro laboratory lines selected for their adherence to CSA, is of particular interest for further characterization. On the other hand, a clear and opposite specific pattern was observed for PF10_0350, which is highly transcribed in non-PAM parasites with respect to placental parasites. The product of this gene is predicted to have surface expression, since it has a transmembrane domain, but no pexel motif targeting red cell surface targeting.
DiscussionDiscussion
De nombreuses études ont permis de prouver le caractère unique des propriétés antigéniques et de liaison des érythrocytes infectés par P. falciparum issus de placentas. Une étude antérieure des antigènes variants de surface du parasite a désigné les variants PfEMPl comme le médiateur majeur des propriétés de variation antigénique et d'adhésion des érythrocytes infectés. En particulier, Tuikue Ndam et al., 2005 a démontré que VAR2CSA PfEMPl est responsable de la liaison à la CSA des érythrocytes infectés provenant du placenta. La présente étude a identifié des différences dans l'expression des gènes en comparaison avec les parasites de la souche contrôle de laboratoire 3D7, en utilisant une analyse par biopuce de l'intégralité du génome des parasites placentaires P. falciparum. Cette approche a démontré la surexpression d'un large nombre de gènes par les parasites placentaires, qui au côté de var2csa, comporte des gènes considérés comme susceptibles de coder pour des protéines de surface pouvant jouer un rôle dans le processus biologique associé au tropisme placentaire des parasites. Pour cette première étude complète du génome des parasites placentaires fraîchement collectés in vivo, les erreurs potentielles dues à la sélection des parasites par l'hôte, aux stades de développement des parasites et à l'expression de l'ARN, ont été minimisées grâce à (1) l'échantillonnage de patients du même groupe ethnique, vivant dans la même zone géographique et ayant le même type de maladie (infection placentaire) , (2) le regroupement d'échantillons selon une distribution relative au stade de développement du parasite, l'analyse de parasites homogènes étant plus riche d' informations en regard des propriétés communément partagées. Ceci a permis l'identification de gènes impliqués dans des processus biologiques communs à tous les parasites se liant à la CSA et se développant préférentiellement dans le placenta. La fenêtre des gènes transcrits différentiellement est réduite fortement à 38 et 46 gènes surexpπmés ou réprimés respectivement dans les parasites placentaires lorsqu'un critère additionnel (des observations similaires dans au moins deux des trois groupes testés) est considéré. Comme var2csa pour lequel la surexpression était visible dans les trois groupes d'échantillons, le processus biologique peut être commun à des stades contigus de développement du parasite et ce malgré les différences dans l'expression des gènes selon ces stades, comme indiqué par Daily et al., 2005. Ceci suggère que ces gènes identifiés dans plus d'un unique groupe sont susceptibles d'être les plus pertinents pour contrôler le tropisme placentaire en général (tableau 2) . Les transcrits représentant différentes protéines hypothétiques sont différentiellement abondants dans les isolats et dans les cultures in vitro de parasites 3D7. Des études plus poussées sur la localisation du produit de ces gènes et l'identification de ceux ciblés par les réponses immunitaires méritent une attention particulière. Plusieurs de ces protéines possèdent des motifs prédits pour contrôler leur exportation en dehors du parasite et dans le globule rougeNumerous studies have demonstrated the unique antigenic and binding properties of erythrocytes infected with P. falciparum from placentas. An earlier study of parasite surface variant antigens designated PfEMP1 variants as the major mediator of the antigenic variation and adhesion properties of infected erythrocytes. In particular, Tuikue Ndam et al., 2005 demonstrated that VAR2CSA PfEMPl is responsible for the binding to CSA of infected erythrocytes from the placenta. The present study has identified differences in gene expression compared to the parasites in the 3D7 laboratory control strain, using a biochip analysis of the entire genome of the parasites. Placental P. falciparum. This approach has demonstrated the overexpression of a large number of genes by placental parasites, which along with var2csa, includes genes considered likely to encode surface proteins that may play a role in the biological process associated with placental tropism. parasites. For this first comprehensive genome study of placental parasites freshly collected in vivo, potential errors due to host parasite selection, parasite developmental stages, and RNA expression were minimized by (1) sampling of patients of the same ethnic group, living in the same geographic area and having the same type of disease (placental infection), (2) grouping of samples according to a distribution relative to the stage of development of the parasite, the analysis of homogeneous parasites being richer in information with regard to commonly shared properties. This allowed the identification of genes involved in biological processes common to all parasites that bind to CSA and preferentially develop in the placenta. The window of differentially transcribed genes is strongly reduced to 38 and 46 genes overexposed or repressed respectively in placental parasites when an additional criterion (similar observations in at least two of the three groups tested) is considered. As var2csa for which overexpression was visible in all three groups of samples, the biological process may be common at contiguous stages of parasite development, despite differences in gene expression in these stages, as reported by Daily and al., 2005. This suggests that these genes identified in more than one group are likely to be most relevant for controlling placental tropism in general (Table 2). Transcripts representing different hypothetical proteins are differentially abundant in isolates and in vitro cultures of 3D7 parasites. Further studies on the localization of the product of these genes and the identification of those targeted by immune responses deserve special attention. Several of these proteins have predicted patterns to control their export outside the parasite and in the red blood cell
(Marti et al., 2004) . On citera a titre d'exemple, les gènes(Marti et al., 2004). As an example, the genes
PFI1785w, PFA0700C, PF14_0757 et PF10_0351 (tableau 2) . Il est intéressant de noter que la transcription de certains de ces gènes dans les isolats collectés sur des sujets infectés diffère également selon l'évolution de la maladie, suggérant qu'ils jouent un rôle potentiel dans le développement clinique du paludisme (Fig. 2) .PFI1785w, PFA0700C, PF14_0757 and PF10_0351 (Table 2). It is interesting to note that the transcription of some of these genes in isolates collected from infected subjects also differs according to the course of the disease, suggesting that they play a potential role in the clinical development of malaria (Fig 2). .
Exemple 2 : Etude du gène PFI1785wExample 2 Study of the PFI1785w Gene
Caractérisation immunologique du produit du gène PFI1785wImmunological characterization of the gene product PFI1785w
Une partie de la protéine codée par PFI1785w a été exprimée dans des cellules d'insecte sf9 infectées par un baculovirus recombinant comportant la séquence du gène PFI1785w, et le produit (NP561) a été purifié en tant que protéine avec une queue histidine sécrétée. NP561 a été reconnu dans des testsPart of the protein encoded by PFI1785w was expressed in recombinant baculovirus-infected sf9 insect cells with the PFI1785w gene sequence, and the product (NP561) was purified as a protein with a secreted histidine tail. NP561 has been recognized in tests
ELISA par des échantillons de sérum provenant d'individus vivant dans des zones endémiques (Ghana) . Les sérums de femmes enceintes infectées présentent un niveau significativement plus élevé d'anticorps dirigés contre NP561 comparés aux sérums d'hommes de la même région du Ghana (p = 0,04) . La reconnaissance d'une autre protéine recombinante de parasite (GLURP) a également été mesurée et aucune différence significative n'a été observée entre les deux types de sérums vis-à-vis de cette protéine (Fig. 3) . L'expression de PFI1785w est associée au phénotype PAMELISA with serum samples from individuals living in endemic areas (Ghana). Sera from infected pregnant women showed a significantly higher level of antibodies against NP561 compared to sera from men in the same region of Ghana (p = 0.04). The recognition of another recombinant parasite protein (GLURP) was also measured and no significant difference was observed between the two types of sera with respect to this protein (Figure 3). The expression of PFI1785w is associated with the PAM phenotype
Afin de déterminer la localisation de PFI1785w dans les érythrocytes matures infectés par des schizontes, des antisérums de lapin spécifiques dirigés contre NP561 (sous forme de protéine recombinante exprimée en système baculovirus) ont été préparés. Ils ont été utilisés dans des analyses d' immunoblot et des dosages par immunofluorescenceTo determine the location of PFI1785w in schizont-infected mature erythrocytes, specific rabbit antisera directed against NP561 (as a recombinant protein expressed as a baculovirus system) were prepared. They have been used in immunoblotting and immunofluorescence assays
(IFA) . Des contrôles ont été effectués à partir d' antisérums de lapin dirigés contre d'autres PfEMPl caractérisées précédemment, contre des érythrocytes non infectés, des érythrocytes infectés avec des souches de laboratoires et des érythrocytes frais infectés issus d'enfants. Une bande protéique d'environ 40 kD, correspondant à la taille attendue, a été détectée spécifiquement par immunoblot sur des lysats de parasites placentaires (Fig. 4). Par cytométrie en flux, les anticorps de lapin spécifiques de NP561 recombinant ont été capables de marquer spécifiquement la surface de globules rouges parasités issus de placenta mais pas celle des globules rouges infectés par des souches de parasites de laboratoire ou celle des érythrocytes infectés provenant d'enfants (Fig. 5) . La localisation en surface de la protéine correspondant à PFI1785w est clairement démontrée par microscopie confocale après IFA. La protéine est localisée spécifiquement à la surface des érythrocytes infectés issus de placenta.(IFA). Controls were carried out from rabbit antisera directed against other previously characterized PfEMPs against uninfected erythrocytes, erythrocytes infected with laboratory strains and infected fresh erythrocytes from children. A protein band of about 40 kD, corresponding to the expected size, was specifically detected by immunoblotting on placental parasites lysates (Fig. 4). By flow cytometry, recombinant NP561 specific rabbit antibodies were able to specifically mark the surface of parasitized red blood cells derived from placenta but not that of red blood cells infected with strains of laboratory parasites or that of infected erythrocytes from children (Fig. 5). The surface location of the protein corresponding to PFI1785w is clearly demonstrated by confocal microscopy after IFA. The protein is specifically located on the surface of infected erythrocytes derived from placenta.
DiscussionDiscussion
PFI1785w présente un profil clairement défini, similaire à celui de var2csa, suggérant sa spécificité à PAM. Cependant, aucune preuve d'une éventuelle relation à un phénotype de liaison à la CSA n'a été observée dans les lignées de parasite sélectionnées in vitro biologiquement pour une liaison à la CSA. Bien que les propriétés de liaison à la CSA représentent un phénotype spécifique majeur des parasites PAM, il semble toutefois que toutes les caractéristiques des parasites responsables de PAM ne puissent être reproduites dans des lignées de parasites adaptées au laboratoire. Malgré l'avis largement accepte de l'importance de la cytoadhésion dans le développement des formes sévères de la maladie, il existe encore de nombreux aspects de ce processus complexe qui restent mal compris. Les travaux complémentaires pour caractériser PFI1785w ont révèle que la protéine codée par ce gène est exprimée par les isolats placentaires comme cela est démontré par les analyses par western blot. Par comparaison à VAR2CSA, la protéine recombinante correspondante (NP561) est mieux reconnue par les échantillons de sérum de femmes enceintes vivant dans les zones endémiques du paludisme suggérant que le produit de ce gène est ciblé par la réponse immune, bien que sa relation au genre soit moins importante. De plus, des anticorps spécifiques dirigés contre NP561 marquent de manière spécifique la surface des parasites PAM comme cela est démontré par la cytométrie en flux et l'IFA. Ceci prouve une implication évidente de cette protéine parasitaire dans le mécanisme de PAM. PFI1785w est un gène ayant une copie unique qui code pour une petite protéine dont il est prédit qu'elle exprime une unique molécule à la surface des érythrocytes . Ce nouvel antigène immunoréactif identifié présente des preuves intéressantes de son implication dans le mécanisme régissant le tropisme placentaire de P. falciparum, et par là même apparaît comme un nouvel antigène prioritaire pour des évaluations visant à l'élaboration d'un vaccin efficace contre le PAM.PFI1785w has a clearly defined profile, similar to that of var2csa, suggesting its specificity to PAM. However, no evidence of a possible relationship to a CSA binding phenotype was observed in biologically-selected in vitro parasite lines for binding to CSA. Although CSA binding properties represent a major specific phenotype of MAP parasites, it appears that all parasite characteristics PAM managers can not be reproduced in laboratory-adapted parasite lines. Despite the widely accepted view of the importance of cytoadhesion in the development of severe forms of the disease, there are still many aspects of this complex process that remain poorly understood. Further work to characterize PFI1785w revealed that the protein encoded by this gene is expressed by placental isolates as demonstrated by western blot analyzes. Compared to VAR2CSA, the corresponding recombinant protein (NP561) is better recognized by serum samples from pregnant women living in endemic areas of malaria suggesting that the product of this gene is targeted by the immune response, although its relationship to genus less important. In addition, specific antibodies directed against NP561 specifically mark the surface of PAM parasites as demonstrated by flow cytometry and IFA. This proves an obvious implication of this parasitic protein in PAM mechanism. PFI1785w is a gene with a unique copy that encodes a small protein that is predicted to express a single molecule on the surface of erythrocytes. This new immunoreactive antigen identified has interesting evidence of its involvement in the mechanism governing placental tropism of P. falciparum, and thus appears as a new priority antigen for evaluations aimed at developing an effective vaccine against MAP. .
La figure 7 donne les comparaisons entre des séquences nucléotidiques génomiques ou d'ADNc d'une souche de Plasmodium ou d' isolats placentaires.Figure 7 gives comparisons between genomic or cDNA sequences of a Plasmodium strain or placental isolates.
La séquence prédite de PlasmoB, qui est obtenue à partir de l'ADNc de 3D7, comporte un cordon « stop ». La région correspondante de l'rntron n'est pas traduite. Cette séquence est donc tronquée, les bases 555 a 647 étant manquantes. Cette séquence peut être traduite à partir d'ADNg (ADN 3D7 et ADNg d'un isolât du Ghana). Les ADNc des isolats N42 et N14 n'ont pas d' mtrons .The predicted sequence of PlasmoB, which is obtained from the 3D7 cDNA, comprises a "stop" bead. The region Corresponding text is not translated. This sequence is therefore truncated, the bases 555 to 647 being missing. This sequence can be translated from gDNA (3D7 DNA and gDNA from a Ghana isolate). The cDNAs of isolates N42 and N14 have no mtrons.
De manière similaire à PFI1785w, PFD1120c, PF10_0350 et PFL0260c sont fortement transcrits dans les isolats non-PAM, ce qui évoque une implication possible de ces gènes dans le processus biologique conduisant à des infections de type non- PAM. PF10_0350 et PF10_0351 sont contigus et dans la même orientation sur le chromosome 10. Il est intéressant de noter que l'un est sur-régulé tandis que l'autre est sous-régulé dans les échantillons placentaires. Puisqu'il y a seulement l,3kb entre le codon « stop » de PF10_0350 et le codon « start » de PF10_0351, il peut être supposé que la fixation de la zone activatπce sur la région promotrice de PFlO 0351 interfère avec l'amplificateur de la région 5' de PFlO 0350. De plus, PF10_0351 appartient a la famille des paralogues de MSP3 (protéine 3 de surface du mérozoite) . Il a été montré que H103, la protéine codée par PF10_0351, est exprimée à la surface des mérozoites (Pearce et al., 2005) . La surexpression de cette protéine dans les parasites placentaires peut indiquer que H103 agit comme un facteur de virulence. Dans la présente étude, les différences entre les parasites m vivo et les cultures m vitro de parasites sont clairement mises en évidence par la transcription de gènes tels que PFCOIlOw (Clag 3.2), PF10_0344 (protéine riche en glutamate) et PF14_0010 (antigène relatif à la protéine de liaison à la glycophoπne) . PFC0120w qui code pour un membre différent de la famille CLAGSimilar to PFI1785w, PFD1120c, PF10_0350 and PFL0260c are highly transcribed in non-PAM isolates, suggesting possible involvement of these genes in the biological process leading to non-PAM infections. PF10_0350 and PF10_0351 are contiguous and in the same orientation on chromosome 10. It is interesting to note that one is over-regulated while the other is under-regulated in placental samples. Since there is only 1.3 kb between the "stop" codon of PF10_0350 and the "start" codon of PF10_0351, it can be assumed that the attachment of the activating zone on the promoter region of PF10 0351 interferes with the enhancer. the 5 'region of PF10 0350. In addition, PF10_0351 belongs to the family of paralogs of MSP3 (merozoite surface protein 3). H103, the protein encoded by PF10_0351, has been shown to be expressed on the surface of merozoites (Pearce et al., 2005). Overexpression of this protein in placental parasites may indicate that H103 acts as a virulence factor. In the present study, the differences between the in vivo parasites and the in vitro parasite cultures are clearly evidenced by the transcription of genes such as PFCOI10w (Clag 3.2), PF10_0344 (glutamate-rich protein) and PF14_0010 (antigen relative to the glycophenic binding protein). PFC0120w that codes for a different member of the CLAG family
(gène asexué lié à la cytoadhérence) , clag 3.1, est cependant sous-régulé dans les parasites placentaires, ceci indiquant probablement que ce dernier n'est pas impliqué dans la pathogénie in vivo des parasites PAM. Bien que la sous-famille des gènes clag (dag3) ait été décrite comme jouant un rôle possible dans la liaison aux érythrocytes lors du processus d'invasion, des études récentes démontrent que les transcrits de clag 3.2, contrairement à ceux de clag 3.1, ne peuvent être détectés dans certaines souches adaptées au laboratoire, telles que les parasites Dd2, ce qui est en accord avec cette étude. La PCR quantitative en temps réel du sous-groupe des 19 gènes identifiés par puces a ADN et réalisée a partir de parasites issus d'individus présentant des formes cliniques différentes de l'infection par le paludisme, démontre de nombreuses différences entre les parasites provenant d'enfants asymptomatiques et ceux provenant de femmes enceintes et non enceintes présentant des symptômes. Ces gènes sont : PFCOIlOw (clag 3.2), PF10_0344 (glurp) , PFB0105c, PF10_0351 et PFI1445w. Ceci implique des différences entre les parasites infectant les enfants asymptomatiques et ceux infectant les individus présentant des symptômes. Ceci peut être en relation avec la forme clinique qui diffère entre ces individus, suggérant un rôle possible de ces protéines comme facteur de virulence, comme cela a été démontré pour clag et glurp. Pour certains gènes analysés, aucune différence n'a été observée entre les isolats, mais des différences existent avec la lignée 3D7. En particulier, on citera PF14 0010 codant pour un antigène relatif à la protéine de liaison à la glycophoπne, qui a été détecté dans les 3 groupes d'échantillons. Des travaux antérieurs ont montré des modifications dans l'expression des protéines exprimées en surface de P. falciparum lorsque le parasite est maintenu en culture sur le long terme ou sous la pression d'une sélection biologique ou immune . Ceci est peut être également applicable aux facteurs de virulence putatifs. Le profil d'expression des gènes qui n'ont été détectés que dans un seul groupe d'échantillons peut potentiellement traduire une spécificité des isolats PAM, bien que ces gènes puissent aussi être spécifiques de certains des stades de développement. La surexpression par les parasites placentaires des gènes codant pour de multiples antigènes asexués (tels que AMAl, MSPl, MSP3, MSP5, MSP6, EBA140, qui sont supposés être impliqués dans l'invasion des globules rouges) est cohérent avec les différences entre les processus biologiques ayant lieu dans un environnement in vivo, qui est riche en cellules immunes et en facteurs, et dans l'environnement in vitro de la souche 3D7.(asexual cytoadherence gene), clag 3.1, is, however, underregulated in placental parasites, probably indicating that the latter is not involved in the in vivo pathogenesis of PAM parasites. Although the subfamily clag genes (dag3) have been described as playing a possible role in erythrocyte binding during the invasion process, recent studies show that clag 3.2 transcripts, unlike those of clag 3.1, can not be detected in some laboratory-adapted strains, such as Dd2 parasites, which is consistent with this study. Real-time quantitative PCR of the subgroup of 19 genes identified by DNA microarrays and made from parasites from individuals with different clinical forms of malaria infection, shows many differences between parasites from asymptomatic children and those from pregnant and non-pregnant women with symptoms. These genes are: PFCOI10w (clag 3.2), PF10_0344 (glurp), PFB0105c, PF10_0351 and PFI1445w. This implies differences between parasites infecting asymptomatic children and those infecting individuals with symptoms. This may be related to the clinical form that differs between these individuals, suggesting a possible role of these proteins as a virulence factor, as has been demonstrated for clag and glurp. For some genes analyzed, no difference was observed between the isolates, but differences exist with the 3D7 lineage. In particular, mention will be made of PF140010 coding for an antigen relative to the glycophenic binding protein, which has been detected in the 3 groups of samples. Previous work has shown changes in the expression of P. falciparum surface expressed proteins when the parasite is maintained in culture in the long term or under the pressure of biological or immune selection. This may also be applicable to putative virulence factors. The expression pattern of genes that have been detected in only one group of samples may potentially reflect a specificity of PAM isolates, although these genes may also be specific for some of the stages of development. Overexpression by placental parasites of genes encoding multiple asexual antigens (such as AMA1, MSP1, MSP3, MSP5, MSP6, EBA140, which are thought to be involved in the invasion of red blood cells) is consistent with the differences between the processes occurring in an in vivo environment, which is rich in immune cells and factors, and in the in vitro environment of strain 3D7.
Structure de l'épissage de PFI1785wSplicing structure of PFI1785w
Les résultats obtenus sont représentés sur les figures 6A et 6B :The results obtained are shown in FIGS. 6A and 6B:
θD (A) montre les produits de PCR confirmant l'épissage de l'intron 1 et pas de l'intron 2 chez 3D7 et un cDNA d' isolât placentaire. Les 3 amorces représentées par des flèches dans la figue B ont été utilisées pour amplifier un fragment court et un fragment complet à partir de l'ADN génomique de 3D7 (lignes 2 et 5), de l'ADNc de 3D7 (lignesθD (A) shows the PCR products confirming the splicing of intron 1 and not intron 2 in 3D7 and a placental isolate cDNA. The 3 primers represented by arrows in Fig. B were used to amplify a short fragment and a complete fragment from the 3D7 genomic DNA (lines 2 and 5), the 3D7 cDNA (lines
3 et 6), de l'ADNc d'un isolât placentaire (lignes 4 et3 and 6), cDNA of a placental isolate (lines 4 and
7) . La ligne 1 montre un marqueur de poids moléculaire de7). Line 1 shows a molecular weight marker of
100 bp. θD (B) représente le schéma de la structure exon/mtron à partir du gène prédit et du ARNm/ADNc . Les barres noires représentent les exons prédits. Les barres blanches et rayées représentent respectivement l'intron 1 et l'intron 2 d' après la séquence génomique de 3D7. Le schéma ARNm/ADNc correspond à la structure observée expérimentalement.100 bp. θD (B) represents the pattern of the exon / mtron structure from the predicted gene and mRNA / cDNA. The black bars represent the predicted exons. The white and striped bars represent intron 1 and intron 2, respectively, according to the genome sequence of 3D7. The mRNA / cDNA pattern corresponds to the structure observed experimentally.
Exemple 3 : Etude des gènes PFA0700c, PF14_0757, PFB0105c, PFlO 0351 et PFlO 0350 Caractérisation immunologique des produits des gènesExample 3 Study of the genes PFA0700c, PF14_0757, PFB0105c, PF10 0351 and PF10 0350 Immunological characterization of gene products
Une partie des protéines codées par PFA0700c, PF14_0757, PFB0105c, PF10_0351 et PF10_0350 a été exprimée dans un baculovirus, transfectée dans des cellules d'insectes et purifiée en tant que protéine avec une queue histidine sécrétée. Les protéines ont été reconnues dans des tests ELISA par des échantillons de sérum provenant d'individus vivant dans des zones endémiques (Ghana) . Les sérums de femmes enceintes infectées présentent un niveau significativement plus élevé d'anticorps dirigés contre ces protéines comparés aux sérums d'hommes de la même région du Ghana (p = 0,04) . La reconnaissance d'une autre protéine recombinante de parasite (GLURP) a également été mesurée et aucune différence significative n'a été observée entre les deux types de sérums (Fig. 3) .Part of the proteins encoded by PFA0700c, PF14_0757, PFB0105c, PF10_0351 and PF10_0350 were expressed in a baculovirus, transfected into insect cells and purified as a secreted histidine tail protein. The proteins were recognized in ELISA assays by serum samples from individuals living in endemic areas (Ghana). Sera from infected pregnant women show a significantly higher level of antibodies to these proteins compared to sera from men in the same region of Ghana (p = 0.04). The recognition of another recombinant parasite protein (GLURP) was also measured and no significant difference was observed between the two types of sera (Fig. 3).
L'expression de PFA0700c, PF14_0757, PFB0105c, PF10_0351 et PF10_0350 est associée au phénotype PAMThe expression of PFA0700c, PF14_0757, PFB0105c, PF10_0351 and PF10_0350 is associated with the PAM phenotype
Afin de déterminer la localisation de PFA0700c, PF14_0757, PFB0105c, PF10_0351 et PF10_0350 dans les érythrocytes matures infectés par des schizontes, des antisérums de lapin spécifiques dirigés contre ces protéines (sous forme de protéine recombinante exprimée en système baculovirus) ont été préparés. Ils ont été utilisés dans des analyses d' immunoblot et dans des marquages par immunofluorescence (IFA) . Des contrôles ont été effectués à partir d' antisérums de lapin dirigés contre d'autres protéines de surface telles que PfEMPl caractérisées précédemment, contre des érythrocytes non infectés, des érythrocytes infectés avec des souches de laboratoires et des érythrocytes frais infectés issus d'enfants. Des bandes protéiques d'environ 13kD, 25kD, 35kD, 65kD et 82kD correspondant aux tailles respectives attendues, ont été détectées spécifiquement par immunoblot sur des lysats de parasites placentaires. Par cytométrie en flux, les anticorps de lapin spécifiques de ces protéines recombinantes ont été capables de marquer spécifiquement la surface de globules rouges parasités issus de placenta mais pas celle des globules rouges infectés par des souches de parasites de laboratoire ou celle des érythrocytes infectés provenant d'enfants. La localisation en surface des protéines correspondant à PFA0700c, PF14_0757, PFB0105c, PF10_0351 et PF10_0350 a été vérifiée par microscopie confocale après IFA. Les anticorps spécifiques de chacune des protéines ci-dessus ont été utilisés en immunoprécipitation sur des lysats de globules rouges parasités et déséquestrés de placentas. Les complexes protéiques ont été dissociés et analysés par spectrométπe de masse. La combinaison de toutes ces méthodes nous a permis de confirmer l'expression, l'exportation à la surface du globule rouge parasité et l' antigénicité de nouvelles protéines parasitaire impliquées dans la pathogenèse du paludisme gestationnel . Ces protéines constituent des cibles thérapeutiques et vaccinales de grand intérêt.In order to determine the localization of PFA0700c, PF14_0757, PFB0105c, PF10_0351 and PF10_0350 in schizont-infected mature erythrocytes, specific rabbit antisera raised against these proteins (in the form of a recombinant protein expressed in baculovirus system) were prepared. They have been used in immunoblotting analyzes and in immunofluorescence (IFA) markings. Controls were carried out from rabbit antisera directed against other surface proteins such as PfEMPl characterized previously, against uninfected erythrocytes, erythrocytes infected with laboratory strains and infected fresh erythrocytes from children. Protein bands of approximately 13kD, 25kD, 35kD, 65kD and 82kD corresponding to the respective expected sizes, were specifically detected by immunoblotting on placental parasite lysates. By flow cytometry, Rabbit antibodies specific for these recombinant proteins were able to specifically mark the surface of parasitized red blood cells derived from placenta but not that of red blood cells infected with strains of laboratory parasites or that of infected erythrocytes from children. The surface localization of the proteins corresponding to PFA0700c, PF14_0757, PFB0105c, PF10_0351 and PF10_0350 was verified by confocal microscopy after IFA. Antibodies specific for each of the above proteins were used in immunoprecipitation on parasitized and desequered red blood cell lysates of placentas. Protein complexes were dissociated and analyzed by mass spectrometry. The combination of all these methods allowed us to confirm the expression, the export to the surface of the parasitized red blood cell and the antigenicity of new parasite proteins involved in the pathogenesis of gestational malaria. These proteins are therapeutic and vaccine targets of great interest.
Exemple 4 : Préparation d/ un anticorps dirigé contre la protéine NP561Example 4 Preparation of an Antibody Directed Against NP561 Protein
Des lapins sont immunisés à l'aide de l'adjuvant incomplet/complet de Freund. Cet adjuvant aide à induire la production d'anticorps réactifs dirigés contre NP561. Les niveaux d' IgGs spécifique de NP561 sont détectés par test ELISA et augmentent au fur et à mesure des immunisations et atteignent un maximum au bout de 5 immunisations (Barfod et al., 2006) . Les anticorps polyclonaux dirigés contre NP561 sont purifiés par affinité à partir des sera de lapins hypeπmmuns . RéférencesRabbits are immunized with incomplete / complete Freund's adjuvant. This adjuvant helps to induce the production of reactive antibodies directed against NP561. The levels of NP561 specific IgGs are detected by ELISA and increase as immunizations proceed and reach a maximum after 5 immunizations (Barfod et al., 2006). The polyclonal antibodies against NP561 are affinity purified from sera of human rabbits. References
Trager W, Jensen JB (1976) Human malaria parasites in continuous culture. Science 193: 673-675.Trager W, Jensen JB (1976) Human malaria parasites in continuous culture. Science 193: 673-675.
Staalsoe T, Giha HA, Dodoo D, Theander TG, Hvnd L (1999) Détection of antibodies to variant antigens on Plasmodium falciparum-infected erythrocytes by flow cytometry. Cytometry 35: 329-336.Staalsoe T, Giha HA, Dodoo D, TG Theander, Hvnd L (1999) Detection of antibodies to variant antigens on Plasmodium falciparum-infected erythrocytes by flow cytometry. Cytometry 35: 329-336.
Plowe CV, Djimde A, Bouare M, Doumbo 0, Wellems TE (1995)Plowe CV, Djimde A, Bouar M, Doumbo 0, Wellems TE (1995)
Pyrimethamme and proguanil resistance-conferring mutations m Plasmodium falciparum dihydrofolate reductase: polymerase chain reaction methods for surveillance in Africa. Am J Trop Med Hyg 52: 565-568.Pyrimethamme and proguanil resistance-conferring mutations Plasmodium falciparum dihydrofolate reductase: polymerase chain reaction methods for surveillance in Africa. Am J Trop Med Hyg 52: 565-568.
Jafaπ S, Le Bras J, Bouchaud 0, Durand R (2004) Plasmodium falciparum clonal population dynamics during malaria treatment. J Infect Dis 189: 195-203.Jafaπ S, J Bras, Bouchaud 0, Durand R (2004) Plasmodium falciparum clonal population dynamics during malaria treatment. J Infect Dis 189: 195-203.
Ralph SA, Bischoff E, Mattei D, Sismeiro O, Dillies MA, et al. (2005) Transcriptome analysis of antigenic variation in Plasmodium falciparum—var silencing îs not dépendent on antisense RNA. Génome Biol 6: R93.Ralph SA, Bischoff E, Mattei D, Sismeiro O, Dillies MA, et al. (2005) Transcriptome analysis of antigenic variation in Plasmodium falciparum-var silencing is not dependent on antisense RNA. Genome Biol 6: R93.
Gentleman RC, Carey VJ, Bâtes DM, Bolstad B, Dettling M, et al. (2004) Bioconductor : open software development for computational biology and bioinformatics . Génome Biol 5: R80.Gentleman RC, Carey VJ, DM Bats, Bolstad B, Dettling M, et al. (2004) Bioconductor: open software development for computational biology and bioinformatics. Genome Biol 5: R80.
Tuikue Ndam NG, Salanti A, Bertin G, Dahlback M, Fievet N, et al. (2005) High Level of var2csa Transcription by Plasmodium falciparum Isolated from the Placenta. J Infect Dis 192: 331-335.Tuikue Ndam NG, Salanti A, Bertin G, Dahlback M, Fievet N, et al. (2005) High Level of Var2csa Transcription by Plasmodium falciparum Isolated from the Placenta. J Infect Dis 192: 331-335.
Salanti A, Staalsoe T, Lavstsen T, Jensen AT, Sowa MP, et al. (2003) Sélective upregulation of a single distmctly structurée! var gène m chondroitin sulphate A-adheringSalanti A, Staalsoe T, Lavensen T, Jensen AT, Sowa MP, et al. (2003) Selective upregulation of a single distmctly structured! var gene m chondroitin sulphate A-adhering
Plasmodium falciparum involved m pregnancy-associated malaria. Mol Microbiol 49: 179-191.Plasmodium falciparum involved in pregnancy-associated malaria. Mol Microbiol 49: 179-191.
Salanti A, Dahlback M, Turner L, Nielsen MA, Barfod L, et al.Salanti A, Dahlback M, Turner L, Nielsen MA, Barfod L, et al.
(2004) Evidence for the involvement of VAR2CSA m pregnancy-associated malaria. J Exp Med 200: 1197-1203.(2004) Evidence for the involvement of VAR2CSA m pregnancy-associated malaria. J Exp Med 200: 1197-1203.
Pearce JA, Mills K, Tπglia T, Cowman AF, Anders RF (2005) Characterisation of two novel proteins from the asexual stage of Plasmodium falciparum, HlOl and H103. Mol Biochem Parasitol 139: 141-151.Pearce JA, Mills K, Tglia T, Cowman AF, Anders RF (2005) Characterization of two novel proteins from the asexual stage of Plasmodium falciparum, H101 and H103. Mol Biochem Parasitol 139: 141-151.
Marti M, Good RT, Rug M, Knuepfer E, Cowman AF (2004) Targetmg malaria virulence and remodeling proteins to the host erythrocyte. Science 306: 1930-1933.Marti M, Good RT, Rug M, Knuepfer E, Cowman AF (2004) Targetmg malaria virulence and remodeling proteins to the host erythrocyte. Science 306: 1930-1933.
Daily JP, Le Roch KG, Sarr O, Ndiaye D, Lukens A, et al.Daily JP, Roch KG, Sarr O, Ndiaye D, Lukens A, et al.
(2005) In vivo transcriptome of Plasmodium falciparum reveals overexpression of transcripts that encode surface proteins. J Infect Dis 191: 1196-1203.(2005) In vivo transcriptome of Plasmodium falciparum reveals overexpression of transcripts that encode surface proteins. J Infect Dis 191: 1196-1203.
Barfod L, Nielsen MA, Turner L, Dahlback M, Jensen AT, HviidBarfod L, Nielsen MA, Turner L, Dahlback M, Jensen AT, Hviid
L, Theander TG, Salanti A. (2006) Baculovirus-expressed constructs induce îmmunoglobulm G that recognizesL, Theander TG, Salanti A. (2006) Baculovirus-expressed constructs induce immunoglobulin G that recognizes
VAR2CSA on Plasmodium falciparum-infected erythrocytes .VAR2CSA on Plasmodium falciparum-infected erythrocytes.
Infect Immun 74:4357-60. Listage de séquenceInfect Immun 74: 4357-60. Sequence listing
SEQ ID NO.1 PFI1785w ΆTGTGGTTTTGTΆΆTΆΆΆTTTΆΆTGΆTΆΆTΆCΆΆCTΆΆΆGGGTTΆCTGGΆTTCTΆΆTΆΆTGT ACAATCAAAATATTGTACCATATATTCTTTTGATGATGAAGAAAATAATACGAAAAGAAAAA ATCAGTTCGCATCTTTTAGTAAATTATGTTTAAAGTTATGTATTCTTGGAATTATTGTAATA GTGAACGTGTGTTGTAGTTTTGAATCAAATGAAATATCCAAGGTTAATTTAATAAAGAAGGA ATATTCCAGAATATTAAGTGAAACCGAGGCATTAGAAAATTTGAAAGAGGAAAGTAAAAATA GAAAAGATGATGAAGAAGAAGTAAGTTTATTTGATGGTTCTGATGATATGGGTCGTACTTAC GATAATGATACATGTTATCAATCAAGATATAATAGATCAAGTATAGGTGATCTGATTCAAGT TATAAAATCCACATTTGGAGGTGAAGATGAACATTTATTTCAAACTTGTCCAGATATTTTCG ATGAGTTAGTAAAACGTTCTACATGGGAACGTTTGGAATTAGATTTGTATGAAACTGAAATT TCTGATTATTTAACTGTAACATATGATCTTTCATTAAATGAAAAAATTTTGACATTGAGTAG ATTAAGTAACGAAGAAGATTTATACAATTTGTGGTCAGAAATAATGAGAAATGAAGAAAGGA AATTTAGCTTTCTAAGATATCATCTATATAACTACTATTATTCACTAAAAAATAGAAGCAGA GTAAGTCGTGAATATTCAGAAAAAATATGGAATGAATGTGAAGAAACCCTTAAAAGTTTACA TGAAAGTCATGAAAGTTCAATCTTTGATTTATTCCATAAATGGATTAATGGAAGTATACATG AGCTTTCGGAATTTAAAGTTCTTGTATCTGCAGGTAGATATTCATGGAGAAATTTACTTAAA ACTGGAGAACGTGAATGTAAAAAATTTATGATTAAACATTATAAGGGTAAAACCGCTTTAAGSEQ ID NO.1 PFI1785w ΆTGTGGTTTTGTΆΆTΆΆΆTTTΆΆTGΆTΆΆTΆCΆΆCTΆΆΆGGGTTΆCTGGΆTTCTΆΆTΆΆTGT ACAATCAAAATATTGTACCATATATTCTTTTGATGATGAAGAAAATAATACGAAAAGAAAAA ATCAGTTCGCATCTTTTAGTAAATTATGTTTAAAGTTATGTATTCTTGGAATTATTGTAATA GTGAACGTGTGTTGTAGTTTTGAATCAAATGAAATATCCAAGGTTAATTTAATAAAGAAGGA ATATTCCAGAATATTAAGTGAAACCGAGGCATTAGAAAATTTGAAAGAGGAAAGTAAAAATA GAAAAGATGATGAAGAAGAAGTAAGTTTATTTGATGGTTCTGATGATATGGGTCGTACTTAC GATAATGATACATGTTATCAATCAAGATATAATAGATCAAGTATAGGTGATCTGATTCAAGT TATAAAATCCACATTTGGAGGTGAAGATGAACATTTATTTCAAACTTGTCCAGATATTTTCG ATGAGTTAGTAAAACGTTCTACATGGGAACGTTTGGAATTAGATTTGTATGAAACTGAAATT TCTGATTATTTAACTGTAACATATGATCTTTCATTAAATGAAAAAATTTTGACATTGAGTAG ATTAAGTAACGAAGAAGATTTATACAATTTGTGGTCAGAAATAATGAGAAATGAAGAAAGGA AATTTAGCTTTCTAAGATATCATCTATATAACTACTATTATTCACTAAAAAATAGAAGCAGA GTAAGTCGTGAATATTCAGAAAAAATATGGAATGAATGTGAAGAAACCCTTAAAAGTTTACA TGAAAGTCATGAAAGTTCAATCTTTGATTTATTCCATAAATGGATTAATGGAAGTATACATG AGCTTTCGGAATTTAAAGTTCTTGTATCTGCAGGTAGATATTCATGGAGAAATTTACTTAAA ACTGGAGAACG TGAATGTAAAAAATTTATGATTAAACATTATAAGGGTAAAACCGCTTTAAG
AATTTAAAATTTAA
SEQ ID NO.2 amino acids PFI1785wSEQ ID NO.2 amino acids PFI1785w
MWFCNKFNDNTTKGLLDSNNVQSKYCTIYSFDDEENNTKRKNQFASFSKLCLKLCILGIIVI VNVCCSFESNEISKVNLIKKEYSRILSETEALENLKEESKNRKDDEEEVSLFDGSDDMGRTY DNDTCYQSRYNRSSIGDLIQVIKSTFGGEDEHLFQTCPDIFDELVKRSTWERLELDLYETEI SDYLTVTYDLSLNEKILTLSRLSNEEDLYNLWSEIMRNEERKFSFLRYHLYNYYYSLKNRSR VSREYSEKIWNECEETLKSLHESHESSIFDLFHKWINGSIHELSEFKVLVSAGRYSWRNLLK TGERECKKFMIKHYKGKTALRIMWFCNKFNDNTTKGLLDSNNVQSKYCTIYSFDDEENNTKRKNQFASFSKLCLKLCILGIIVI VNVCCSFESNEISKVNLIKKEYSRILSETEALENLKEESKNRKDDEEEVSLFDGSDDMGRTY DNDTCYQSRYNRSSIGDLIQVIKSTFGGEDEHLFQTCPDIFDELVKRSTWERLELDLYETEI SDYLTVTYDLSLNEKILTLSRLSNEEDLYNLWSEIMRNEERKFSFLRYHLYNYYYSLKNRSR VSREYSEKIWNECEETLKSLHESHESSIFDLFHKWINGSIHELSEFKVLVSAGRYSWRNLLK TGERECKKFMIKHYKGKTALRI
SEQ ID No.3SEQ ID No.3
CAATCAAGATATAATAGATCAAGTATAGGTGATCTGATTCAAGTTATAAAATCCACATTTGG AGGTGAAGATGAACATTTATTTCAAACTTGTCCAGATATTTTCGATGAGTTAGTAAAACGTT CTACATGGGAACGTTTGGAATTAGATTTGTATGAAACTGAAATTTCTGATTATTTAACTGTA ACATATGATCTTTCATTAAATGAAAAAATTTTGACATTGAGTAGATTAAGTAACGAAGAAGA TTTATACAATTTGTGGTCAGAAATAATGAGAAATGAAGAAAGGAAATTTAGCTTTCTAAGAT ATCATCTATATAACTACTATTATTCACTAAAAAATAGAAGCAGAGTAAGTCGTGAATATTCA GAAAAAATATGGAATGAATGTGAAGAAACCCTTAAAAGTTTACATGAAAGTCATGAAAGTTC AATCTTTGATTTATTCCATAAATGGATTAATGGAAGTATACATGAGCTTTCGGAATTTAAAG TTCTTGTATCTGCAGGTAGATATTCATGGAGAAATTTACTTAAAACTGGAGAACGTGAATGT AAAAAATTTATGATTAAACATTATAAGGGTAAAACCGCAATCAAGATATAATAGATCAAGTATAGGTGATCTGATTCAAGTTATAAAATCCACATTTGG AGGTGAAGATGAACATTTATTTCAAACTTGTCCAGATATTTTCGATGAGTTAGTAAAACGTT CTACATGGGAACGTTTGGAATTAGATTTGTATGAAACTGAAATTTCTGATTATTTAACTGTA ACATATGATCTTTCATTAAATGAAAAAATTTTGACATTGAGTAGATTAAGTAACGAAGAAGA TTTATACAATTTGTGGTCAGAAATAATGAGAAATGAAGAAAGGAAATTTAGCTTTCTAAGAT ATCATCTATATAACTACTATTATTCACTAAAAAATAGAAGCAGAGTAAGTCGTGAATATTCA GAAAAAATATGGAATGAATGTGAAGAAACCCTTAAAAGTTTACATGAAAGTCATGAAAGTTC AATCTTTGATTTATTCCATAAATGGATTAATGGAAGTATACATGAGCTTTCGGAATTTAAAG TTCTTGTATCTGCAGGTAGATATTCATGGAGAAATTTACTTAAAACTGGAGAACGTGAATGT AAAAAATTTATGATTAAACATTATAAGGGTAAAACCG
SEQ ID No.4 QSRYNRSSIGDLIQVIKSTFGGEDEHLFQTCPDIFDELVKRSTWERLELDLYETEISDYLTV TYDLSLNEKILTLSRLSNEEDLYNLWSEIMRNEERKFSFLRYHLYNYYYSLKNRSRVSREYS EKIWNECEETLKSLHESHESSIFDLFHKWINGSIHELSEFKVLVSAGRYSWRNLLKTGEREC KKFMIKHYKGKTSEQ ID No.4 QSRYNRSSIGDLIQVIKSTFGGEDEHLFQTCPDIFDELVKRSTWERLELDLYETEISDYLTV TYDLSLNEKILTLSRLSNEEDLYNLWSEIMRNEERKFSFLRYHLYNYYYSLKNRSRVSREYS EKIWNECEETLKSLHESHESSIFDLFHKWINGSIHELSEFKVLVSAGRYSWRNLLKTGEREC KKFMIKHYKGKT
PFA0700CPFA0700C
SEQ ID No. 5SEQ ID No. 5
ATGTCGTTTTATTATTTTAAATTATCATTCATTTCTATTTTACTGTGTATTTTAATAATTACATGTCGTTTTATTATTTTAAATTATCATTCATTTCTATTTTACTGTGTATTTTAATAATTAC
ACATAAGTTCAGCCTTGAACAAATAACTCATAATAAAAGTAATAATTTTAATATTATAAATG TAACACACAGGAGATTACTAGCCGAACCACACAAATCACATATATTGAAAACCCATAAAGGA GAAAATTCAATGGCACAACCAATAGTTAATAAATTAAGAGAAAATCATACAGAGTGTCCTAA AAAATCATCTTCCATTAAGCTTAAAAAAATTTTAATACTTGTATCTTTGTTTACATTACCTT GTTCTTTCTTTTGTTTTCAATAA SEQ ID No. 6ACATAAGTTCAGCCTTGAACAAATAACTCATAATAAAAGTAATAATTTTAATATTATAAATG TAACACACAGGAGATTACTAGCCGAACCACACAAATCACATATATTGAAAACCCATAAAGGA GAAAATTCAATGGCACAACCAATAGTTAATAAATTAAGAGAAAATCATACAGAGTGTCCTAA AAAATCATCTTCCATTAAGCTTAAAAAAATTTTAATACTTGTATCTTTGTTTACATTACCTT GTTCTTTCTTTTGTTTTCAATAA SEQ ID No. 6
MSFYYFKLSFISILLCILIITHKFSLEQITHNKSNNFNIINVTHRRLLAEPHKSHILKTHKG ENSMAQPIVNKLRENHTECPKKSSSIKLKKILILVSLFTLPCSFFCFQMSFYYFKLSFISILLCILIITHKFSLEQITHNKSNNFNIINVTHRRLLAEPHKSHILKTHKG ENSMAQPIVNKLRENHTECPKKSSSIKLKKILILVSLFTLPCSFFCFQ
PF14_0757PF14_0757
SEQ ID No. 7SEQ ID No. 7
ATGAAATTTTTTTCTGTTATGCAAATATTTTTAAATTTGTTAACAATTAGTGGGATTTTATT ATTAAATATAATAATATGTGACAAAAGTGAAACAATGTATTCAGGAGTTTATCATATATATA TATATAGAAGAAATTTGTCTGAGTCAAAAAGTGTAAAGAATAAAGGATTAAGAAATAAAAGT GAGAAAAATAAATTAAAAAATGGAGTCGATGAAAAAAATGATAGTACTCCTCTTAATCTTTA TAACATATGGTCACCTGCTTTGGGTATAGCTAATGAAATTTTTTTCTGTTATGCAAATATTTTTAAATTTGTTAACAATTAGTGGGATTTTATT ATTAAATATAATAATATGTGACAAAAGTGAAACAATGTATTCAGGAGTTTATCATATATATA TATATAGAAGAAATTTGTCTGAGTCAAAAAGTGTAAAGAATAAAGGATTAAGAAATAAAAGT GAGAAAAATAAATTAAAAAATGGAGTCGATGAAAAAAATGATAGTACTCCTCTTAATCTTTA TAACATATGGTCACCTGCTTTGGGTATAGCTA
AAAACGCATTTGATGAGATGATAAAAGATTTATGGCTTTATATAGAAGATTATTTAAATAAA TATGAATATCAACGTTATCATCATATTATGTGTAGGAGACCTGTATGTGTAAGAATTAAATA CCGTACATTGTATAAATCAAAAGATGATATTGGTGTTGCACTATCATCTACAGATATGCAAC ATACTCTTAATTTTTATAGTTTGGTTAAAAATGGAGAATCAATTGATGAAATGAAAAAATTT ATTTATTCATATATAAAGTGTTATGATACATTACAAAATGATTTATTTAATGAACATAGGAA AATATGTACAGGAAGGGTGAGGAATTCCAAAGGATTAGATATGTAAAAAACGCATTTGATGAGATGATAAAAGATTTATGGCTTTATATAGAAGATTATTTAAATAAA TATGAATATCAACGTTATCATCATATTATGTGTAGGAGACCTGTATGTGTAAGAATTAAATA CCGTACATTGTATAAATCAAAAGATGATATTGGTGTTGCACTATCATCTACAGATATGCAAC ATACTCTTAATTTTTATAGTTTGGTTAAAAATGGAGAATCAATTGATGAAATGAAAAAATTT ATTTATTCATATATAAAGTGTTATGATACATTACAAAATGATTTATTTAATGAACATAGGAA AATATGTACAGGAAGGGTGAGGAATTCCAAAGGATTAGATATGTAA
SEQ ID No. 8 MKFFSVMQIFLNLLTISGILLLNIIICDKSETMYSGVYHIYIYRRNLSESKSVKNKGLRNKS EKNKLKNGVDEKNDSTPLNLYNIWSPALGIAKNAFDEMIKDLWLYIEDYLNKYEYQRYHHIM CRRPVCVRIKYRTLYKSKDDIGVALSSTDMQHTLNFYSLVKNGESIDEMKKFIYSYIKCYDT LQNDLFNEHRKICTGRVRNSKGLDMSEQ ID No. 8 MKFFSVMQIFLNLLTISGILLLNIIICDKSETMYSGVYHIYIYRRNLSESKSVKNKGLRNKS EKNKLKNGVDEKNDSTPLNLYNIWSPALGIAKNAFDEMIKDLWLYIEDYLNKYEYQRYHHIM CRRPVCVRIKYRTLYKSKDDIGVALSSTDMQHTLNFYSLVKNGESIDEMKKFIYSYIKCYDT LQNDLFNEHRKICTGRVRNSKGLDM
PFB0105CPFB0105C
SEQ ID No. 9SEQ ID No. 9
ATGTGGTTATGCAAAAGGGGACTGAGTGTTAATGATACAACTAAATGTGATGTTCCATGTAA AGATTTTTACATGTTATTTTTAAGTAATAAAAAAGAGAAAATTAAATGGGAACATTTTTTGG TTATATCTTTTTAAGTAAATTTATGAAATTGTCAATTTCTCTTCTTTTACTTGCATTAATTC AGAATATACTATTAAGCAATGTTTCTTTAATTTCTGGATCACACTTATATAAGAGAAATTCA AGAAAATTTGCTGAGGGATATATGAAGGGAT CTGGATCAGAAAAAAATGTATATCTTTCAAATAAAAATAAAGAAATTAATATGAACCAACAA TCAGATAATAAAATGTGTGATGAATGTGATGATATGAATCAACCAGGAGATGTAAATAAAAA TGACAAAACATCAAATGATCAAGCAAATTCAAGTGATTCTGATTGTGAGCCCTTACCATTTG GATTAAAACCTTCAGATTTAAATAGAAAAGTTACAGAAGAAGATTTAGAAAGAATGATAATA GAATTACCAGGAAAATTAGAAAGGAAAGATATGTATTTAATATGGCATTATAGTCATTCTCT TTTGAGAGATAAATTTAATAAAATGAAAAGTTCGTTATGGAGTATTTGTGGGAAATTAGCTC ATGAACATAAGTTACCATTCAAAATTAAAATGAAGAAATGGTGGAAATGTTGTGGTCATGTT ACAGATGAATTATTAATAAAAGAGCATGATGATTATAATTCTATATATAATTATATTAATAA TGAATCATCAAGTCGTGAACAATTTCTTATATTTCTTAATATGATAAAGCATTCATGGACAA CATTTACTATGGAGACTTTTATTAAATGTAAGATTTCTTTAGAAAATAACATGAGAAATGTT ACAAATTAAATGTGGTTATGCAAAAGGGGACTGAGTGTTAATGATACAACTAAATGTGATGTTCCATGTAA AGATTTTTACATGTTATTTTTAAGTAATAAAAAAGAGAAAATTAAATGGGAACATTTTTTGG TTATATCTTTTTAAGTAAATTTATGAAATTGTCAATTTCTCTTCTTTTACTTGCATTAATTC AGAATATACTATTAAGCAATGTTTCTTTAATTTCTGGATCACACTTATATAAGAGAAATTCA AGAAAATTTGCTGAGGGATATATGAAGGGAT CTGGATCAGAAAAAAATGTATATCTTTCAAATAAAAATAAAGAAATTAATATGAACCAACAA TCAGATAATAAAATGTGTGATGAATGTGATGATATGAATCAACCAGGAGATGTAAATAAAAA TGACAAAACATCAAATGATCAAGCAAATTCAAGTGATTCTGATTGTGAGCCCTTACCATTTG GATTAAAACCTTCAGATTTAAATAGAAAAGTTACAGAAGAAGATTTAGAAAGAATGATAATA GAATTACCAGGAAAATTAGAAAGGAAAGATATGTATTTAATATGGCATTATAGTCATTCTCT TTTGAGAGATAAATTTAATAAAATGAAAAGTTCGTTATGGAGTATTTGTGGGAAATTAGCTC ATGAACATAAGTTACCATTCAAAATTAAAATGAAGAAATGGTGGAAATGTTGTGGTCATGTT ACAGATGAATTATTAATAAAAGAGCATGATGATTATAATTCTATATATAATTATATTAATAA TGAATCATCAAGTCGTGAACAATTTCTTATATTTCTTAATATGATAAAGCATTCATGGACAA CATTTACTATGGAGACTTTTATTAAATGTAAGATTTCTTTAGAAAATAACATGAGAAATGTT ACAAATTAA
SEQ ID No. 10SEQ ID No. 10
MWLCKRGLSVNDTTKCDVPCKDFYMLFLSNKKEKIKCGTFFGYIFLSKFMKLSISLLLLALI QNILLSNVSLISGSHLYKRNSRKFAEGYMKGSGSEKNVYLSNKNKEINMNQQSDNKMCDECD DMNQPGDVNKNDKTSNDQANSSDSDCEPLPFGLKPSDLNRKVTEEDLERMIIELPGKLERKD MYLIWHYSHSLLRDKFNKMKSSLWSICGKLAHEHKLPFKIKMKKWWKCCGHVTDELLIKEHD DYNSIYNYINNESSSREQFLIFLNMIKHSWTTFTMETFIKCKISLENNMRNVTNMWLCKRGLSVNDTTKCDVPCKDFYMLFLSNKKEKIKCGTFFGYIFLSKFMKLSISLLLLALI QNILLSNVSLISGSHLYKRNSRKFAEGYMKGSGSEKNVYLSNKNKEINMNQQSDNKMCDECD DMNQPGDVNKNDKTSNDQANSSDSDCEPLPFGLKPSDLNRKVTEEDLERMIIELPGKLERKD MYLIWHYSHSLLRDKFNKMKSSLWSICGKLAHEHKLPFKIKMKKWWKCCGHVTDELLIKEHD DYNSIYNYINNESSSREQFLIFLNMIKHSWTTFTMETFIKCKISLENNMRNVTN
PF10_0351PF10_0351
SEQ ID No. 11SEQ ID No. 11
ATGTTGAATATTTTTAATATAATTTTCTTGTTGTTTTTAATAAACATATATATATGTGAAGC CAATGGAACACTCTCTGAAAATATTGAAAGTGCTGAAGAGATAGATGCTTTAAAAACGAATT TAAGAAATGGATATTTAAATAATACTTATTTTAATGAAGAAAACAATAATTTAAATATAGAA AATGAAATAAATAATACAAATTATAATGAAGTAACAGAAGAAACTAAAGAAGAATTATATGA TATAAATGAAAATATTTTCCCTGATTATTTTTTTCTTGATATCTTTACTGAAAATAAAGAAC AAAAAAATGAAGAAGTACCAATGAAATAGAAGTAGTAAATGATGGAGAAGAAGTAAAAACAG AATATGTATCTGAAAAAAATGAGGAAGTAGAAAATAAATCGGAAACTGAAATAGGTGAAGAA TTAACTGAAAAAGTAGATGAAAAAGTACCTGAAGAAGTAGCTGAAGAATTAGTTGAAAAAGT AGATGAAGAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAAAAAGTAGCTGAAGAAGTGA TCAAAAAGTAGATGAAGAAGTAACTGAAGAATTAATTGAAAAAGTAGATGAAGAAGTAACTG AAGAATTAATTGAAAAAGTAGATGAAGAAGTTGCTGAAGAATTAATTGAAAAAGTAGATGAA GAAGTTGCTGAAGAATTAATTGAAAAGGTAGCTGATGAATTAATTGAAAAAGTAGATGAAGA AGTTGCTGAAGAATTAATTGAAAAGGTAGCTGATGAATTAGTTGAAAAAGTAGCTGAAGAAT TAGTTGAAAAAGTAGATGAAGAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAAAAAGTA GCTGAAGAAGTAGATCAAAAAGTAGATGAAGAAGTAACTGAAGAATTAATTGAAAAAGTAGA TGAAGAAGTAACTGAAGAATTAATTGAAAAAGTAGATGAAGAAGTTGCTGAAGAATTAATTG AAAAAGTAGATGAAGAAGTTGCTGAAGAATTAATTGAAAAGGTAGCTGATGAATTAGTTGAA AAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAACAAGTAGCTGAAGAATTAGTTGAAAA AGTAGATGAACAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAACAAGTAGTTGAAGAAG TAGCTGAAGAAGTAGCTGAAGAAGTAGTTGAAGAAGGTGAAAAAGTACCTGAAGAAGTAGCT GAAGAAGTAGCTGAAGAAGTAGCTGAAGAAGTAGCTGAAGAAGTAGCTGAAGAATTAGTTGA AAAAGTAGATGAAGAAGTAGCTGAAAAAGTAGTTGAAGAAGAAGGTGAAAAAGTACCTGAAG AAGTAGTTGAAGAAGTAGATGAAGAAGTAGCTGAAAAAGTAGTTGAAGAAGAAGGTGAAAAA GTACTTGAAGAAGTAATTGAAGAAGTAGTTGAAGAAGTAGCCGAAGAAGTAGCTGAAAAAGT AGTTGAAGAACAAGGTGAAAAAGTAAACAAAAATGATTTAAATGATGCATCTTCCGAGGAAA TTAAGGATTCTAGTGATTTTAAAGAATCTCATGAGGAATTATTTAAAGTTTTCCTGGAGTTA ATTAATAAAAACGATTTAGTTAAAGAAAATTTAAAAAAGATTACAAACAATTTAAATGAAAT GCATTTAAGCACTTTATATCCATAA SEQ ID No. 12ATGTTGAATATTTTTAATATAATTTTCTTGTTGTTTTTAATAAACATATATATATGTGAAGC CAATGGAACACTCTCTGAAAATATTGAAAGTGCTGAAGAGATAGATGCTTTAAAAACGAATT TAAGAAATGGATATTTAAATAATACTTATTTTAATGAAGAAAACAATAATTTAAATATAGAA AATGAAATAAATAATACAAATTATAATGAAGTAACAGAAGAAACTAAAGAAGAATTATATGA TATAAATGAAAATATTTTCCCTGATTATTTTTTTCTTGATATCTTTACTGAAAATAAAGAAC AAAAAAATGAAGAAGTACCAATGAAATAGAAGTAGTAAATGATGGAGAAGAAGTAAAAACAG AATATGTATCTGAAAAAAATGAGGAAGTAGAAAATAAATCGGAAACTGAAATAGGTGAAGAA TTAACTGAAAAAGTAGATGAAAAAGTACCTGAAGAAGTAGCTGAAGAATTAGTTGAAAAAGT AGATGAAGAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAAAAAGTAGCTGAAGAAGTGA TCAAAAAGTAGATGAAGAAGTAACTGAAGAATTAATTGAAAAAGTAGATGAAGAAGTAACTG AAGAATTAATTGAAAAAGTAGATGAAGAAGTTGCTGAAGAATTAATTGAAAAAGTAGATGAA GAAGTTGCTGAAGAATTAATTGAAAAGGTAGCTGATGAATTAATTGAAAAAGTAGATGAAGA AGTTGCTGAAGAATTAATTGAAAAGGTAGCTGATGAATTAGTTGAAAAAGTAGCTGAAGAAT TAGTTGAAAAAGTAGATGAAGAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAAAAAGTA GCTGAAGAAGTAGATCAAAAAGTAGATGAAGAAGTAACTGAAGAATTAATTGAAAAAGTAGA TGAAGAAGTAACTGAAGAATTAATTGAAAAAGTAGATGAAGAAGTTGCTGAAGAATTAATTG AAAAAGTAGATGAAGAAGTTGCTGAAGAATTAATTGAAAAGGTAGCTGATGAATTAGTTGAA AAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAACAAGTAGCTGAAGAATTAGTTGAAAA AGTAGATGAACAAGTAGCTGAAGAATTAGTTGAAAAAGTAGATGAACAAGTAGTTGAAGAAG TAGCTGAAGAAGTAGCTGAAGAAGTAGTTGAAGAAGGTGAAAAAGTACCTGAAGAAGTAGCT GAAGAAGTAGCTGAAGAAGTAGCTGAAGAAGTAGCTGAAGAAGTAGCTGAAGAATTAGTTGA AAAAGTAGATGAAGAAGTAGCTGAAAAAGTAGTTGAAGAAGAAGGTGAAAAAGTACCTGAAG AAGTAGTTGAAGAAGTAGATGAAGAAGTAGCTGAAAAAGTAGTTGAAGAAGAAGGTGAAAAA GTACTTGAAGAAGTAATTGAAGAAGTAGTTGAAGAAGTAGCCGAAGAAGTAGCTGAAAAAGT AGTTGAAGAACAAGGTGAAAAAGTAAACAAAAATGATTTAAATGATGCATCTTCCGAGGAAA TTAAGGATTCTAGTGATTTTAAAGAATCTCATGAGGAATTATTTAAAGTTTTCCTGGAGTTA ATTAATAAAAACGATTTAGTTAAAGAAAATTTAAAAAAGATTACAAACAATTTAAATGAAAT GCATTTAAGCACTTTATATCCATAA SEQ ID No. 12
MLNIFNIIFLLFLINIYICEANGTLSENIESAEEIDALKTNLRNGYLNNTYFNEENNNLNIE NEINNTNYNEVTEETKEELYDINENIFPDYFFLDIFTENKEQKNEEVPMKIEVVNDGEEVKT EYVSEKNEEVENKSETEIGEELTEKVDEKVPEEVAEELVEKVDEEVAEELVEKVDEKVAEEV DQKVDEEVTEELIEKVDEEVTEELIEKVDEEVAEELIEKVDEEVAEELIEKVADELIEKVDE EVAEELIEKVADELVEKVAEELVEKVDEEVAEELVEKVDEKVAEEVDQKVDEEVTEELIEKV DEEVTEELIEKVDEEVAEELIEKVDEEVAEELIEKVADELVEKVAEELVEKVDEQVAEELVE KVDEQVAEELVEKVDEQVVEEVAEEVAEEVVEEGEKVPEEVAEEVAEEVAEEVAEEVAEELV EKVDEEVAEKVVEEEGEKVPEEVVEEVDEEVAEKVVEEEGEKVLEEVIEEVVEEVAEEVAEK VVEEQGEKVNKNDLNDASSEEIKDSSDFKESHEELFKVFLELINKNDLVKENLKKITNNLNE MHLSTLYPMLNIFNIIFLLFLINIYICEANGTLSENIESAEEIDALKTNLRNGYLNNTYFNEENNNLNIE NEINNTNYNEVTEETKEELYDINENIFPDYFFLDIFTENKEQKNEEVPMKIEVVNDGEEVKT EYVSEKNEEVENKSETEIGEELTEKVDEKVPEEVAEELVEKVDEEVAEELVEKVDEKVAEEV DQKVDEEVTEELIEKVDEEVTEELIEKVDEEVAEELIEKVDEEVAEELIEKVADELIEKVDE EVAEELIEKVADELVEKVAEELVEKVDEEVAEELVEKVDEKVAEEVDQKVDEEVTEELIEKV DEEVTEELIEKVDEEVAEELIEKVDEEVAEELIEKVADELVEKVAEELVEKVDEQVAEELVE KVDEQVAEELVEKVDEQVVEEVAEEVAEEVVEEGEKVPEEVAEEVAEEVAEEVAEEVAEELV EKVDEEVAEKVVEEEGEKVPEEVVEEVDEEVAEKVVEEEGEKVLEEVIEEVVEEVAEEVAEK VVEEQGEKVNKNDLNDASSEEIKDSSDFKESHEELFKVFLELINKNDLVKENLKKITNNLNE MHLSTLYP
PF10_0350 SEQ ID No. 13 ATGAAATATATATTAAGTATTAGTCTTTTTTTAATTCTTTTAAATTTATATAAATGTGCTAG TATATCATGTGAAATAGATTACACCCCTAGTACCAATATTACTAGCAATTTAAATTCTAATT TAAGAAGCTGTTCTTCTAATCTTGTTCTTTCTTCAAATATAGATTCTACTAAATTAGAAGGA ACATATGGTGAAAATTTAAACGACAGTGTATCTTTGACGAATAATATTAATGATCATACAAC TAACGAATCAAATATATCAAATGTATCAAATATATCAAATGAATCAAATATATCAAATGAAT CAAGTATAACTAACCAGTCAAATTTATCTAGCGAAACAAATATATCTAGCGAAACAAATATA TCTAACGAATCAAGTGTACCAAATGAAAGCAGTGTCAATGAGGTACCTCAACTTGAAGTACC TAAAGATGCAGTAGAAAATCACACAGAATCCAAAGATGTTTTATTGAATGAAAAGGAAAATT TTGCAAATGGAGTGGAAACACATGTTGATCTAGGATCCCAAGAACAATATTTTGGATCTTCC TATGATATGAATATGGACACAGAAGGAGGAATAAAAAAGTTCAAAAATGTGTTTCAGTCTTA TTTTAATCAATCCAAAGGAAATAGTGGTACTGAAGGTGATGGATCAAGTGTATTTGGATCCA TATTTGGTAGCTTATTAACCCCTATAGATTCATTGTTAGAAAAATTTATAGGATCTAACAAT ACAAATTCGGATTCTAATGTGAAGAACACTTCTATGGGAAATGGACAAAATAAATACGACAA TAATATATACTTAGATGAAGAAGATGCTTTGAGTGATGCAGAACATTATAATGATGGTAGTA TAAGTTTAGGCGAAGAAGATGAGTTGAGTGATGCAGAACATTATAATGATGGAAGTATAAGT TTAGATGAAGAAGATGAGTTGAGTGATGCAGAACATTATAATGATGGAGGTATATGTTTAGG TGAAGAAGATGAGTTAAGTGATGCAGAACATTATAATGATGGAGGTATAAGTTTAGATGAAG AAGATGTGTTGAGTGATGCAGAACATTATAATGATGGAGATATAAGTTTAGATGAAGATGAG TTAAGTGATACAGAAAATTATTATGATGGAGGTATAAGTTTAGACGAATCAGATGATTTGAG TGACCCCGAAAGTAAAACAAAAGAAGATAACTACCATTTATATTATTGGGATGATTTCTATC ATGAATATAAACCAACTTATTTAAATTATCATATGCATTATACACTTTATGAACCAAACAAT TTTTATGATACTACTAATGAAGAAACACACAATTTTTATAATACTACTAATGAAGAATCACA CAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAAT CACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAA GAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCA TGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTA CTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAAC CCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTA CACCCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATT TTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACAC AATTTTTACAACCCTACTCATGAAGAATCA CACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACACCCCTACTCATGATGA ATTTAATGTTCCTTTAAATTATAACCATGACTACGATTACAATTACTTTGAAAATGATAATT ATAATATTCAAAATGTTAAAGACAATTTGGTAAAAAAAGTTAATGATTTCATGGAATCAGAT AATTTATTAGTTAATACCTTTAAAGGTATAGCTGGGGGTGTTACTAGTTTTTTCGGATATTAPF10_0350 SEQ ID No. 13 ATGAAATATATATTAAGTATTAGTCTTTTTTTAATTCTTTTAAATTTATATAAATGTGCTAG TATATCATGTGAAATAGATTACACCCCTAGTACCAATATTACTAGCAATTTAAATTCTAATT TAAGAAGCTGTTCTTCTAATCTTGTTCTTTCTTCAAATATAGATTCTACTAAATTAGAAGGA ACATATGGTGAAAATTTAAACGACAGTGTATCTTTGACGAATAATATTAATGATCATACAAC TAACGAATCAAATATATCAAATGTATCAAATATATCAAATGAATCAAATATATCAAATGAAT CAAGTATAACTAACCAGTCAAATTTATCTAGCGAAACAAATATATCTAGCGAAACAAATATA TCTAACGAATCAAGTGTACCAAATGAAAGCAGTGTCAATGAGGTACCTCAACTTGAAGTACC TAAAGATGCAGTAGAAAATCACACAGAATCCAAAGATGTTTTATTGAATGAAAAGGAAAATT TTGCAAATGGAGTGGAAACACATGTTGATCTAGGATCCCAAGAACAATATTTTGGATCTTCC TATGATATGAATATGGACACAGAAGGAGGAATAAAAAAGTTCAAAAATGTGTTTCAGTCTTA TTTTAATCAATCCAAAGGAAATAGTGGTACTGAAGGTGATGGATCAAGTGTATTTGGATCCA TATTTGGTAGCTTATTAACCCCTATAGATTCATTGTTAGAAAAATTTATAGGATCTAACAAT ACAAATTCGGATTCTAATGTGAAGAACACTTCTATGGGAAATGGACAAAATAAATACGACAA TAATATATACTTAGATGAAGAAGATGCTTTGAGTGATGCAGAACATTATAATGATGGTAGTA TAAGTTTAGGCGAAGAAGATGAGTTGAGTGATGCAGAACATTATAATGATGGAAGTATAAGT TTAGATGAAGAAGATGAGTTGAGTGATGCAG AACATTATAATGATGGAGGTATATGTTTAGG TGAAGAAGATGAGTTAAGTGATGCAGAACATTATAATGATGGAGGTATAAGTTTAGATGAAG AAGATGTGTTGAGTGATGCAGAACATTATAATGATGGAGATATAAGTTTAGATGAAGATGAG TTAAGTGATACAGAAAATTATTATGATGGAGGTATAAGTTTAGACGAATCAGATGATTTGAG TGACCCCGAAAGTAAAACAAAAGAAGATAACTACCATTTATATTATTGGGATGATTTCTATC ATGAATATAAACCAACTTATTTAAATTATCATATGCATTATACACTTTATGAACCAAACAAT TTTTATGATACTACTAATGAAGAAACACACAATTTTTATAATACTACTAATGAAGAATCACA CAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAAT CACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAA GAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCA TGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTA CTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACAAC CCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTA CACCCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACACAATT TTTACAACCCTACTCATGAAGAATCACACAATTTTTACAACCCTACTCATGAAGAATCACAC AATTTTTACAACCCTACTCATGAAGAATCA CACAATTTTTACAACCCTACTCATGAAGAATCACACAATTTTTACACCCCTACTCATGATGA ATTTAATGTTCCTTTAAATTATAACCATGACTACGATTACAATTACTTTGAAAATGATAATT ATAATATTCAAAATGTTAAAGACAATTTGGTAAAAAAAGTTAATGATTTCATGGAATCAGAT AATTTATTAGTTAATACCTTTAAAGGTATAGCTGGGGGTGTTACTAGTTTTTTCGGATATTA
AAT
SEQ ID No. 14SEQ ID No. 14
MKYILSISLFLILLNLYKCASISCEIDYTPSTNITSNLNSNLRSCSSNLVLSSNIDSTKLEG TYGENLNDSVSLTNNINDHTTNESNISNVSNISNESNISNESSITNQSNLSSETNISSETNI SNESSVPNESSVNEVPQLEVPKDAVENHTESKDVLLNEKENFANGVETHVDLGSQEQYFGSS YDMNMDTEGGIKKFKNVFQSYFNQSKGNSGTEGDGSSVFGSIFGSLLTPIDSLLEKFIGSNN TNSDSNVKNTSMGNGQNKYDNNIYLDEEDALSDAEHYNDGSISLGEEDELSDAEHYNDGSIS LDEEDELSDAEHYNDGGICLGEEDELSDAEHYNDGGISLDEEDVLSDAEHYNDGDISLDEDE LSDTENYYDGGISLDESDDLSDPESKTKEDNYHLYYWDDFYHEYKPTYLNYHMHYTLYEPNN FYDTTNEETHNFYNTTNEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHE ESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYN PTHEESHNFYNPTHEESHNFYTPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESH NFYNPTHEESHNFYNPTHEESHNFYTPTHDEFNVPLNYNHDYDYNYFENDNYNIQNVKDNLV KKVNDFMESDNLLVNTFKGIAGGVTSFFGY MKYILSISLFLILLNLYKCASISCEIDYTPSTNITSNLNSNLRSCSSNLVLSSNIDSTKLEG TYGENLNDSVSLTNNINDHTTNESNISNVSNISNESNISNESSITNQSNLSSETNISSETNI SNESSVPNESSVNEVPQLEVPKDAVENHTESKDVLLNEKENFANGVETHVDLGSQEQYFGSS YDMNMDTEGGIKKFKNVFQSYFNQSKGNSGTEGDGSSVFGSIFGSLLTPIDSLLEKFIGSNN TNSDSNVKNTSMGNGQNKYDNNIYLDEEDALSDAEHYNDGSISLGEEDELSDAEHYNDGSIS LDEEDELSDAEHYNDGGICLGEEDELSDAEHYNDGGISLDEEDVLSDAEHYNDGDISLDEDE LSDTENYYDGGISLDESDDLSDPESKTKEDNYHLYYWDDFYHEYKPTYLNYHMHYTLYEPNN FYDTTNEETHNFYNTTNEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHE ESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESHNFYN PTHEESHNFYNPTHEESHNFYTPTHEESHNFYNPTHEESHNFYNPTHEESHNFYNPTHEESH NFYNPTHEESHNFYNPTHEESHNFYTPTHDEFNVPLNYNHDYDYNYFENDNYNIQNVKDNLV KKVNDFMESDNLLVNTFKGIAGGVTSFFGY
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR0702772A FR2915207B1 (en) | 2007-04-17 | 2007-04-17 | POLYNUCLEOTIDES AND POLYPEPTIDES INVOLVED IN GESTATIONAL MALARIA AND BIOLOGICAL APPLICATIONS. |
| PCT/IB2008/051482 WO2008126065A2 (en) | 2007-04-17 | 2008-04-17 | Polynucleotides and polypeptides involved in gestational malaria, and biological applications |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2145003A2 true EP2145003A2 (en) | 2010-01-20 |
Family
ID=38613117
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP08737901A Withdrawn EP2145003A2 (en) | 2007-04-17 | 2008-04-17 | Polynucleotides and polypeptides involved in gestational malaria, and biological applications |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US8563008B2 (en) |
| EP (1) | EP2145003A2 (en) |
| AP (1) | AP3116A (en) |
| FR (1) | FR2915207B1 (en) |
| WO (1) | WO2008126065A2 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB201318084D0 (en) * | 2013-10-11 | 2013-11-27 | Isis Innovation | Malaria vaccination |
| US9321834B2 (en) | 2013-12-05 | 2016-04-26 | Leidos, Inc. | Anti-malarial compositions |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090047303A1 (en) * | 2005-05-16 | 2009-02-19 | Alan Shaw | Method for improving the immunogenicity of plasmodium antigens |
| US20070036819A1 (en) * | 2005-08-09 | 2007-02-15 | Michal Fried | Malaria vaccines |
-
2007
- 2007-04-17 FR FR0702772A patent/FR2915207B1/en not_active Expired - Fee Related
-
2008
- 2008-04-17 US US12/450,874 patent/US8563008B2/en not_active Expired - Fee Related
- 2008-04-17 EP EP08737901A patent/EP2145003A2/en not_active Withdrawn
- 2008-04-17 AP AP2009005041A patent/AP3116A/en active
- 2008-04-17 WO PCT/IB2008/051482 patent/WO2008126065A2/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2008126065A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2008126065A3 (en) | 2008-12-31 |
| AP3116A (en) | 2015-02-28 |
| FR2915207A1 (en) | 2008-10-24 |
| US20100255018A1 (en) | 2010-10-07 |
| US8563008B2 (en) | 2013-10-22 |
| FR2915207B1 (en) | 2012-10-05 |
| WO2008126065A2 (en) | 2008-10-23 |
| AP2009005041A0 (en) | 2009-12-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP0666916B1 (en) | Plasmodium falciparum antigens inducing protective antibodies | |
| US5814617A (en) | Protective 17 KDA malaria hepatic and erythrocytic stage immunogen and gene | |
| EP0570489B1 (en) | LIVER-STAGE-SPECIFIC PEPTIDE SEQUENCES OF $i(P. FALCIPARUM) BEARING EPITOPES CAPABLE OF STIMULATING THE T LYMPHOCYTES | |
| JP2009000104A (en) | Pre-erythrocytic malaria polypeptide molecule | |
| EP0301961B1 (en) | Specific secretion-excretion-antigens from toxoplasma gondii, expression products therefrom, production processes therefor and their diagnostic and prophylactic applications | |
| WO1984002472A1 (en) | Polypeptidic fractions inducing protection antibodies against parasites of paludism, and immunizing compositions containing them | |
| WO2008126065A2 (en) | Polynucleotides and polypeptides involved in gestational malaria, and biological applications | |
| WO1997030159A2 (en) | Recombinant protein containing a c-terminal fragment of plasmodium msp-1 | |
| EP2945648A1 (en) | Vaccines against pregnancy-associated malaria | |
| EP0407230B1 (en) | Sporozoite and liver-stage protein antigen of P. falciparum | |
| AU2001277513B2 (en) | Proteins involved in cytoadhesion of plasmodium falciparum ring-stage-infected erythrocytes | |
| JP2002371098A (en) | Diagnostic material for malaria infection and antigen for immunization to suppress the growth of malaria parasite | |
| US20030104003A1 (en) | Novel surface protein of the malaria parasite plasmodium falciparum | |
| WO1992002549A1 (en) | Plasmodium falciparum antigen for eliciting protective antibodies for use in vaccines | |
| AU2001277513A1 (en) | Proteins involved in cytoadhesion of plasmodium falciparum ring-stage-infected erythrocytes | |
| CN104736710A (en) | Use of P47 from plasmodium falciparum (PFS47) or plasmodium vivax (PVS47) as a vaccine or drug screening targets for the inhibition of human malaria transmission | |
| JPWO2001012813A1 (en) | Gene encoding a protein from merozoites of Babesia cavalli, recombinant protein obtained from said gene, and use thereof | |
| CA2346968A1 (en) | Plasmodium falciparum antigens and their vaccinal and diagnostic applications | |
| CA2345206A1 (en) | Plasmodium falciparum antigens and vaccinal and diagnostic applications thereof | |
| WO2012011381A1 (en) | Malaria vaccine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20091023 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MT NL NO PL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL BA MK RS |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: TUIKUE NDAM, NICAISE, GEORGES Inventor name: DELORON, PHILIPPE, LUCIEN Inventor name: SALANTI, ALI Inventor name: BERTIN, GWLADYS, IRENEE Inventor name: COPPEE, JEAN-YVES Inventor name: BISCHOFF, EMMANUEL Inventor name: PROUX, CAROLINE, STEPHANIE Inventor name: DAVID, PETER Inventor name: LAVSTSEN, THOMAS |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: TUIKUE NDAM, NICAISE, GEORGES Inventor name: BERTIN, GWLADYS, IRENEE Inventor name: COPPEE, JEAN-YVES Inventor name: LAVSTSEN, THOMAS Inventor name: DAVID, PETER Inventor name: SALANTI, ALI Inventor name: BISCHOFF, EMMANUEL Inventor name: PROUX, CAROLINE, STEPHANIE Inventor name: DELORON, PHILIPPE, LUCIEN |
|
| 17Q | First examination report despatched |
Effective date: 20100414 |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20161101 |