EP1926748B1 - Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance - Google Patents
Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance Download PDFInfo
- Publication number
- EP1926748B1 EP1926748B1 EP06792228A EP06792228A EP1926748B1 EP 1926748 B1 EP1926748 B1 EP 1926748B1 EP 06792228 A EP06792228 A EP 06792228A EP 06792228 A EP06792228 A EP 06792228A EP 1926748 B1 EP1926748 B1 EP 1926748B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- sequence
- glp
- fusion peptide
- peptide
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Not-in-force
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 370
- 230000004927 fusion Effects 0.000 title claims abstract description 190
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 title claims abstract description 141
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 title claims abstract description 13
- 102000004196 processed proteins & peptides Human genes 0.000 title abstract description 90
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 title description 132
- 229920001184 polypeptide Polymers 0.000 title description 16
- 102000035195 Peptidases Human genes 0.000 title description 9
- 108091005804 Peptidases Proteins 0.000 title description 9
- 235000019833 protease Nutrition 0.000 title description 2
- 101100337060 Caenorhabditis elegans glp-1 gene Proteins 0.000 title 1
- 150000001413 amino acids Chemical class 0.000 claims abstract description 76
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 claims abstract description 32
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 claims abstract description 30
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 21
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims abstract description 16
- 208000035475 disorder Diseases 0.000 claims abstract description 13
- 201000010099 disease Diseases 0.000 claims abstract description 8
- 239000003814 drug Substances 0.000 claims abstract description 8
- 208000015122 neurodegenerative disease Diseases 0.000 claims abstract description 5
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 claims abstract 8
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 claims abstract 2
- 229940024606 amino acid Drugs 0.000 claims description 75
- 210000004027 cell Anatomy 0.000 claims description 66
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 59
- 101800004266 Glucagon-like peptide 1(7-37) Proteins 0.000 claims description 55
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 47
- 238000011282 treatment Methods 0.000 claims description 40
- 239000000203 mixture Substances 0.000 claims description 35
- -1 -hydroxy-histidine Chemical compound 0.000 claims description 33
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 claims description 33
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims description 30
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 claims description 27
- 150000003839 salts Chemical group 0.000 claims description 26
- 238000009472 formulation Methods 0.000 claims description 25
- 230000004048 modification Effects 0.000 claims description 25
- 238000012986 modification Methods 0.000 claims description 25
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 claims description 24
- 102400000324 Glucagon-like peptide 1(7-37) Human genes 0.000 claims description 23
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 23
- 238000000034 method Methods 0.000 claims description 21
- 150000007523 nucleic acids Chemical class 0.000 claims description 21
- 150000001408 amides Chemical class 0.000 claims description 19
- 108020004707 nucleic acids Proteins 0.000 claims description 19
- 102000039446 nucleic acids Human genes 0.000 claims description 19
- 229960002885 histidine Drugs 0.000 claims description 14
- 241001465754 Metazoa Species 0.000 claims description 13
- 125000000539 amino acid group Chemical group 0.000 claims description 13
- 230000004071 biological effect Effects 0.000 claims description 12
- 206010012601 diabetes mellitus Diseases 0.000 claims description 12
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 239000013598 vector Substances 0.000 claims description 11
- PAJPWUMXBYXFCZ-UHFFFAOYSA-N 1-aminocyclopropanecarboxylic acid Chemical compound OC(=O)C1(N)CC1 PAJPWUMXBYXFCZ-UHFFFAOYSA-N 0.000 claims description 10
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 10
- 108010058003 Proglucagon Proteins 0.000 claims description 10
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 10
- CNMAQBJBWQQZFZ-LURJTMIESA-N (2s)-2-(pyridin-2-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=CC=N1 CNMAQBJBWQQZFZ-LURJTMIESA-N 0.000 claims description 9
- WTKYBFQVZPCGAO-LURJTMIESA-N (2s)-2-(pyridin-3-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=CN=C1 WTKYBFQVZPCGAO-LURJTMIESA-N 0.000 claims description 9
- SAAQPSNNIOGFSQ-LURJTMIESA-N (2s)-2-(pyridin-4-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=NC=C1 SAAQPSNNIOGFSQ-LURJTMIESA-N 0.000 claims description 9
- MSECZMWQBBVGEN-LURJTMIESA-N (2s)-2-azaniumyl-4-(1h-imidazol-5-yl)butanoate Chemical compound OC(=O)[C@@H](N)CCC1=CN=CN1 MSECZMWQBBVGEN-LURJTMIESA-N 0.000 claims description 9
- UYEGXSNFZXWSDV-BYPYZUCNSA-N (2s)-3-(2-amino-1h-imidazol-5-yl)-2-azaniumylpropanoate Chemical compound OC(=O)[C@@H](N)CC1=CNC(N)=N1 UYEGXSNFZXWSDV-BYPYZUCNSA-N 0.000 claims description 9
- FVTVMQPGKVHSEY-UHFFFAOYSA-N 1-AMINOCYCLOBUTANE CARBOXYLIC ACID Chemical compound OC(=O)C1(N)CCC1 FVTVMQPGKVHSEY-UHFFFAOYSA-N 0.000 claims description 9
- WOXWUZCRWJWTRT-UHFFFAOYSA-N 1-amino-1-cyclohexanecarboxylic acid Chemical compound OC(=O)C1(N)CCCCC1 WOXWUZCRWJWTRT-UHFFFAOYSA-N 0.000 claims description 9
- IINRZEIPFQHEAP-UHFFFAOYSA-N 1-aminocycloheptane-1-carboxylic acid Chemical compound OC(=O)C1(N)CCCCCC1 IINRZEIPFQHEAP-UHFFFAOYSA-N 0.000 claims description 9
- NILQLFBWTXNUOE-UHFFFAOYSA-N 1-aminocyclopentanecarboxylic acid Chemical compound OC(=O)C1(N)CCCC1 NILQLFBWTXNUOE-UHFFFAOYSA-N 0.000 claims description 9
- HNDVDQJCIGZPNO-RXMQYKEDSA-N D-histidine Chemical compound OC(=O)[C@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-RXMQYKEDSA-N 0.000 claims description 9
- 229930195721 D-histidine Natural products 0.000 claims description 9
- KBOJOGQFRVVWBH-ZETCQYMHSA-N N-acetyl-L-histidine Chemical compound CC(=O)N[C@H](C(O)=O)CC1=CN=CN1 KBOJOGQFRVVWBH-ZETCQYMHSA-N 0.000 claims description 9
- ZCKYOWGFRHAZIQ-UHFFFAOYSA-N dihydrourocanic acid Chemical compound OC(=O)CCC1=CNC=N1 ZCKYOWGFRHAZIQ-UHFFFAOYSA-N 0.000 claims description 9
- PJSQECUPWDUIBT-UHFFFAOYSA-N 1-azaniumylcyclooctane-1-carboxylate Chemical compound OC(=O)C1(N)CCCCCCC1 PJSQECUPWDUIBT-UHFFFAOYSA-N 0.000 claims description 8
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 claims description 7
- 230000002779 inactivation Effects 0.000 claims description 6
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 claims description 5
- 230000007935 neutral effect Effects 0.000 claims description 5
- MPVGZUDRATZEEE-YFKPBYRVSA-N (2s)-2-amino-3-(3-hydroxyimidazol-4-yl)propanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1O MPVGZUDRATZEEE-YFKPBYRVSA-N 0.000 claims description 4
- 102000009027 Albumins Human genes 0.000 claims description 4
- 108010088751 Albumins Proteins 0.000 claims description 4
- 101000886868 Homo sapiens Gastric inhibitory polypeptide Proteins 0.000 claims description 4
- 210000004102 animal cell Anatomy 0.000 claims description 4
- 230000006907 apoptotic process Effects 0.000 claims description 4
- 206010022489 Insulin Resistance Diseases 0.000 claims description 3
- 102000035554 Proglucagon Human genes 0.000 claims description 3
- 108090000901 Transferrin Proteins 0.000 claims description 3
- 102000004338 Transferrin Human genes 0.000 claims description 3
- 230000002424 anti-apoptotic effect Effects 0.000 claims description 3
- 230000002209 hydrophobic effect Effects 0.000 claims description 3
- 230000000813 microbial effect Effects 0.000 claims description 3
- 230000000508 neurotrophic effect Effects 0.000 claims description 3
- 238000002560 therapeutic procedure Methods 0.000 claims description 3
- 239000012581 transferrin Substances 0.000 claims description 3
- 210000001671 embryonic stem cell Anatomy 0.000 claims description 2
- 238000010647 peptide synthesis reaction Methods 0.000 claims description 2
- 239000007787 solid Substances 0.000 claims description 2
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 claims 2
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 claims 2
- 102000014914 Carrier Proteins Human genes 0.000 claims 1
- 108010078791 Carrier Proteins Proteins 0.000 claims 1
- 159000000021 acetate salts Chemical class 0.000 claims 1
- 125000000837 carbohydrate group Chemical group 0.000 claims 1
- 239000012634 fragment Substances 0.000 abstract description 44
- 230000000694 effects Effects 0.000 abstract description 27
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 abstract description 21
- 238000001727 in vivo Methods 0.000 abstract description 12
- 230000036961 partial effect Effects 0.000 abstract description 8
- 238000002360 preparation method Methods 0.000 abstract description 6
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 abstract description 2
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 abstract 1
- 208000034615 apoptosis-related disease Diseases 0.000 abstract 1
- 102100040918 Pro-glucagon Human genes 0.000 description 150
- 235000001014 amino acid Nutrition 0.000 description 66
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 57
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 47
- 239000008103 glucose Substances 0.000 description 46
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 44
- 210000004369 blood Anatomy 0.000 description 39
- 239000008280 blood Substances 0.000 description 39
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 38
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 23
- 241000699670 Mus sp. Species 0.000 description 22
- 125000003275 alpha amino acid group Chemical group 0.000 description 19
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 18
- 241001529936 Murinae Species 0.000 description 17
- 235000018102 proteins Nutrition 0.000 description 17
- 102000004169 proteins and genes Human genes 0.000 description 17
- 108010011459 Exenatide Proteins 0.000 description 16
- 238000007792 addition Methods 0.000 description 15
- 229960001519 exenatide Drugs 0.000 description 15
- 239000000126 substance Substances 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 238000012360 testing method Methods 0.000 description 15
- 235000009697 arginine Nutrition 0.000 description 14
- 239000008194 pharmaceutical composition Substances 0.000 description 14
- 108020004414 DNA Proteins 0.000 description 13
- 108091028043 Nucleic acid sequence Proteins 0.000 description 13
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 13
- 239000011780 sodium chloride Substances 0.000 description 13
- 102000004877 Insulin Human genes 0.000 description 12
- 108090001061 Insulin Proteins 0.000 description 12
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 12
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 12
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 12
- 229940125396 insulin Drugs 0.000 description 12
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 11
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 11
- 102000037865 fusion proteins Human genes 0.000 description 11
- 108020001507 fusion proteins Proteins 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- 238000002347 injection Methods 0.000 description 11
- 239000007924 injection Substances 0.000 description 11
- 102000017011 Glycated Hemoglobin A Human genes 0.000 description 10
- 108010014663 Glycated Hemoglobin A Proteins 0.000 description 10
- 210000004899 c-terminal region Anatomy 0.000 description 10
- 230000015556 catabolic process Effects 0.000 description 10
- 150000001875 compounds Chemical class 0.000 description 10
- 238000006731 degradation reaction Methods 0.000 description 10
- 229940090044 injection Drugs 0.000 description 10
- 239000004475 Arginine Substances 0.000 description 9
- 239000004472 Lysine Substances 0.000 description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 description 9
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 9
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 9
- 229960003121 arginine Drugs 0.000 description 9
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 9
- 239000003795 chemical substances by application Substances 0.000 description 9
- 229960003646 lysine Drugs 0.000 description 9
- 235000018977 lysine Nutrition 0.000 description 9
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 239000002253 acid Substances 0.000 description 8
- 230000027455 binding Effects 0.000 description 8
- 108010063245 glucagon-like peptide 1 (7-36)amide Proteins 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 108091016366 Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 description 7
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 7
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 7
- 230000037396 body weight Effects 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 235000012631 food intake Nutrition 0.000 description 7
- 210000004379 membrane Anatomy 0.000 description 7
- 210000000496 pancreas Anatomy 0.000 description 7
- 230000004044 response Effects 0.000 description 7
- 235000000346 sugar Nutrition 0.000 description 7
- 239000006228 supernatant Substances 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 102100035043 Histone-lysine N-methyltransferase EHMT1 Human genes 0.000 description 6
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 6
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 6
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 6
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 239000004365 Protease Substances 0.000 description 6
- 102000001708 Protein Isoforms Human genes 0.000 description 6
- 108010029485 Protein Isoforms Proteins 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Substances CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 6
- 235000004279 alanine Nutrition 0.000 description 6
- 238000004113 cell culture Methods 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical class OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- 230000005847 immunogenicity Effects 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 239000013558 reference substance Substances 0.000 description 6
- 230000003248 secreting effect Effects 0.000 description 6
- 238000010254 subcutaneous injection Methods 0.000 description 6
- 150000005846 sugar alcohols Chemical class 0.000 description 6
- 239000004094 surface-active agent Substances 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 5
- 102000007446 Glucagon-Like Peptide-1 Receptor Human genes 0.000 description 5
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- 150000001295 alanines Chemical class 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 238000007446 glucose tolerance test Methods 0.000 description 5
- 229960002449 glycine Drugs 0.000 description 5
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 5
- 238000007912 intraperitoneal administration Methods 0.000 description 5
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 239000003381 stabilizer Substances 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 4
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 4
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 4
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 4
- 229930195725 Mannitol Natural products 0.000 description 4
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 210000004556 brain Anatomy 0.000 description 4
- 150000001720 carbohydrates Chemical class 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 235000011187 glycerol Nutrition 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 239000000594 mannitol Substances 0.000 description 4
- 235000010355 mannitol Nutrition 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- XOAAWQZATWQOTB-UHFFFAOYSA-N taurine Chemical compound NCCS(O)(=O)=O XOAAWQZATWQOTB-UHFFFAOYSA-N 0.000 description 4
- 235000008521 threonine Nutrition 0.000 description 4
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- DKJPOZOEBONHFS-ZLUOBGJFSA-N Ala-Ala-Asp Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O DKJPOZOEBONHFS-ZLUOBGJFSA-N 0.000 description 3
- 208000024827 Alzheimer disease Diseases 0.000 description 3
- 101800001415 Bri23 peptide Proteins 0.000 description 3
- 102400000107 C-terminal peptide Human genes 0.000 description 3
- 101800000655 C-terminal peptide Proteins 0.000 description 3
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 3
- IVOMOUWHDPKRLL-KQYNXXCUSA-N Cyclic adenosine monophosphate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-KQYNXXCUSA-N 0.000 description 3
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 3
- 102000003779 Dipeptidyl-peptidases and tripeptidyl-peptidases Human genes 0.000 description 3
- 108090000194 Dipeptidyl-peptidases and tripeptidyl-peptidases Proteins 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- KIEICAOUSNYOLM-NRPADANISA-N Glu-Val-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O KIEICAOUSNYOLM-NRPADANISA-N 0.000 description 3
- 101000684208 Homo sapiens Prolyl endopeptidase FAP Proteins 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- 102000000422 Matrix Metalloproteinase 3 Human genes 0.000 description 3
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 3
- 101100395023 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) his-7 gene Proteins 0.000 description 3
- QARPMYDMYVLFMW-KKUMJFAQSA-N Phe-Pro-Glu Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(O)=O)C1=CC=CC=C1 QARPMYDMYVLFMW-KKUMJFAQSA-N 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- IVOMOUWHDPKRLL-UHFFFAOYSA-N UNPD107823 Natural products O1C2COP(O)(=O)OC2C(O)C1N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-UHFFFAOYSA-N 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 150000001412 amines Chemical class 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- 229960005261 aspartic acid Drugs 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000003491 cAMP production Effects 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 229940095074 cyclic amp Drugs 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 210000003743 erythrocyte Anatomy 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 3
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 description 3
- 239000000859 incretin Substances 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000002473 insulinotropic effect Effects 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 150000007524 organic acids Chemical class 0.000 description 3
- 150000007530 organic bases Chemical class 0.000 description 3
- 230000003647 oxidation Effects 0.000 description 3
- 238000007254 oxidation reaction Methods 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 3
- 229960004063 propylene glycol Drugs 0.000 description 3
- 235000013772 propylene glycol Nutrition 0.000 description 3
- 235000019419 proteases Nutrition 0.000 description 3
- 230000017854 proteolysis Effects 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 235000004400 serine Nutrition 0.000 description 3
- 229960001153 serine Drugs 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 3
- 230000000087 stabilizing effect Effects 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 108091007196 stromelysin Proteins 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 229960002898 threonine Drugs 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- PORPENFLTBBHSG-MGBGTMOVSA-N 1,2-dihexadecanoyl-sn-glycerol-3-phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(O)=O)OC(=O)CCCCCCCCCCCCCCC PORPENFLTBBHSG-MGBGTMOVSA-N 0.000 description 2
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 2
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 2
- 239000005711 Benzoic acid Substances 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- 150000008574 D-amino acids Chemical class 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- 208000004986 Diffuse Cerebral Sclerosis of Schilder Diseases 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 108060003199 Glucagon Proteins 0.000 description 2
- 101800004295 Glucagon-like peptide 1(7-36) Proteins 0.000 description 2
- 102000001554 Hemoglobins Human genes 0.000 description 2
- 108010054147 Hemoglobins Proteins 0.000 description 2
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 2
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- SEQKRHFRPICQDD-UHFFFAOYSA-N N-tris(hydroxymethyl)methylglycine Chemical compound OCC(CO)(CO)[NH2+]CC([O-])=O SEQKRHFRPICQDD-UHFFFAOYSA-N 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 239000002033 PVDF binder Substances 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 101710180309 Protease 4 Proteins 0.000 description 2
- 101000886298 Pseudoxanthomonas mexicana Dipeptidyl aminopeptidase 4 Proteins 0.000 description 2
- RADKZDMFGJYCBB-UHFFFAOYSA-N Pyridoxal Chemical compound CC1=NC=C(CO)C(C=O)=C1O RADKZDMFGJYCBB-UHFFFAOYSA-N 0.000 description 2
- 239000008156 Ringer's lactate solution Substances 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- YRKCREAYFQTBPV-UHFFFAOYSA-N acetylacetone Chemical compound CC(=O)CC(C)=O YRKCREAYFQTBPV-UHFFFAOYSA-N 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 125000005907 alkyl ester group Chemical group 0.000 description 2
- 125000000217 alkyl group Chemical group 0.000 description 2
- 125000003277 amino group Chemical class 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- RWZYAGGXGHYGMB-UHFFFAOYSA-N anthranilic acid Chemical compound NC1=CC=CC=C1C(O)=O RWZYAGGXGHYGMB-UHFFFAOYSA-N 0.000 description 2
- 239000003472 antidiabetic agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000013011 aqueous formulation Substances 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 235000010233 benzoic acid Nutrition 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- DWKPZOZZBLWFJX-UHFFFAOYSA-L calcium;1,4-bis(2-ethylhexoxy)-1,4-dioxobutane-2-sulfonate Chemical compound [Ca+2].CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC.CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC DWKPZOZZBLWFJX-UHFFFAOYSA-L 0.000 description 2
- 150000001718 carbodiimides Chemical class 0.000 description 2
- 230000023852 carbohydrate metabolic process Effects 0.000 description 2
- 235000021256 carbohydrate metabolism Nutrition 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- WDRMVIMVHHWVBI-STCSGHEYSA-N chembl1222074 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)N[C@@H](CC=1NC=NC=1)C(O)=O)[C@@H](C)O)[C@H](C)O)C(C)C)C1=CC=CC=C1 WDRMVIMVHHWVBI-STCSGHEYSA-N 0.000 description 2
- 238000002038 chemiluminescence detection Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000006240 deamidation Effects 0.000 description 2
- 239000007857 degradation product Substances 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 235000019329 dioctyl sodium sulphosuccinate Nutrition 0.000 description 2
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 230000007515 enzymatic degradation Effects 0.000 description 2
- 229940031098 ethanolamine Drugs 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- UKVFVQPAANCXIL-FJVFSOETSA-N glp-1 (1-37) amide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 UKVFVQPAANCXIL-FJVFSOETSA-N 0.000 description 2
- 229940121355 glucagon like peptide 2 (glp-2) analogues Drugs 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 229940049906 glutamate Drugs 0.000 description 2
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 2
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 2
- 150000002334 glycols Chemical class 0.000 description 2
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 2
- 230000003862 health status Effects 0.000 description 2
- 102000053680 human centrocyte centroblast marker 1 Human genes 0.000 description 2
- 108700042450 human centrocyte centroblast marker 1 Proteins 0.000 description 2
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 150000007529 inorganic bases Chemical class 0.000 description 2
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 2
- 229960000367 inositol Drugs 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- QPJVMBTYPHYUOC-UHFFFAOYSA-N methyl benzoate Chemical compound COC(=O)C1=CC=CC=C1 QPJVMBTYPHYUOC-UHFFFAOYSA-N 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 239000002736 nonionic surfactant Substances 0.000 description 2
- QWVGKYWNOKOFNN-UHFFFAOYSA-N o-cresol Chemical compound CC1=CC=CC=C1O QWVGKYWNOKOFNN-UHFFFAOYSA-N 0.000 description 2
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 235000006408 oxalic acid Nutrition 0.000 description 2
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- OJUGVDODNPJEEC-UHFFFAOYSA-N phenylglyoxal Chemical compound O=CC(=O)C1=CC=CC=C1 OJUGVDODNPJEEC-UHFFFAOYSA-N 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 229920001993 poloxamer 188 Polymers 0.000 description 2
- 229920001308 poly(aminoacid) Polymers 0.000 description 2
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 2
- 229920000728 polyester Polymers 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 2
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- CACRHRQTJDKAPJ-UHFFFAOYSA-M potassium;1,4-bis(2-ethylhexoxy)-1,4-dioxobutane-2-sulfonate Chemical compound [K+].CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC CACRHRQTJDKAPJ-UHFFFAOYSA-M 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 2
- 229960004919 procaine Drugs 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- NGVDGCNFYWLIFO-UHFFFAOYSA-N pyridoxal 5'-phosphate Chemical compound CC1=NC=C(COP(O)(O)=O)C(C=O)=C1O NGVDGCNFYWLIFO-UHFFFAOYSA-N 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 230000036186 satiety Effects 0.000 description 2
- 235000019627 satiety Nutrition 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000004611 spectroscopical analysis Methods 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 238000001694 spray drying Methods 0.000 description 2
- 230000003019 stabilising effect Effects 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 150000003462 sulfoxides Chemical class 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229960003080 taurine Drugs 0.000 description 2
- CWERGRDVMFNCDR-UHFFFAOYSA-N thioglycolic acid Chemical compound OC(=O)CS CWERGRDVMFNCDR-UHFFFAOYSA-N 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- DNIAPMSPPWPWGF-VKHMYHEASA-N (+)-propylene glycol Chemical compound C[C@H](O)CO DNIAPMSPPWPWGF-VKHMYHEASA-N 0.000 description 1
- SNRCMWGPCHPRBP-YFKPBYRVSA-N (2s)-2-(hydroxyamino)-3-(1h-imidazol-5-yl)propanoic acid Chemical compound ON[C@H](C(O)=O)CC1=CNC=N1 SNRCMWGPCHPRBP-YFKPBYRVSA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 1
- RUDATBOHQWOJDD-UHFFFAOYSA-N (3beta,5beta,7alpha)-3,7-Dihydroxycholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 RUDATBOHQWOJDD-UHFFFAOYSA-N 0.000 description 1
- PYIDGJJWBIBVIA-IHAUNJBESA-N (3r,4s,5s,6r)-2-dodecoxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound CCCCCCCCCCCCOC1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O PYIDGJJWBIBVIA-IHAUNJBESA-N 0.000 description 1
- NGJOFQZEYQGZMB-KTKZVXAJSA-N (4S)-5-[[2-[[(2S,3R)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[2-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-2-oxoethyl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-2-oxoethyl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-2-oxoethyl]amino]-4-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NGJOFQZEYQGZMB-KTKZVXAJSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- DNIAPMSPPWPWGF-GSVOUGTGSA-N (R)-(-)-Propylene glycol Chemical compound C[C@@H](O)CO DNIAPMSPPWPWGF-GSVOUGTGSA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- YPFDHNVEDLHUCE-UHFFFAOYSA-N 1,3-propanediol Substances OCCCO YPFDHNVEDLHUCE-UHFFFAOYSA-N 0.000 description 1
- ZPDQFUYPBVXUKS-YADHBBJMSA-N 1-stearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)COP(O)(=O)OC[C@H](N)C(O)=O ZPDQFUYPBVXUKS-YADHBBJMSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- HCSBTDBGTNZOAB-UHFFFAOYSA-N 2,3-dinitrobenzoic acid Chemical compound OC(=O)C1=CC=CC([N+]([O-])=O)=C1[N+]([O-])=O HCSBTDBGTNZOAB-UHFFFAOYSA-N 0.000 description 1
- NHJVRSWLHSJWIN-UHFFFAOYSA-N 2,4,6-trinitrobenzenesulfonic acid Chemical compound OS(=O)(=O)C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O NHJVRSWLHSJWIN-UHFFFAOYSA-N 0.000 description 1
- MIJDSYMOBYNHOT-UHFFFAOYSA-N 2-(ethylamino)ethanol Chemical compound CCNCCO MIJDSYMOBYNHOT-UHFFFAOYSA-N 0.000 description 1
- BHANCCMWYDZQOR-UHFFFAOYSA-N 2-(methyldisulfanyl)pyridine Chemical compound CSSC1=CC=CC=N1 BHANCCMWYDZQOR-UHFFFAOYSA-N 0.000 description 1
- TXHAHOVNFDVCCC-UHFFFAOYSA-N 2-(tert-butylazaniumyl)acetate Chemical compound CC(C)(C)NCC(O)=O TXHAHOVNFDVCCC-UHFFFAOYSA-N 0.000 description 1
- IEQAICDLOKRSRL-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-dodecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO IEQAICDLOKRSRL-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- FKJSFKCZZIXQIP-UHFFFAOYSA-N 2-bromo-1-(4-bromophenyl)ethanone Chemical compound BrCC(=O)C1=CC=C(Br)C=C1 FKJSFKCZZIXQIP-UHFFFAOYSA-N 0.000 description 1
- UWECDTIQVXCVOS-UHFFFAOYSA-N 2-bromo-4-(1h-imidazol-5-yl)-4-oxobutanoic acid Chemical compound OC(=O)C(Br)CC(=O)C1=CN=CN1 UWECDTIQVXCVOS-UHFFFAOYSA-N 0.000 description 1
- WBBPRCNXBQTYLF-UHFFFAOYSA-N 2-methylthioethanol Chemical compound CSCCO WBBPRCNXBQTYLF-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- VJINKBZUJYGZGP-UHFFFAOYSA-N 3-(1-aminopropylideneamino)propyl-trimethylazanium Chemical compound CCC(N)=NCCC[N+](C)(C)C VJINKBZUJYGZGP-UHFFFAOYSA-N 0.000 description 1
- GSWYUZQBLVUEPH-UHFFFAOYSA-N 3-(azaniumylmethyl)benzoate Chemical compound NCC1=CC=CC(C(O)=O)=C1 GSWYUZQBLVUEPH-UHFFFAOYSA-N 0.000 description 1
- TVZRAEYQIKYCPH-UHFFFAOYSA-N 3-(trimethylsilyl)propane-1-sulfonic acid Chemical compound C[Si](C)(C)CCCS(O)(=O)=O TVZRAEYQIKYCPH-UHFFFAOYSA-N 0.000 description 1
- TUBRCQBRKJXJEA-UHFFFAOYSA-N 3-[hexadecyl(dimethyl)azaniumyl]propane-1-sulfonate Chemical compound CCCCCCCCCCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O TUBRCQBRKJXJEA-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- ONZQYZKCUHFORE-UHFFFAOYSA-N 3-bromo-1,1,1-trifluoropropan-2-one Chemical compound FC(F)(F)C(=O)CBr ONZQYZKCUHFORE-UHFFFAOYSA-N 0.000 description 1
- QHSXWDVVFHXHHB-UHFFFAOYSA-N 3-nitro-2-[(3-nitropyridin-2-yl)disulfanyl]pyridine Chemical compound [O-][N+](=O)C1=CC=CN=C1SSC1=NC=CC=C1[N+]([O-])=O QHSXWDVVFHXHHB-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- PXACTUVBBMDKRW-UHFFFAOYSA-N 4-bromobenzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=C(Br)C=C1 PXACTUVBBMDKRW-UHFFFAOYSA-N 0.000 description 1
- SJZRECIVHVDYJC-UHFFFAOYSA-N 4-hydroxybutyric acid Chemical compound OCCCC(O)=O SJZRECIVHVDYJC-UHFFFAOYSA-N 0.000 description 1
- OBKXEAXTFZPCHS-UHFFFAOYSA-N 4-phenylbutyric acid Chemical compound OC(=O)CCCC1=CC=CC=C1 OBKXEAXTFZPCHS-UHFFFAOYSA-N 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 1
- 208000011403 Alexander disease Diseases 0.000 description 1
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 1
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 1
- 102000014303 Amyloid beta-Protein Precursor Human genes 0.000 description 1
- 108010079054 Amyloid beta-Protein Precursor Proteins 0.000 description 1
- PWAIZUBWHRHYKS-MELADBBJSA-N Asp-Phe-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)NC(=O)[C@H](CC(=O)O)N)C(=O)O PWAIZUBWHRHYKS-MELADBBJSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010003594 Ataxia telangiectasia Diseases 0.000 description 1
- 102000014461 Ataxins Human genes 0.000 description 1
- 108010078286 Ataxins Proteins 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-N Betaine Natural products C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 1
- 241000212384 Bifora Species 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- LVDKZNITIUWNER-UHFFFAOYSA-N Bronopol Chemical compound OCC(Br)(CO)[N+]([O-])=O LVDKZNITIUWNER-UHFFFAOYSA-N 0.000 description 1
- QFOHBWFCKVYLES-UHFFFAOYSA-N Butylparaben Chemical compound CCCCOC(=O)C1=CC=C(O)C=C1 QFOHBWFCKVYLES-UHFFFAOYSA-N 0.000 description 1
- 101100335894 Caenorhabditis elegans gly-8 gene Proteins 0.000 description 1
- 208000022526 Canavan disease Diseases 0.000 description 1
- 239000005635 Caprylic acid (CAS 124-07-2) Substances 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical group NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 206010008025 Cerebellar ataxia Diseases 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 239000004380 Cholic acid Substances 0.000 description 1
- 208000010200 Cockayne syndrome Diseases 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108010062580 Concanavalin A Proteins 0.000 description 1
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 description 1
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 description 1
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 description 1
- HEBKCHPVOIAQTA-QWWZWVQMSA-N D-arabinitol Chemical compound OC[C@@H](O)C(O)[C@H](O)CO HEBKCHPVOIAQTA-QWWZWVQMSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-GSVOUGTGSA-N D-glutamine Chemical compound OC(=O)[C@H](N)CCC(N)=O ZDXPYRJPNDTMRX-GSVOUGTGSA-N 0.000 description 1
- 229930195715 D-glutamine Natural products 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 101710156525 Dipeptidyl aminopeptidase 4 Proteins 0.000 description 1
- 206010049020 Encephalitis periaxialis diffusa Diseases 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- IMROMDMJAWUWLK-UHFFFAOYSA-N Ethenol Chemical group OC=C IMROMDMJAWUWLK-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 201000011240 Frontotemporal dementia Diseases 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 description 1
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- QJCKNLPMTPXXEM-AUTRQRHGSA-N Glu-Glu-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O QJCKNLPMTPXXEM-AUTRQRHGSA-N 0.000 description 1
- 102000051325 Glucagon Human genes 0.000 description 1
- 102400000325 Glucagon-like peptide 1(7-36) Human genes 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-M Glycolate Chemical compound OCC([O-])=O AEMRFAOFKBGASW-UHFFFAOYSA-M 0.000 description 1
- 108010008488 Glycylglycine Proteins 0.000 description 1
- 229920003114 HPC-L Polymers 0.000 description 1
- 229920003115 HPC-SL Polymers 0.000 description 1
- 241000270431 Heloderma suspectum Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101500028773 Homo sapiens Glucagon-like peptide 1(7-37) Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- JRHFQUPIZOYKQP-KBIXCLLPSA-N Ile-Ala-Glu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O JRHFQUPIZOYKQP-KBIXCLLPSA-N 0.000 description 1
- YWCJXQKATPNPOE-UKJIMTQDSA-N Ile-Val-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N YWCJXQKATPNPOE-UKJIMTQDSA-N 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 229940123993 Incretin mimetic Drugs 0.000 description 1
- 208000009164 Islet Cell Adenoma Diseases 0.000 description 1
- 206010023379 Ketoacidosis Diseases 0.000 description 1
- 208000007976 Ketosis Diseases 0.000 description 1
- LKDRXBCSQODPBY-AMVSKUEXSA-N L-(-)-Sorbose Chemical compound OCC1(O)OC[C@H](O)[C@@H](O)[C@@H]1O LKDRXBCSQODPBY-AMVSKUEXSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 1
- 125000002059 L-arginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])C(=N[H])N([H])[H] 0.000 description 1
- 125000002061 L-isoleucyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](C([H])([H])[H])([H])C(C([H])([H])[H])([H])[H] 0.000 description 1
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 1
- 125000002435 L-phenylalanyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 125000003798 L-tyrosyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C1=C([H])C([H])=C(O[H])C([H])=C1[H] 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010076502 Matrix Metalloproteinase 11 Proteins 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-O N,N,N-trimethylglycinium Chemical compound C[N+](C)(C)CC(O)=O KWIUHFFTVRNATP-UHFFFAOYSA-O 0.000 description 1
- FSVCELGFZIQNCK-UHFFFAOYSA-N N,N-bis(2-hydroxyethyl)glycine Chemical compound OCCN(CCO)CC(O)=O FSVCELGFZIQNCK-UHFFFAOYSA-N 0.000 description 1
- VIHYIVKEECZGOU-UHFFFAOYSA-N N-acetylimidazole Chemical compound CC(=O)N1C=CN=C1 VIHYIVKEECZGOU-UHFFFAOYSA-N 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 238000011887 Necropsy Methods 0.000 description 1
- BZQFBWGGLXLEPQ-UHFFFAOYSA-N O-phosphoryl-L-serine Natural products OC(=O)C(N)COP(O)(O)=O BZQFBWGGLXLEPQ-UHFFFAOYSA-N 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 206010033307 Overweight Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-L Phosphate ion(2-) Chemical compound OP([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-L 0.000 description 1
- 208000000609 Pick Disease of the Brain Diseases 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 239000004698 Polyethylene Chemical class 0.000 description 1
- 229920002562 Polyethylene Glycol 3350 Polymers 0.000 description 1
- 229920002565 Polyethylene Glycol 400 Polymers 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000007584 Prealbumin Human genes 0.000 description 1
- 108010071690 Prealbumin Proteins 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- GOOHAUXETOMSMM-UHFFFAOYSA-N Propylene oxide Chemical compound CC1CO1 GOOHAUXETOMSMM-UHFFFAOYSA-N 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 239000004373 Pullulan Substances 0.000 description 1
- 229920001218 Pullulan Polymers 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 208000021811 Sandhoff disease Diseases 0.000 description 1
- 208000021235 Schilder disease Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 239000004288 Sodium dehydroacetate Substances 0.000 description 1
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 description 1
- 102000017303 Stromelysin-3 Human genes 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-N Sulfurous acid Chemical compound OS(O)=O LSNNMFCWUKXFEE-UHFFFAOYSA-N 0.000 description 1
- 239000005864 Sulphur Substances 0.000 description 1
- UZMAPBJVXOGOFT-UHFFFAOYSA-N Syringetin Natural products COC1=C(O)C(OC)=CC(C2=C(C(=O)C3=C(O)C=C(O)C=C3O2)O)=C1 UZMAPBJVXOGOFT-UHFFFAOYSA-N 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- NYTOUQBROMCLBJ-UHFFFAOYSA-N Tetranitromethane Chemical compound [O-][N+](=O)C([N+]([O-])=O)([N+]([O-])=O)[N+]([O-])=O NYTOUQBROMCLBJ-UHFFFAOYSA-N 0.000 description 1
- 229920002359 Tetronic® Polymers 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 239000007997 Tricine buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- ZZXDRXVIRVJQBT-UHFFFAOYSA-M Xylenesulfonate Chemical compound CC1=CC=CC(S([O-])(=O)=O)=C1C ZZXDRXVIRVJQBT-UHFFFAOYSA-M 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- IPBVNPXQWQGGJP-UHFFFAOYSA-N acetic acid phenyl ester Natural products CC(=O)OC1=CC=CC=C1 IPBVNPXQWQGGJP-UHFFFAOYSA-N 0.000 description 1
- YTIVTFGABIZHHX-UHFFFAOYSA-L acetylenedicarboxylate(2-) Chemical compound [O-]C(=O)C#CC([O-])=O YTIVTFGABIZHHX-UHFFFAOYSA-L 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 238000007605 air drying Methods 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 150000005215 alkyl ethers Chemical class 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 150000001370 alpha-amino acid derivatives Chemical class 0.000 description 1
- 235000008206 alpha-amino acids Nutrition 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 150000001414 amino alcohols Chemical class 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 229940127003 anti-diabetic drug Drugs 0.000 description 1
- 230000003178 anti-diabetic effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 201000004562 autosomal dominant cerebellar ataxia Diseases 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- OGBUMNBNEWYMNJ-UHFFFAOYSA-N batilol Chemical class CCCCCCCCCCCCCCCCCCOCC(O)CO OGBUMNBNEWYMNJ-UHFFFAOYSA-N 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- 229960004365 benzoic acid Drugs 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 239000007998 bicine buffer Substances 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 229930189065 blasticidin Natural products 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 229960003168 bronopol Drugs 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 229940084891 byetta Drugs 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- BMLSTPRTEKLIPM-UHFFFAOYSA-I calcium;potassium;disodium;hydrogen carbonate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].OC([O-])=O BMLSTPRTEKLIPM-UHFFFAOYSA-I 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 150000001244 carboxylic acid anhydrides Chemical class 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 239000003093 cationic surfactant Substances 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229940106189 ceramide Drugs 0.000 description 1
- 150000001783 ceramides Chemical class 0.000 description 1
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 1
- YMKDRGPMQRFJGP-UHFFFAOYSA-M cetylpyridinium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 YMKDRGPMQRFJGP-UHFFFAOYSA-M 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- KVSASDOGYIBWTA-UHFFFAOYSA-N chloro benzoate Chemical compound ClOC(=O)C1=CC=CC=C1 KVSASDOGYIBWTA-UHFFFAOYSA-N 0.000 description 1
- VIMWCINSBRXAQH-UHFFFAOYSA-M chloro-(2-hydroxy-5-nitrophenyl)mercury Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[Hg]Cl VIMWCINSBRXAQH-UHFFFAOYSA-M 0.000 description 1
- VXIVSQZSERGHQP-UHFFFAOYSA-N chloroacetamide Chemical compound NC(=O)CCl VXIVSQZSERGHQP-UHFFFAOYSA-N 0.000 description 1
- FOCAUTSVDIKZOP-UHFFFAOYSA-N chloroacetic acid Chemical compound OC(=O)CCl FOCAUTSVDIKZOP-UHFFFAOYSA-N 0.000 description 1
- 229940106681 chloroacetic acid Drugs 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960002242 chlorocresol Drugs 0.000 description 1
- MXOAEAUPQDYUQM-UHFFFAOYSA-N chlorphenesin Chemical compound OCC(O)COC1=CC=C(Cl)C=C1 MXOAEAUPQDYUQM-UHFFFAOYSA-N 0.000 description 1
- 235000019416 cholic acid Nutrition 0.000 description 1
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 1
- 229960002471 cholic acid Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 229940001468 citrate Drugs 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000000562 conjugate Substances 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- GHVNFZFCNZKVNT-UHFFFAOYSA-N decanoic acid Chemical compound CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000003831 deregulation Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 229950006137 dexfosfoserine Drugs 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 229940099371 diacetylated monoglycerides Drugs 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- KCFYHBSOLOXZIF-UHFFFAOYSA-N dihydrochrysin Natural products COC1=C(O)C(OC)=CC(C2OC3=CC(O)=CC(O)=C3C(=O)C2)=C1 KCFYHBSOLOXZIF-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-M dihydrogenphosphate Chemical compound OP(O)([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-M 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- FRKBLBQTSTUKOV-UHFFFAOYSA-N diphosphatidyl glycerol Natural products OP(O)(=O)OCC(OP(O)(O)=O)COP(O)(O)=O FRKBLBQTSTUKOV-UHFFFAOYSA-N 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- RCFKEIREOSXLET-UHFFFAOYSA-N disulfamide Chemical compound CC1=CC(Cl)=C(S(N)(=O)=O)C=C1S(N)(=O)=O RCFKEIREOSXLET-UHFFFAOYSA-N 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 229940018614 docusate calcium Drugs 0.000 description 1
- 229940018600 docusate potassium Drugs 0.000 description 1
- 229960000878 docusate sodium Drugs 0.000 description 1
- QBHFVMDLPTZDOI-UHFFFAOYSA-N dodecylphosphocholine Chemical compound CCCCCCCCCCCCOP([O-])(=O)OCC[N+](C)(C)C QBHFVMDLPTZDOI-UHFFFAOYSA-N 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 1
- YMFBFFPJRABBPE-BTVCFUMJSA-N ethanol;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanal Chemical compound CCO.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O YMFBFFPJRABBPE-BTVCFUMJSA-N 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- 239000004403 ethyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010228 ethyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229940043351 ethyl-p-hydroxybenzoate Drugs 0.000 description 1
- HXQVQGWHFRNKMS-UHFFFAOYSA-M ethylmercurithiosalicylic acid Chemical compound CC[Hg]SC1=CC=CC=C1C(O)=O HXQVQGWHFRNKMS-UHFFFAOYSA-M 0.000 description 1
- NUVBSKCKDOMJSU-UHFFFAOYSA-N ethylparaben Chemical compound CCOC(=O)C1=CC=C(O)C=C1 NUVBSKCKDOMJSU-UHFFFAOYSA-N 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- FBPFZTCFMRRESA-GUCUJZIJSA-N galactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-GUCUJZIJSA-N 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 150000002270 gangliosides Chemical class 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 239000003629 gastrointestinal hormone Substances 0.000 description 1
- 230000005176 gastrointestinal motility Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- 229940093181 glucose injection Drugs 0.000 description 1
- 230000010030 glucose lowering effect Effects 0.000 description 1
- 230000004153 glucose metabolism Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960002743 glutamine Drugs 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 150000002327 glycerophospholipids Chemical class 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 229940043257 glycylglycine Drugs 0.000 description 1
- HHLFWLYXYJOTON-UHFFFAOYSA-N glyoxylic acid Chemical compound OC(=O)C=O HHLFWLYXYJOTON-UHFFFAOYSA-N 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- ZRALSGWEFCBTJO-UHFFFAOYSA-N guanidine group Chemical group NC(=N)N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- KKLGDUSGQMHBPB-UHFFFAOYSA-N hex-2-ynedioic acid Chemical compound OC(=O)CCC#CC(O)=O KKLGDUSGQMHBPB-UHFFFAOYSA-N 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-M hexanoate Chemical compound CCCCCC([O-])=O FUZZWVXGSFPDMH-UHFFFAOYSA-M 0.000 description 1
- 229920006158 high molecular weight polymer Polymers 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- 229940071870 hydroiodic acid Drugs 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 229940050526 hydroxyethylstarch Drugs 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 230000003345 hyperglycaemic effect Effects 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Substances C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 1
- 150000002462 imidazolines Chemical class 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229940113174 imidurea Drugs 0.000 description 1
- 210000004201 immune sera Anatomy 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000003914 insulin secretion Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 201000002529 islet cell tumor Diseases 0.000 description 1
- KQNPFQTWMSNSAP-UHFFFAOYSA-N isobutyric acid Chemical compound CC(C)C(O)=O KQNPFQTWMSNSAP-UHFFFAOYSA-N 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 235000014705 isoleucine Nutrition 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 210000001630 jejunum Anatomy 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 101150000548 laf1 gene Proteins 0.000 description 1
- 125000000400 lauroyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 150000004668 long chain fatty acids Chemical class 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 125000005341 metaphosphate group Chemical group 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- IZYBEMGNIUSSAX-UHFFFAOYSA-N methyl benzenecarboperoxoate Chemical compound COOC(=O)C1=CC=CC=C1 IZYBEMGNIUSSAX-UHFFFAOYSA-N 0.000 description 1
- 229940095102 methyl benzoate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- NEGQCMNHXHSFGU-UHFFFAOYSA-N methyl pyridine-2-carboximidate Chemical compound COC(=N)C1=CC=CC=N1 NEGQCMNHXHSFGU-UHFFFAOYSA-N 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 125000001419 myristoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- FEMOMIGRRWSMCU-UHFFFAOYSA-N ninhydrin Chemical compound C1=CC=C2C(=O)C(O)(O)C(=O)C2=C1 FEMOMIGRRWSMCU-UHFFFAOYSA-N 0.000 description 1
- 231100000957 no side effect Toxicity 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- WWZKQHOCKIZLMA-UHFFFAOYSA-M octanoate Chemical compound CCCCCCCC([O-])=O WWZKQHOCKIZLMA-UHFFFAOYSA-M 0.000 description 1
- 229960002446 octanoic acid Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 230000004792 oxidative damage Effects 0.000 description 1
- YFZOUMNUDGGHIW-UHFFFAOYSA-M p-chloromercuribenzoic acid Chemical compound OC(=O)C1=CC=C([Hg]Cl)C=C1 YFZOUMNUDGGHIW-UHFFFAOYSA-M 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 210000002571 pancreatic alpha cell Anatomy 0.000 description 1
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- JLFNLZLINWHATN-UHFFFAOYSA-N pentaethylene glycol Chemical compound OCCOCCOCCOCCOCCO JLFNLZLINWHATN-UHFFFAOYSA-N 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 229940083254 peripheral vasodilators imidazoline derivative Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- DYUMLJSJISTVPV-UHFFFAOYSA-N phenyl propanoate Chemical compound CCC(=O)OC1=CC=CC=C1 DYUMLJSJISTVPV-UHFFFAOYSA-N 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 229940049953 phenylacetate Drugs 0.000 description 1
- WLJVXDMOQOGPHL-UHFFFAOYSA-N phenylacetic acid Chemical compound OC(=O)CC1=CC=CC=C1 WLJVXDMOQOGPHL-UHFFFAOYSA-N 0.000 description 1
- 229950009215 phenylbutanoic acid Drugs 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- HMFAQQIORZDPJG-UHFFFAOYSA-N phosphono 2-chloroacetate Chemical compound OP(O)(=O)OC(=O)CCl HMFAQQIORZDPJG-UHFFFAOYSA-N 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- XNGIFLGASWRNHJ-UHFFFAOYSA-L phthalate(2-) Chemical compound [O-]C(=O)C1=CC=CC=C1C([O-])=O XNGIFLGASWRNHJ-UHFFFAOYSA-L 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 229920001992 poloxamer 407 Polymers 0.000 description 1
- 229940044476 poloxamer 407 Drugs 0.000 description 1
- 229920001987 poloxamine Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000573 polyethylene Chemical class 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229920000166 polytrimethylene carbonate Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- KCXFHTAICRTXLI-UHFFFAOYSA-N propane-1-sulfonic acid Chemical compound CCCS(O)(=O)=O KCXFHTAICRTXLI-UHFFFAOYSA-N 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- UORVCLMRJXCDCP-UHFFFAOYSA-M propynoate Chemical compound [O-]C(=O)C#C UORVCLMRJXCDCP-UHFFFAOYSA-M 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 230000002633 protecting effect Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 239000012474 protein marker Substances 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 235000019423 pullulan Nutrition 0.000 description 1
- 229960003581 pyridoxal Drugs 0.000 description 1
- 235000008164 pyridoxal Nutrition 0.000 description 1
- 239000011674 pyridoxal Substances 0.000 description 1
- 235000007682 pyridoxal 5'-phosphate Nutrition 0.000 description 1
- 239000011589 pyridoxal 5'-phosphate Substances 0.000 description 1
- 229960001327 pyridoxal phosphate Drugs 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000003979 response to food Effects 0.000 description 1
- 238000012340 reverse transcriptase PCR Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 229940116351 sebacate Drugs 0.000 description 1
- CXMXRPHRNRROMY-UHFFFAOYSA-L sebacate(2-) Chemical compound [O-]C(=O)CCCCCCCCC([O-])=O CXMXRPHRNRROMY-UHFFFAOYSA-L 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 150000003355 serines Chemical class 0.000 description 1
- 238000010008 shearing Methods 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- 229960005480 sodium caprylate Drugs 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 229940001593 sodium carbonate Drugs 0.000 description 1
- NRHMKIHPTBHXPF-TUJRSCDTSA-M sodium cholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 NRHMKIHPTBHXPF-TUJRSCDTSA-M 0.000 description 1
- 235000019259 sodium dehydroacetate Nutrition 0.000 description 1
- 229940079839 sodium dehydroacetate Drugs 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- IHQKEDIOMGYHEB-UHFFFAOYSA-M sodium dimethylarsinate Chemical compound [Na+].C[As](C)([O-])=O IHQKEDIOMGYHEB-UHFFFAOYSA-M 0.000 description 1
- APSBXTVYXVQYAB-UHFFFAOYSA-M sodium docusate Chemical compound [Na+].CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC APSBXTVYXVQYAB-UHFFFAOYSA-M 0.000 description 1
- OABYVIYXWMZFFJ-ZUHYDKSRSA-M sodium glycocholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 OABYVIYXWMZFFJ-ZUHYDKSRSA-M 0.000 description 1
- BYKRNSHANADUFY-UHFFFAOYSA-M sodium octanoate Chemical compound [Na+].CCCCCCCC([O-])=O BYKRNSHANADUFY-UHFFFAOYSA-M 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 235000011008 sodium phosphates Nutrition 0.000 description 1
- JAJWGJBVLPIOOH-IZYKLYLVSA-M sodium taurocholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 JAJWGJBVLPIOOH-IZYKLYLVSA-M 0.000 description 1
- DSOWAKKSGYUMTF-GZOLSCHFSA-M sodium;(1e)-1-(6-methyl-2,4-dioxopyran-3-ylidene)ethanolate Chemical compound [Na+].C\C([O-])=C1/C(=O)OC(C)=CC1=O DSOWAKKSGYUMTF-GZOLSCHFSA-M 0.000 description 1
- IWQPOPSAISBUAH-VOVMJQHHSA-M sodium;2-[[(2z)-2-[(3r,4s,5s,8s,9s,10s,11r,13r,14s,16s)-16-acetyl-3,11-dihydroxy-4,8,10,14-tetramethyl-2,3,4,5,6,7,9,11,12,13,15,16-dodecahydro-1h-cyclopenta[a]phenanthren-17-ylidene]-6-methylheptanoyl]amino]ethanesulfonate Chemical compound [Na+].C1C[C@@H](O)[C@@H](C)[C@@H]2CC[C@]3(C)[C@@]4(C)C[C@H](C(C)=O)/C(=C(C(=O)NCCS([O-])(=O)=O)/CCCC(C)C)[C@@H]4C[C@@H](O)[C@H]3[C@]21C IWQPOPSAISBUAH-VOVMJQHHSA-M 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 239000006076 specific stabilizer Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000003335 steric effect Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- TYFQFVWCELRYAO-UHFFFAOYSA-L suberate(2-) Chemical compound [O-]C(=O)CCCCCCC([O-])=O TYFQFVWCELRYAO-UHFFFAOYSA-L 0.000 description 1
- 125000000185 sucrose group Chemical group 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 150000003588 threonines Chemical class 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 239000008181 tonicity modifier Substances 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- HHLJUSLZGFYWKW-UHFFFAOYSA-N triethanolamine hydrochloride Chemical compound Cl.OCCN(CCO)CCO HHLJUSLZGFYWKW-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 229960004799 tryptophan Drugs 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229960004441 tyrosine Drugs 0.000 description 1
- 235000002374 tyrosine Nutrition 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- RUDATBOHQWOJDD-UZVSRGJWSA-N ursodeoxycholic acid Chemical compound C([C@H]1C[C@@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 RUDATBOHQWOJDD-UZVSRGJWSA-N 0.000 description 1
- 229960001661 ursodiol Drugs 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 235000008979 vitamin B4 Nutrition 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940071104 xylenesulfonate Drugs 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
- 239000002888 zwitterionic surfactant Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- G—PHYSICS
- G07—CHECKING-DEVICES
- G07F—COIN-FREED OR LIKE APPARATUS
- G07F11/00—Coin-freed apparatus for dispensing, or the like, discrete articles
- G07F11/02—Coin-freed apparatus for dispensing, or the like, discrete articles from non-movable magazines
- G07F11/04—Coin-freed apparatus for dispensing, or the like, discrete articles from non-movable magazines in which magazines the articles are stored one vertically above the other
- G07F11/16—Delivery means
- G07F11/165—Delivery means using xyz-picker or multi-dimensional article picking arrangements
Definitions
- the present invention relates to novel GLP-1 fusion peptides which have extended C termini, are resistant to endopeptidase IV inactivation, may be expressed at high levels in transformed animal cells, and are e.g. useful in the treatment of type 2 diabetes.
- the glucagon gene is well studied, see e.g. White, J.W. et al., 1986 Nucleic Acid Res. 14(12) 4719-4730 .
- the preproglucagon molecule as a high molecular weight precursor molecule is synthesised in pancreatic alpha cells and in the jejunum and colon L cells.
- Preproglucagon is a 180 amino acid long prohormone and its sequence contains, in addition to glucagon, two sequences of related structure: glucagon-like peptide-1 (GLP-1) and glucagon-like peptide-2 (GLP-2).
- the preproglucagon molecule In the preproglucagon molecule, between GLP-1 and GLP-2 is a 17 amino acid peptide sequence (or rather a 15 amino acid sequence plus the C-terminal RR cleavage site), intervening peptide 2 (IP2).
- IP2 sequence located between GLP-1 and -2 in the precursor molecule
- the preproglucagon module is therefore cleaved into various peptides, depending on the cell, and the environment, including GLP-1 (1-37), a 37 amino acid peptide in its unprocessed form. Generally, this processing occurs in the pancreas and the intestine.
- the GLP-1 (1-37) sequence can be further proteolytically processed into active GLP-1 (7-37), the 31 amino acid processed form, or GLP-1 (7-36) amide. Accordingly, the designation GLP-1(7-37) designates that the fragment in question comprises the amino acid residues from (and including) number 7 to (and including) number 37 when counted from the N-terminal end of the parent peptide, GLP-1.
- the amino acid sequence of GLP-1(7-36)amide and of GLP-1(7-37) is given in formula I (SEQ ID No.: 43):
- GLP-1 is a gut hormone and is the most potent endogenous insulinotropic agent with actions that include stimulating adenylate cyclase and protein kinase activity in the beta-cell. Physiologically, together with gastric inhibitory polypeptide from the upper gut, it functions as an incretin hormone lowering the blood glucose level. Accordingly, GLP-1, secreted in response to food intake, has e.g. multiple effects on the stomach, liver, pancreas and brain that work in concert to regulate blood sugar.
- Glucagon-like peptide GLP-1 (7-36) amide, and its non-amidated analogue GLP-1 (7-37) have attracted considerable interest because of their potent actions on carbohydrate metabolism and its potential applicability to the treatment of diabetes, including type 2 diabetes.
- Type 2 diabetes is characterized by insulin resistance, since cells do not respond appropriately when insulin is present. This is a more complex problem than type 1 diabetes.
- Type 2 diabetes may go unnoticed for years in a patient before diagnosis, since the symptoms are typically milder (no ketoacidosis) and can be sporadic. However, severe complications can result from unnoticed type 2 diabetes, including renal failure, and coronary heart disease. This leads to increased morbidity and mortality.
- GLP-1 (7-36) amide or GLP-1(7-37) is short-lived in serum.
- the peptide is cleaved by dipeptidyl peptidase IV (DPP-IV) between residues 8 and 9.
- DPP-IV dipeptidyl peptidase IV
- the cleaved peptide is inactive.
- GLP-1, administered exogenously, is extremely short-lived and has limited utility in therapeutic applications.
- WO 02/46227 discloses GLP-1 fusion proteins, comprising glucagon-like-1 compounds fused to proteins suitable to extend the in vivo half life of the peptides.
- WO 02/46227 describes a fusion protein of GLP-1 with albumin or immunoglobulin.
- such proteins may be used to treat non-insulin dependent diabetes mellitus as well as a variety of other conditions.
- WO 02/46227 does not disclose fusion proteins comprising as component (I) N-terminally GLP-1 (7-35, 7-36 or 7-37) or a derivative thereof and as component (II) C-terminally a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI).
- US 2003/0221201 discloses fusion proteins of transferrin and GLP-1.
- US 2003/0195154 describes a fusion protein of GLP-1 and transthyretin as fusion partners.
- no further GLP-1 fusion proteins are disclosed or suggested in US 2003/0221201 or US 2003/0195154 , particularly no further possible fusion partners for GLP-1, capable of stabilizing GLP-1 in vivo.
- WO 99/46283 describes a pharmacologically active peptide conjugate comprising a pharmacological active peptide sequence (X), like GLP-1, and a stabilising peptide sequence (Z) of 4 to 20 amino acid residues, which are covalently linked to the pharmacologically active peptide sequence (X).
- the stabilising peptide sequence (Z) may be e.g.
- Lys p -Xaa q or Xaa p -Lys q sequences wherein p and q are integers in the range from 1 to 14, with the proviso that p+q is in the range of 3-15, and each Xaa is independently selected from the group consisting of Ser, Thr, Tyr, Asn, Gln, Asp, Glu, Arg, His, Orn, 2,4-diaminobutanoic acid, 2,3-diaminopropanoic acid and Met, particularly short peptide sequences of the formulae Lys 3 -Glu 3 or Glu 3 -Lys 3 .
- WO 99/46283 does not disclose fusion proteins comprising as component (I) N-terminally GLP-1(7-35, 7-36 or 7-37) or a derivative thereof and as component (II) C-terminally a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI).
- WO 03/058203 discloses a GLP-1 peptide coupled with an extended C-terminus that provides increased stability. This extended C-terminus comprises at least 6 amino acids, preferably 7 to 9 amino acids. WO 03/058203 does not disclose GLP-1 fusion proteins comprising a sequence according to SEQ ID NO 26 (AADFPEEVAI) as an extended C-terminus.
- US 2004/0146985 describes a GLP-1 (7-37) fusion protein containing multiple copies of the GLP-1 (7-37) peptide for producing this therapeutically agent on a larger scale.
- US 2004/0146985 does not disclose a GLP-1 (7-37) fusion protein comprising as component (I) N-terminally GLP-1 (7-35, 7-36 or 7-37) or a derivative thereof and as component (II) C-terminally a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI).
- US 5,861,284 discloses fusion peptides of GLP-1 (7-37) and an amino acid sequence derived from the fibroblast growth factor at the C-terminus.
- the invention of US 5,861,284 is particularly directed to the production of cysteine free peptides, produced by a fusion protein comprising a protein having cysteine at its N-terminal end and a cysteine-free peptide ligated to the N-terminal end and subsequently cleaving off the cysteine-free peptide.
- US 5,861,284 does not disclose fusion peptides of GLP-1 (7-37) and a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI).
- WO 98/08871 discloses various GLP-1 derivatives, particularly a GLP-1 derivative, wherein at least one amino acid of GLP-1 has a lipophilic substituent attached.
- WO 98/08871 does neither disclose GLP-1 fusion peptides of GLP-1 (7-37, 7-36 or 7-35) nor a peptidic extension of the C-terminus of GLP-1.
- WO 2005/058958 relates to GLP-1 analogues linked to albumin-like agents.
- EP 1 454 629 discloses a partial peptide of a preproglucagon peptide comprising at least the amino acid sequence at positions 92-97 of a preproglucagon peptide as an effective ingredient of an antidiabetic drug.
- US 6,858,576 relates to methods for regulating gastrointestinal motility, particularly to the use of exendins and analogs and agosists thereof.
- WO 2006/010143 discloses a GLP-1/GLP-2 fusion peptide comprising GLP-1 (7-37) at the N-terminus. Further, it contains an IP-2 fragment.
- D15 does not disclose a fusion peptide comprising as a first component N-terminally a sequence according to formula II or formula III as defined below and as a second component C-terminally a peptide sequence of at least 9 amino acids containing sequence according to the sequence AADFPEEVAI or being of at least 90% identity to such a sequence.
- Thorens, B. discloses a strategy for creating a multimeric GLP-1 expression cassette which can be incorporated into a variety of cell types which are publicly available immortalised cell lines and dividing primary cell cultures. Examples include EGF-responsive neurospheres, bFGF-responsive neural progenitor stem cells from the CNS of mammals, while the worked example uses baby hamster kidney, BHK cells. The implanted transfected cells were said to have been used to treat successfully diabetic mice, allowing glucose control equivalent substantially to non-diabetic controls. However, this techniques does not comply with the requirements of a treatment to be administered routinely to diabetes patients.
- Exenatide is a synthetic version of a natural compound found in the saliva of the Gila monster lizard.
- an incretin mimetic (exenatide) has demonstrated reductions in blood sugar and improvements in markers of beta cell function.
- Exenatide exhibits only certain effects of human incretin hormone glucagon-like peptide-1 (GLP-1).
- GLP-1 a therapy which reflects the entire spectrum of beneficial effects known for GLP-1, e.g. its activity in physiological concentrations to powerfully reduce the rate of entry of nutrients into the circulation by a reduction of gastric emptying rate in obese subjects or its insulin stimulating activity. Therefore, it is an object of the present invention to provide GLP-1 based peptide molecules which are biologically active and resistant towards proteolytic degradation.
- the present invention relates to a fusion peptide comprising as component (I) N-terminally a sequence according to
- the present invention relates to a fusion peptide as defined above, wherein component (I) is GLP-1(7-35) or GLP-1(7-36).
- the present invention is based on the finding that the resulting inventive peptide is protected against the proteolytic degradation in vivo, mainly due to proteolytic endopeptidase IV activity.
- the inventive peptide having at least two components (I) and_(II) as defined above exhibits. GLP-1's biologically activity and, simultaneously, confers stability to the GLP-1 as its component (I) by a C-terminal elongation.
- the term "inventive peptide” as used herein is a fusion peptide as defined herein, a variant, an analog, a fragment or a derivative thereof, including combinations e.g. a derivatized fragment, analog or variant of a fusion peptide.
- GLP-1 peptide as used herein means GLP-1(7-35, 36 or 37)
- modified GLP-1 peptide is intended to mean any GLP-1 analogue, a GLP-1 derivative, a GLP-1 variant or GLP-1 fragment, including a derivatized fragment, analog or variant of GLP-1 (7-35, 36 or 37), which may occur in either component (I) and (III) of the inventive peptide.
- GLP-2 peptide as used herein means GLP-2 (1-33, 34, or 35), whereas "modified GLP-2 peptide” is intended to mean any GLP-2 analogue, fragment or variant, a GLP-2 derivative or a derivative of a GLP-2 analogue, including a derivatized fragment, analog or variant of GLP-2(1-33, 34 or 35). Variants, analogs, fragments and derivatives are categorized as modifications of the unmodified sequence, e.g. GLP-1(7-35, 36 or 37) or GLP-2(1-33, 34 or 35). Within the meaning of the present invention any variant, analog, fragment or derivative has to be functional, e.g. has to exert the same or a similar biological effects as the unmodified GLP-1 peptide.
- the inventive peptide is a fusion peptide as defined above or a variant, analog, fragment or derivative thereof, wherein component (I) may contain a sequence having at least 80 %, more preferably at least 85 % and even more preferably at least 90 % sequence identity with SEQ ID No.: 1.
- SEQ ID No.1 represents the native amino acid sequence of GLP-1(7-37) (length of 31 amino acids), which is strictly conserved among mammalians.
- the second component (component (II)) as defined above of the fusion peptide according to the invention contains a sequence length of at least nine amino acids, which may or may not form a ß-turn like structure.
- a ß-turn structure is a typical secondary structure element of proteins or peptides. It is typically formed by four amino acids, which revert the direction of the peptide's or protein's backbone chain direction.
- the amino acid sequence of component (II) contains at least nine amino acids and contains at least one proline or alanine residue in its sequence.
- Proline residues are common amino acids within the ß turn forming tetrameric amino acid sequence.
- the proline residue is commonly is typically located at position 2 or 3, preferably 2, of the tetrameric ß-turn sequence occurring in component (II) of the fusion peptide.
- An inventive fusion may typically have in its component (II) sequence length of 9 to 30, preferably 9 to 20, and most preferably 9 to 15 amino acids. Generally spoken, shorter sequences in component (II) may be preferred due to their superior binding activity to the GLP receptor over longer sequences.
- the sequence of component (II), even though it is not a prerequisite, may preferably be neutral or may have a negative charge at pH7.
- a fusion peptide according to the invention is preferred, if its component (II) contains a sequence motif selected from the group consisting of PEEV, DFPE and AADX, wherein X represents any amino acid (naturally occurring or a modified non-natural amino acid).
- component (II) contains a sequence motif selected from the group consisting of PEEV, DFPE and AADX, wherein X represents any amino acid (naturally occurring or a modified non-natural amino acid).
- tetrameric motifs may be located anywhere in the sequence of component (II).
- the inventive fusion peptide component (II) is a peptide sequence being linked to the C-terminus of component (I) by its N-terminal sequence motif selected from the group consisting of AA, XA and AX, wherein X represents any amino acid (naturally occurring or a modified non-natural amino acid).
- a preferred motif of component (II) in an inventive fusion peptide contains the sequence motif SEQ ID No.: 25 (DFPEEVA) or contains a sequence having at least 80% sequence homology with the sequence motif DFPEEVA, which corresponds to a partial sequence of human or murine IP-2.
- inventive fusion peptide component (II) is a peptide sequence containing a sequence according to SEQ ID No.: 26 (AADFPEEVAI) (all peptide sequences given in the one-letter-code) or a sequence having at least 90% sequence identity with SEQ ID No.: 26.
- SEQ ID No.: 26 is derived from a partial sequence of the full-length (human or murine) JP-2 (intervening peptide 2) sequence, which contains the N-terminal 10 amino acids of the 15 amino acid long full-lenght JP-2 sequence, by substitution of the N-terminal (RR) residues by (AA).
- IP-2 is a preferred example of a ⁇ -turn containing peptide sequence.
- component (II) other stronger preferred sequences being contained in component (II) are longer partial amino acid sequences of IP-2, such as e.g. SEQ ID No.: 27 (AADFPEEVAIVEEL), SEQ ID No.: 28 (AADFPEEVAIAEEL), SEQ ID No.: 29 (AADFPEEVAIVEELG), and SEQ ID NO.: 30 (AADFPEEVAIAEELG), wherein all sequences mentioned in this paragraph may also be provided with the N-terminal motif (AX) or (XA). More than one copy of a sequence being included into component (II) may be provided, e.g. 2, 3 or even more copies of IP2 or a fragment, variant or analog or derivative of IP2.
- an inventive fusion peptide is preferred containing a sequence according to SEQ ID No.: 31 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGAADFPEEVAIAEELG) or SEQ ID No.: 38 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGAADFPEEVAIVEELG) i.e. GLP-1(7-37) linked without any linker sequence via its C-terminus to specific analogs or variants of the IP2 sequence.
- the C-terminal peptide is either not cleaved from the GLP-1 (7-35, 36 or 37) sequence prior to acting on its receptor in target cells or it may be cleaved enzymatically to form GLP-1 (7-35, 36 or 37) in vivo. Irrespective of the exact form of the inventive fusion peptide bound at the site of the GLP-1 receptor, an inventive fusion peptide exerts its function as an active insulinotropic compound.
- Peptide sequences which are considered to be suitable for being contained in component (II) due to a primary structure forming a ß-turn element may readily be identified by adequate e.g. spectroscopic methods, e.g. circular dichroism, or other methods known to the skilled person.
- Component (II) and component (I) may be directly linked or linked via a linker sequence.
- both components are directly linked with each other.
- the linker is preferably a peptide linker or an organic linker.
- a peptide linker typically has a length of 1 to 10 amino acids, preferably 1 to 5, even more preferably 1 to 3 amino acids, in some cases the linker sequence may be even longer comprising 11 to 50 amino acids.
- a peptide linker may be composed of various amino acid sequences.
- a peptide linker will introduce some structural flexibility between components to be linked. Structural flexibility is achieved e.g.
- peptide linker containing various glycine or proline residues, preferably at least 30%, more preferably at least 40% and even more preferably at least 60 % proline and glycine residues within the linker sequence. Irrespective of the specific sequence the peptide linker may preferably be immunologically inactive.
- an inventive fusion peptide contains a third component (component (III)) which is either linked to the C-terminus of component (II) and/or to the N-terminus of component (I).
- component (III) is located at the C-terminus of component (II).
- the coupling may be direct or indirect via a linker sequence.
- linker sequence it is referred to the above disclosure for a linker connecting component (I) and component (II).
- component (III) comprises at least four amino acid residues, preferably at least 10 additional amino acid residues, more preferably at least 20, or at least 30.
- component (III) is provided to further enhance the stability of the inventive fusion peptide.
- Component (III) is expected not to interfere with the biological function of the inventive fusion peptide which is app. comparable to the biological activity of GLP-1(7-37).
- component (III) of the inventive fusion peptide comprises at least 4, preferably at least 10, more preferably at least 20 additional amino acid residues of the N-terminal sequence of an isoform of GLP-2 of any mammalian organism (other naturally occurring variant of GLP-2 among mammalian), e.g. murine or human isoforms as shown in SEQ ID Nos: 4 and 5.
- GLP-2 occurs in pro-glucagon and is also involved in carbohydrate metabolism.
- component (III) may also comprise analogs, variants or derivatives of naturally occurring forms of GLP-2.
- component (III) may also comprise at least 4, preferably at least 10, more preferably at least 20 additional amino acid residues of the N-terminal sequence of GLP-1(7-37), correspondingly including all mammalian isoforms or - as disclosed herein - all functional variants, analogs or derivatives thereof.
- component (III) may contain any form of a GLP-1 peptide or a modified GLP-1 peptide, which is disclosed herein as suitable for component (I) of the inventive fusion peptide.
- component (III) may also contain chimeric forms of GLP-1 (7-37) and GLP-2.
- a chimeric form may be produced by coupling GLP-1 (7-37) and GLP-2 (or fragments, analogs, variants or derivatives of both) with each other and by subsequently introducing this chimeric form as component (III) into the inventive fusion peptide.
- the chimeric form is composed of a partial sequence of GLP-1 (7-37) and a partial sequence of GLP-2 linked together.
- the chimeric form may include the N-terminal 5 to 30 amino acids of GLP-1 and the C-terminal 5 to 30 amino acids of GLP-2 or vice versa, e.g amino acids 7 or 8 to 22, 23, 24, 25, 26, 27, or 28 of GLP-1 (7-37) and amino acid sequence from position 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 to e.g. the C-terminus of GLP-2.
- component (III) preferably contains the sequence of SEQ ID Nos.: 4 or 5 or SEQ ID No.: 1, respectively, or a sequence having at least 80% sequence identity with SEQ ID Nos.: 4 or 5 or SEQ ID No.: 1.
- Derivatives of these preferred sequences e.g. due to side chain modifications or peptide backbone modifications etc. (as disclosed herein pertaining to "derivatives"), are also encompassed as component (III) by the present invention.
- component (III) may contain a plurality of sequences as described above.
- component (III) may contain at least two, preferably 2, 3, or 4 copies of GLP-1(7-37) and/or GLP-2 or at least two copies of sequences having at least 80% sequence identity with SEQ ID Nos: 1, 4 or 5.
- component (III) may contain more than copy of a chimeric version of GLP-1 (7-37) or GLP-2, as disclosed above, e.g. eventually forming a combination of chimeric version(s) together with GLP-1(7-37) and/or GLP-2 or its modifications with at least 80 % sequence identity.
- two or more, preferably two component (III) which may e.g.
- component (II) may be (1) linked by its N-terminus to the C-terminus of component (II) and (2) linked by its C-terminus to the N-terminus of component (I) via a linker or directly. If two components (III) are provided, these may be identical or different.
- inventive fusion peptides containing three components (I), (II) and (III) are particularly preferred.
- Four specific embodiments containing all of these components are selected from a group consisting of: SEQ ID No. 6 (N-GLP-1(7-37)-IP2(murine)-RR-GLP-1(7-37)-C, also designated murine CM1 herein), SEQ ID No. 7 (N-GLP-1(7-37)-IP2(murine)-RR-GLP2-C, also designated murine CM2 herein), SEQ ID No. 10 (N-GLP-1(7-37)-IP2(human)-RR-GLP-1(7-37)-C, also designated human CM1), and SEQ ID No.
- Component (I) in each of the embodiments according to SEQ ID Nos:6, 7, 10 or 11 is GLP-1 (7-37), whereas component (III) (in each of these embodiments linked to the C-terminus of component (II)) is either GLP-1 (7-37) or GLP-2.
- inventive fusion peptides may occur in various modified forms. These modified forms are disclosed in the following and described in more detail.
- salts herein refers to both salts of carboxyl groups and to acid addition salts of amino groups of the fusion peptides described above or analogs, fragments, derivatives or variants thereof.
- Salts of a carboxyl group may be formed by means known in the art and include inorganic salts, for example, sodium, calcium, ammonium, ferric or zinc salts, and the like, and salts with organic bases as those formed, for example, with amines, such ethanolamine, arginine or lysine, piperidine, procaine and the like.
- Acid addition salts include, for example, salts with mineral acids, such as, for example, hydrochloric acid or sulfuric acid, and salts with organic acids, such as, for example, acetic acid or oxalic acid.
- mineral acids such as, for example, hydrochloric acid or sulfuric acid
- organic acids such as, for example, acetic acid or oxalic acid.
- any such salts must retain the biological activity of the inventive peptides relevant to the present invention, i.e. the ability to reduce the rate of entry of nutrients into the circulation.
- the salt peptide forms may be contained in a pharmaceutical formulation.
- a "fragment" of a fusion peptide according to the present invention refers to any subset of the molecules, that is, a shorter peptide which retains the desired biological activity. Fragments may readily be prepared by removing amino acids from either end of the molecule and testing the resultant for its properties as a incretin. Proteases for removing one amino acid at a time from either the N-terminal and/or the C-terminal and of a polypeptide are known, and so determining fragments which retain the desired biological activity involves only routine experimentation. Conclusively, fragments may be due to deletions of amino acids at the peptide termini and/or of amino acids positioned within the peptide sequence.
- inventive fusion peptide which has anti-diabetes type 2 activity can also contain additional amino acid residues flanking the inventive peptide.
- additional flanking residues affect the basic and novel characteristics of the core peptide, e.g. by its effects on pancreas cells, by routine experimentation.
- the term "consisting essentially of, when referring to a specified sequence, means that additional flanking residues can be present which do not affect the basic and novel characteristic of the specified inventive peptide. This term does not comprehend substitutions, deletions or additions within the specified sequence.
- variant refers to a molecule which is substantially similar to either the entire inventive peptide defined above or a fragment thereof.
- Variant peptides may be conveniently prepared by direct chemical synthesis of the variant peptide, using methods well known in the art.
- such variant of an inventive peptide would have similar anti-diabetic, e.g. insulin stimulating activity as the corresponding naturally-occurring GLP-1 peptide.
- amino acid sequence variants of the fusion peptides defined above can be prepared by mutations in the DNAs which encode the synthesized derivatives. Such variants include, for example, deletions from, or insertions or substitutions of, residues within the amino acid sequence. Any combination of deletion, insertion, and substitution may also be made to arrive at the final construct, provided that the final construct possesses the desired activity. Obviously, the mutations that will be made in the DNA encoding the variant peptide must not alter the reading frame and preferably will not create complementary regions that could produce secondary mRNA structure.
- an "analog" of the fusion peptides defined above, according to the present invention refers to a non-natural molecule which is substantially similar to either the entire molecule or to an active fragment thereof. Such analog would exhibit the same activity as the corresponding naturally-occurring GLP-1 peptide.
- substitutions which may be made in the inventive fusion peptide, according to the present invention, may be based on analysis of the frequencies of amino acid changes between a homologous protein/peptide of different species. Based upon such analysis, conservative substitutions may be defined herein as exchanges within one of the following five groups:
- substitutions are considered to be "highly conservative” : Asp/Glu; His/Arg/Lys; Phe/Tyr/Trp; Met/Leu/Ile/Val.
- Semi-conservative substitutions are defined to be exchanges between two of groups (I) - (IV) above which are limited to supergroup (A), comprising(I), (II), and(III) above, or to supergroup (B), comprising (IV) and (V) above. Substitutions are not limited to the genetically encoded or even the naturally-occurring amino acids.
- analogs or variants of the inventive fusion peptide may also contain amino acid substitutions, made e.g. with the intention of improving solubility (replacement of hydrophobic amino acids with hydrophilic amino acids).
- the (modified) GLP-1 peptide is characterized by one or more substitution(s) at positions 7, 8, 11, 12, 16, 22, 23, 24, 25, 27, 30, 33, 34, 35, 36, or 37 of the GLP-1 peptide.
- substitution(s) designates a GLP-1 analogue wherein the naturally occurring lysine at position 34 has been substituted with arginine.
- component (I) and/or (III) of an inventive fusion peptide may comprise variants and analogs of GLP-1(7-35, 36 or 37) including, for example, Gln9-GLP-1 (7-37), D-Gln9-GLP-1(7-37), acetyl-Lys9-GLP-1 (7-37), Thr16-Lys18-GLP-1 (7-37), and Lys18-GLP-1 (7-37), Arg34-GLP-1 (7-37), Lys38-Arg26-GLP-1 (7-38)-OH, Lys36-Arg26-GLP-1 (7-36), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34-Lys38-GLP-1(7-38), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34
- inventive fusion peptide contains as component (I) or (III) a modified GLP-1 peptide comprising the amino acid sequence of the following formula II (SEQ ID No.: 44):
- component (I) and/or (III) of the inventive fusion peptide contains a modified GLP-1 peptide comprising the amino acid sequence of the following formula III (SEQ ID No.: 45):
- component (I) and/or (III) of the inventive fusion peptide contain a (modified) GLP-1 peptide, which is selected from GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)-amide, GLP-1 (7-37) or an variant, analogue or derivative thereof.
- inventive peptides comprising in their components (I) and/or (III) a modified GLP-1 peptide having a Aib residue in position 8 or an amino acid residue in position 7 of said GLP-1 peptide, which is selected from the group consisting of D-histidine, desamino-histidine, 2-amino-histidine, hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine and 4-pyridylalanine.
- a modified GLP-1 peptide having a Aib residue in position 8 or an amino acid residue in position 7 of said GLP-1 peptide, which is selected from the group consisting of D-histidine, desamino-histidine, 2-amino-histidine, hydroxy-histidine, homohistidine, N-acetyl-histidine,
- Examples of production of amino acid substitutions in proteins which can be used for obtaining analogs for use in the present invention include any known method steps, such as presented in U. S. patents RE 33,653 ; 4,959,314 ; 4,588,585 and 4,737,462, to Mark et al ; 5,116,943 to Koths et al ; 4,965,195 to Namen et al ; and 5,017,691 to Lee, et al , and lysine substituted proteins presented in US patent 4,904,584 (Shaw et al ).
- the variant or analog as defined above and contained in component (I), (II) and/or (III), will have a core sequence, which is the same as that of the "native" sequence, e.g. GLP-1(7-37) or GLP-2 or biologically active fragment thereof or any IP2 isoform, which has an amino acid sequence having at least 80% identity to the native amino acid sequence and retains the biological activity thereof. More preferably, such a sequence has at least 90% identity, or most preferably at least 95% identity to the native sequence. Where a particular peptide is said to have a specific percent identity to a reference polypeptide of a defined length, the percent identity is relative to the reference peptide.
- the percent identity is relative to the reference peptide.
- a peptide that is 50% identical to a reference polypeptide that is 100 amino acids long can be a 50 amino acid polypeptide that is completely identical to a 50 amino acid long portion of the reference polypeptide. It might also be a 100 amino acid long polypeptide, which is 50% identical to the reference polypeptide over its entire length.
- sequence identity means that the sequences are compared as follows.
- sequences are aligned using Version 9 of the Genetic Computing Group's GAP (global alignment program), using the default (BLOSUM62) matrix (values-4 to +11) with a gap open penalty of-12 (for the first null of a gap) and a gap extension penalty of-4 (per each additional consecutive null in the gap).
- BLOSUM62 global alignment program
- percentage identity is calculated by expressing the number of matches as a percentage of the number of amino acids in the claimed sequence.
- Derivatives of a fusion peptide or an analog, fragment or variant thereof are also encompassed by the present invention.
- the term "derivatives" of an inventive fusion peptide is intended to include only those modified inventive peptides that do not change one amino acid to another of the twenty commonly-occurring natural amino acids.
- a genetically encoded amino acid may be modified by reacting it with an organic derivatizing agent that is capable of reacting with selected side chains of residues or amino or carboxy groups of terminal residues (preferably by covalent modification) or by introducing non-natural amino acids (manufactured by chemical synthesis, i.e.
- D-isomers of the amino acids encoded by the genetic code Aib (a-aminoisobutyric acid), Abu (a-aminobutyric acid), Tie (tert-butylglycine), alanine, 3-aminomethyl benzoic acid, anthranilic acid) or natural amino acids which are not encoded by the genetic code, e.g. hydroxyproline, ⁇ -carboxyglutamate, ornithine, phosphoserine, D-alanine and D-glutamine or by a modification of the peptide backbone by alternative peptide backbone arrangements.
- inventive fusion peptide which - as defined above - also comprises variants, analogues or fragments of the fusion peptide) are disclosed, which may occur in an inventive fusion peptide at any site (any amino acid), e.g. positioned in component (I), (II) and/or (III).
- Cysteinyl residues if present in any form of an inventive fusion peptide, e.g. an analogue of an inventive fusion peptide, most commonly are reacted with alpha-haloacetates (and corresponding amines), such as chloroacetic acid or chloroacetamide, to give carboxylmethyl orcarboxyamidomethyl derivatives.
- Cysteinyl residues also are derivatized by reaction with bromotrifluoroacetone, alpha-bromo-beta-(5-imidazoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl-2-pyridyl disulfide, p-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, orchloro-7-nitrobenzo-2-oxa-1,3-diazole.
- Histidyl residues in an inventive fusion peptide may be derivatized by reaction with diethylprocarbonate at pH 5.5-7.0 because this agent is relatively specific for the histidyl side chain.
- Parabromophenacyl bromide is also useful; the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.
- the N-terminal histidine residue (His7) of GLP-1(7-37) as contained in component (I) and/or (III) of the inventive fusion peptide is very important to the insulinotropic activity of GLP-1 peptides as shown by Suzuki et. al. (Diabetes Res.; Clinical Practice 5 (Supp. 1): S30 (1988 )).
- inventive fusion peptide may be modified at His7 of its GLP-1 as part of component (I) and/or (III) by alkyl or acyl (C1-C6) groups, or replacement of His with functionally-equivalent C5-C6 ring structures.
- a preferred modification is the introduction of a hydrophobic moiety at the amino terminus of His7 or its histidyl side chain.
- Lysinyl and amino terminal residues of an inventive fusion peptide may e.g. be reacted with succinic or other carboxylic acid anhydrides. Derivatization with these agents has the effect of reversing the charge of the lysinyl residues.
- acyl (C12-C18) modifications of the epsilon-amino group of lysine residue(s) in the inventive fusion peptide their half-life in circulation is increased.
- Arginyl residues may e.g. be modified by reaction with one or several conventional reagents, among them phenylglyoxal; and ninhydrin.
- arginine residues requires that the reaction be performed in alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine, as well as the arginine epsilon-amino group.
- N-acetylimidazole and tetranitromethane may be used to form O-acetyl tyrosyl species and e-nitro derivatives, respectively.
- Carboxyl side groups may be selectively modified by reaction with carbodiimides (R'N-C-N-R') such as 1-cyclohexyl-3-[2-morpholinyl-(4-ethyl)] carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl)carbodiimide.
- carbodiimides R'N-C-N-R'
- aspartyl and glutamyl residues may be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
- Glutaminyl and asparaginyl residues may be deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues may be deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention.
- Deamidated inventive fusion peptides may undergo an altered susceptibility to proteolysis with protease or peptidase enzymes, suggesting that deamidation may have physiological significance in directing proteolytic cleavage of an inventive fusion peptide. It is noted that bio-synthetic inventive fusion peptides may degrade under certain storage conditions, resulting in deamidation at one more positions in the inventive peptide.
- Methionine residues in the inventive peptides may be susceptible to oxidation, primarily to the sulfoxide.
- both desamide inventive fusion peptides and/or sulfoxide inventive fusion peptides may be used to exhibit full biological activity.
- Suitable reagents for derivatizing alpha-amino acid-containing residues include imidoesters such as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methyliosurea; 2,4-pentanedione; and transaminase-catalyzed reaction with glyoxylate.
- imidoesters such as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methyliosurea; 2,4-pentanedione; and transaminase-catalyzed reaction with glyoxylate.
- terminal amino acid residues of an inventive fusion peptide with their carboxy (C-terminus) and their amine (N-terminus) groups may be present in their protected (e.g. the C terminus by an amide group) and/or unprotected form, using appropriate amino or carboxyl protecting groups.
- acid-addition salts of the inventive fusion peptide may be provided. Common acid addition salts are hydrohalic acid salts, i.e., HBr, HI, or more preferably, HCl.
- inventive fusion peptides are based on carbohydrates and/or lipids which may be covalently coupled to the inventive fusion peptide. It is preferred to couple lipids and/or carbohydrates to serine, threonine, asparagine, glutamine or tyrosine or glutamate or aspartate via their reactive side chain moieties. Alternatively, carbohydrates and/or lipids may also be linked to the terminal moieties of the inventive fusion peptide. Furthermore, an inventive fusion peptide may be coupled to a functionally different peptide or protein moiety, which may also stabitize the inventive fusion peptide and/or may serve to improve the transport properties of an inventive fusion peptide in body fluids, in particular blood.
- Suitable peptides or proteins may e.g. be selected from Albumin, Transferrin etc., which are directly coupled (as component IV) to the inventive fusion peptide or via a peptide or organic linker sequence.
- these peptides or protein are linked to one of the termini of the inventive fusion peptide.
- retro-inverso isomer of the inventive fusion peptide composed of D amino acids or at least partially composed of D amino acids.
- the term "retro-inverso isomer” refers to an isomer of a linear peptide in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see, e.g., Jameson et al., Nature, 368, 744-746 (1994 ); Brady et al., Nature, 368, 692-693 (1994 )).
- the retro-inverso peptide is assembled in reverse order of amino acids, typically with F-moc amino acid derivatives.
- the crude peptides may be purified by reversed phase HPLC.
- inventive fusion peptides relate to modifications of the peptide backbone.
- the modified inventive fusion peptides are scaffold mimetics. Their backbone is different from the natural occurring backbone, while their side-chain structures are identical with the inventive fusion peptides or their fragments, variants, derivatives or analogs.
- scaffold mimetics exhibit a modification of one or more of the backbone chain members (NH, CH, CO), either as substitution (preferably) or as an insertion. Substituents are e.g.
- a peptide mimetic of an inventive fusion peptide may be a combination of each of these modifications. In particular, modifications of each the groups I, II and III may be combined.
- each backbone chain member may be modified or, alternatively, only a certain number of chain members may be exchanged for a non-naturally occurring moiety.
- all backbone chain members of an inventive fusion peptide of either -NH-, -CHR- or CO are exchanged for another non-naturally occurring group.
- preferable substitution moieties are bioisosteric, e.g.
- back-bone chain elongation by insertions may occur in a scaffold mimetic of the inventive fusion peptide, e.g. by moieties flanking the C-alpha atom. On either side of the C-alpha atom e.g. - O-, -S-, -CH-, -NH- may be inserted.
- oligocarbamate peptide backbone structure of the inventive fusion peptides are particularly preferred.
- the amide bond is replaced by a carbamate moiety.
- the monomeric N-protected amino alkyl carbonates are accessible via the corresponding amino acids or amino alcohols. They are converted into active esters, e.g. p-nitro phenyl ester by using the F-moc moiety or a photo sensitive nitroatryloxycarbonyl group by solid phase synthesis.
- Inventive fusion peptides are protected against proteolytic cleavage as outlined above. They are in particular protected against dipeptidyl aminopeptidase-4 (DPP-IV).
- DPP-IV protected refers to a peptide according to claim 1.
- Inventive fusion peptides as well as their derivatives, analogs, fragments and variants render GLP-1(7-35, 36 or 37) as part of component (I) and/or (III) of the inventive fusion peptide resistant to the plasma peptidase (DPP-IV).
- Resistance of a peptide to degradation by dipeptidyl aminopeptidase IV is determined e.g. by the following degradation assay: Aliquots of the fusion peptides are incubated at 37 C with an aliquot of purified dipeptidyl aminopeptidase IV for 4-22 hours in an appropriate buffer at pH 7-8 (buffer not being albumin). Enzymatic reactions are terminated by the addition of trifluoroacetic acid, and the peptide degradation products are separated and quantified using HPLC or LC-MS analysis.
- One method for performing this analysis is: The mixtures are applied onto a Zorbax300SB-C18 (30 nm pores, 5 ⁇ m particles) 150 x 2.1 mm column and eluted at a flow rate of 0.5 ml/min with a linear gradient of acetonitrile in 0. 1% trifluoroacetic acid (0%-100% acetonitrile over 30 min). Peptides and their degradation products may be monitored by their absorbance at 214 nm (peptide bonds) or 280 nm (aromatic amino acids), and are quantified by integration of their peak areas. The degradation pattern can be determined by using LC-MS where MS spectra of the separated peak can be determined. Percentage intact/degraded compound at a given time is used for estimation of the peptides DPP-IV stability.
- An inventive fusion peptide is defined as DPP-IV stabilised when it is 10 times more stable than the GLP-1 (7-37) based on percentage intact compound at a given time.
- a DPP-IV stabilised inventive fusion peptide is preferably at least 10, more preferably at least 20 times more stable than GLP-1 (7-37) as such. Stability may be assessed by any method known to the skilled person, e.g. by adding DPP-IV to a solution of the fusion peptide to be tested and by determining the degradation of the fusion peptide, e.g. over time, by e.g. a spectroscopic method, Westem-Blot analysis, antibody screening etc.
- an inventive fusion peptide is defined as a compound, which exerts the effect of GLP-1 (7-37) by e.g. binding to its native receptor (GLP-1 receptor).
- GLP-1 receptor e.g. binding to its native receptor
- an inventive fusion peptide has a binding affinity to the GLP-1 receptor, which corresponds to at least 10%, preferably at least 50% of the binding affinity of the naturally occurring GLP-1 peptide.
- the binding affinity may be determined by any suitable method, e.g. surface plasmon resonance etc.
- the inventive peptide evokes formation of intracellular cAMP by its binding to its extracellular receptor, which transmits the signal into the cell.
- the fusion peptides of the invention may be produced synthetically, using solid phase peptide synthesis techniques, similar to the manner of production of GLP-1 (7-36) amide and GLP-1 (7-37) in the art and can be purified afterwards on a laboratory scale e.g. by a single purification step on a reversed-phase HPLC column or suitable chromatography methods.
- inventive fusion peptide may be isolated from the cells from which it is expressed, for instance using conventional separation techniques. Thus cells may be grown under appropriate conditions, for instance including support and nutrients, in vitro, and secreted protein, i.e. the inventive fusion peptide, is recovered from the extracellular medium.
- sequences engineered into cells thus preferably include leader sequences and signal peptide sequences directing secretion of the inventive fusion peptide.
- the cells preferably express protease capable of cleaving the leader and signal sequences, either endogenously or by engineered gene sequences.
- the engineered gene sequences encoding an inventive fusion peptide do not include such leader and signal peptide sequences, whereby the intracellularly expressed inventive fusion peptide will not be secreted, and is recovered from cells by processes involving cell lysis.
- the coding sequences may include purification tags allowing efficient extraction of the product peptide from the medium, which tags may be cleaved to release isolated inventive fusion peptide.
- the invention further provides a nucleic acid, which codes for the inventive fusion peptide, be it the fusion peptide or a fragment, analog or variant thereof.
- a nucleic acid which codes for an inventive fusion peptides is encompassed by the present invention. Due to degeneracy of the genetic code a plurality of nucleic acid sequences may code for an inventive fusion peptide.
- a nucleic acid molecule within the scope of the present invention may also contain the nucleic acid coding for the inventive fusion peptide and, additionally, further (functional) nucleotide sequences.
- such a fusion nucleic acid molecule may code (a) for the entire GLP-1 aa sequence (GLP-1(1-37) or the functional GLP-1(7-35, 36 or 37) sequence, (b) a cleavage sequence at the N-terminus of the GLP-1 sequence according to (a) for any protease, upstream from (b) may code for a leader sequence.
- upstream from the nucleic acid sequence coding for (b) the nucleic acid molecule may additionally comprise (c) a sequence coding for a signal peptide.
- the inventive nucleic acid molecule may have sequence (c) fused upstream from (a) without any sequence coding for a leader sequence (b) in between.
- the leader sequence and signal peptide sequence are heterologous to preproglucagon.
- the invention further provides a vector comprising an inventive nucleic acid (molecule) and other functional components for expression of the inventive nucleic acid (molecule).
- inventive nucleic acid (molecule) will be fused to a promoter sequence and, eventually combined with other regulator sequences, e.g. an enhancer sequence.
- the plasmid may contain an origin of replication.
- one or more antibiotic resistance gene(s) e.g. kanamycin, ampicillin
- the vector may be a plasmid that includes bacterial original promoter, and antibiotic resistance genes and origin promoter, and antibiotic resistance genes for replication and expression in mammalian cells.
- the invention further provides a host cell comprising exogenously introduced DNA of the invention capable of translating the said precursor protein.
- the host cell may be either a prokaryotic host cell or an eukaryotic host cell, e.g. a mammalian cell. However, the host cell is not a human embryonic stem cell & a human germ cell.
- inventive fusion peptide for the manufacture of a medicament for the treatment of an animal, preferably a human being, by administration of an inventive peptide comprising components (I) and (II) and eventually component (III). It is also provided corresponding use of such inventive peptides in the manufacture of a product for the treatment or prevention of a disease or condition associated with glucose metabolism.
- glucose disorder include: diabetes mellitus type I or type II (NIDDM), or insulin resistance, weight disorders and diseases or conditions associated thereto, wherein such weight disorders or associated conditions include obesity, overweight-associated conditions, satiety deregulation, reduced plasma insulin levels, increased blood glucose levels, or reduced pancreatic beta cell mass.
- inventive fusion peptides for the manufacture of a medicament for the treatment of type 2 diabetes (NIDDM) is disclosed herewith.
- the present invention relates to a use of the inventive peptide e.g. for lowering weight of a subject, for reducing satiety of a subject, for post-prandially increasing plasma insulin levels in a subject, for reducing fasting blood glucose level in a subject, for increasing pancreatic beta cell mass in a subject or for treating diabetes type I or II in a subject.
- inventive fusion peptides i.e. fusion peptides or its analogs, fragments, variants or derivatives, as well.
- inventive fusion peptides may be used for the preparation of a medicament for the treatment of neurodegenerative disorders and diseases or conditions associated thereto and for the treatment of disorders and diseases or conditions associated to apoptosis.
- the use of the inventive fusion peptide for treating these disorders results from the following: GLP-1 receptors, which are coupled to the cyclic AMP second messenger pathway, are expressed throughout the brains of rodents and humans. The chemoarchitecture of receptor distribution in the brain does not only correlate with a central role for GLP-1 in the regulation of food intake and response to aversive stress.
- GLP-1 binding at its GLP-1 receptor exerts neurotrophic properties, and offer protection against glutamate-induced apoptosis and oxidative injury in cultured neuronal cells.
- GLP-1 was shown to modify processing of the amyloid ⁇ -protein precursor in cell culture and dose-dependently reduces amyloid ⁇ -peptide levels in the brain in vivo. GLP-1 is therefore also known as regulator of the central nervous system.
- Inventive fusion peptides mimicking the biological activity of physiologically active GLP-1 have therapeutic relevance to the treatment of e.g. Alzheimer's disease (AD) and other central and peripheral neurodegenerative conditions (e.g.
- AD Alzheimer's disease
- other central and peripheral neurodegenerative conditions e.g.
- amyotrophic lateral sclerosis ALS
- Alexander disease Alper's disease
- Ataxia telangiectasia Canavan disease
- Cockayne syndrome Creutzfeldt-Jakob disease
- Multiple Sclerosis Sandhoff disease
- Pick's disease Spinocerebellar Ataxia
- Schilder's disease Parkinson's disease
- physiologically active GLP-1 exerts anti-apoptotic action on various cells, e.g. GLP-1 is beneficial to the preservation of mass and function of freshly isolated human islets or other cell types.
- the biologically active inventive fusion peptide may be used to treat disorders, which are caused by cell or tissue apoptosis.
- inventive fusion peptide may be for the manufacture of a composition which is administered exogenously, and comprises the isolated inventive fusion peptide.
- the resulting composition may be used as well for the treatment of the above disorders.
- inventive host cells, nucleic acid (molecules) or vectors or, rather, inventive host cells, nucleic acid (molecules) or vectors may be used for the preparation of a medicament for the treatment of these disorders.
- formulations which contain inventive fusion peptide sequences as active ingredients are generally well understood in the art, as exemplified by US Patents 4,608,251 ; 4,601,903 ; 4,599,231 ; 4,599,230 ; 4,596,792 ; and 4,578,770 .
- fusion Typically, such formulations are prepared as injectables either as liquid solutions or suspensions, preferably containing water (aqueous formulation) or may be emulsified.
- aqueous formulation is defined as a formulation comprising at least 50 % w/w water.
- aqueous solution is defined as a solution comprising at least 50% w/w water
- aqueous suspension is defined as a suspension comprising at least 50 % w/w water.
- Liquid pharmaceutical compositions generally include a liquid vehicle such as water.
- the liquid vehicle will include a physiological saline solution, dextrose ethanol or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol or combinations thereof may be included.
- isotonic vehicles such as Ringer's Injection or Lactated Ringer's Injection.
- the invention relates to a pharmaceutical formulation
- a pharmaceutical formulation comprising an aqueous solution of a compound according to the present invention, and a buffer, wherein said compound is present in a concentration from 0.1 mg/ml or above, and wherein said formulation has a pH from about 2.0 to about 10.0, preferably from about 7.0 to about 8. 5.
- the pH of the formulation is at least 1 pH unit from the isoelectric point of the compound according to the present invention, even more preferable the pH of the formulation is at least 2 pH unit from the isoelectric point of the compound according to the present invention.
- Solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared.
- the pharmaceutical formulation may be a freeze-dried formulation, whereto the physician or the patient adds solvents and/or diluents prior to use.
- the formulation once prepared may not of immediately administered to a subject. Rather, following preparation, it is packaged for storage in a frozen state, or in a dried form for later reconstitution into a liquid form or other form suitable for administration to a subject.
- the pharmaceutical formulation is a dried formulation (e.g. freeze-dried or spray-dried) ready for use without any prior dissolution.
- dried form is intended the liquid pharmaceutical composition or formulation is dried either by freeze drying (i.e.
- Aggregate formation by a polypeptide during storage of a liquid pharmaceutical composition can adversely affect biological activity of that polypeptide, resulting in loss of therapeutic efficacy of the pharmaceutical composition. Furthermore, aggregate formation may cause other problems such as blockage of tubing, membranes, or pumps when the polypeptide-containing pharmaceutical composition is administered using an infusion system.
- ingredients may be present in the peptide pharmaceutical formulation of the present invention.
- additional ingredients may include wetting agents, emulsifiers, antioxidants, bulking agents, pH buffering agents (e.g. phosphate or citrate or maleate buffers), preservatives, surfactants, stabilizers, tonicity modifiers, cheating agents, metal ions, oleaginous vehicles, proteins (e.g. human serum albumin, gelatin or proteins) and/or a zwitterion (e.g. an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine).
- stabilizers for inventive formulations may preferably be selected from the group of high molecular weight polymers or low molecular compounds.
- the stabilizer is selected from polyethylene glycol (e.g. PEG 3350), polyvinylalcohol (PVA), polyvinylpyrrolidone, carboxy-hydroxycellulose or derivates thereof (e.g. HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, sulphur-containing substances as monothioglycerol, thioglycolic acid and 2-methylthioethanol, and different salts (e.g. sodium chloride).
- PEG 3350 polyethylene glycol
- PVA polyvinylalcohol
- polyvinylpyrrolidone polyvinylpyrrolidone
- carboxy-hydroxycellulose or derivates thereof e.g. HPC, HPC-SL, HPC-L and HPMC
- cyclodextrins e.g. sulphur-containing substances as mono
- compositions may also comprise additional stabilizing agents, which further enhance stability of a therapeutical active polypeptide therein.
- Stabilizing agents of particular interest to the present invention include, but are not limited to, methionine and EDTA, which protect the polypeptide against methionine oxidation, and a nonionic surfactant, which protects the polypeptide against aggregation associated with freeze-thawing or mechanical shearing.
- surfactants for inventive formulations may preferably be selected from a detergent, ethoxylated castor oil, polyglycolyzed glycerides, acetylated monoglycerides, sorbitan fatty acid esters, polyoxypropylene-polyoxyethylene block polymers (e.g. poloxamers such as Pluronic F68, poloxamer 188 and 407, TritonX-100), polyoxyethylene sorbitan fatty acid esters, starshaped PEO, polyoxyethylene and polyethylene derivatives such as alkylated and alkoxylated derivatives (tweens, e.g.
- Tween-20, Tween-40, Tween-80 and Brij-35 polyoxyethylenehydroxystearate, monoglycerides or ethoxylated derivatives thereof, diglycerides or polyoxyethylene derivatives thereof, alcohols, glycerol, lecitins and phospholipids (e.g. phosphatidyl serine, phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl inositol, diphosphatidyl glycerol and sphingomyelin), derivates of phospholipids (e.g. dipalmitoyl phosphatidic acid) and lysophospholipids (e.g.
- ceramides e.g. sodium tauro-dihydrofusidate etc.
- long-chain fatty acids and salts thereof C6-C12 e.g.
- acylcarnitines and derivatives N'X-acylated derivatives of lysine, arginine or histidine, or side-chain acylated derivatives of lysine or arginine N-acylated derivatives of dipeptides comprising any combination of lysine, arginine or histidine and a neutral or acidic amino acid, N-acylated derivative of a tripeptide comprising any combination of a neutral amino acid and two charged amino acids, DSS (docusate sodium, CAS registry no [577-11- 7]), docusate calcium, CAS registry no [128-49-4] ), docusate potassium, CAS registry no [7491-09-0]), SDS (sodium dodecyl sulfate or sodium lauryl sulfate), sodium caprylate, cholic acid or derivatives thereof, bile acids and salts thereof and glycine or taurine conjugates, urso
- Tetronic's which are tetrafunctional block copolymers derived from sequential addition of propylene oxide and ethylene oxide to ethylenediamine, or the surfactant may be selected from the group of imidazoline derivatives, or mixtures thereof. Each one of these specific surfactants constitutes an alternative embodiment of the invention.
- the use of a surfactant in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995 .
- preservatives may preferably be selected from the group consisting of phenol, o-cresol, m-cresol, p-cresol, methyl p-hydroxybenzoate, propyl p-hydroxybenzoate, 2-phenoxyethanol, butyl p-hydroxybenzoate, 2-phenylethanol, benzyl alcohol, ethanol, chlorobutanol, and thiomerosal, bronopol, benzoic acid, imidurea, chlorohexidine, sodium dehydroacetate,chlorocresol, ethyl p-hydroxybenzoate, benzethonium chloride, chlorphenesine (3p-chlorphenoxypropane-1,2-diol) or mixtures thereof.
- isotonic agents these may preferably be selected from the group consisting of a salt (e.g. sodium chloride), a sugar or sugar alcohol, an amino acid (e.g. L-glycine, L-histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine), an alditol (e.g. glycerol (glycerine), 1,2-propanediol (propyleneglycol), 1,3-propanediol, 1,3-butanediol) polyethyleneglycol (e.g. PEG400), or mixtures thereof.
- a salt e.g. sodium chloride
- a sugar or sugar alcohol an amino acid (e.g. L-glycine, L-histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine), an alditol (e.g. g
- Any sugar such as mono-, di-, or polysaccharides, or water-solubleglucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, soluble starch, hydroxyethyl starch and carboxymethylcellulose-Na may be used.
- the sugar additive is sucrose.
- Sugar alcohol is defined as a C4-C8 hydrocarbon having at least one -OH group and includes, for example, mannitol, sorbitol, inositol, galacititol, dulcitol, xylitol, and arabitol.
- the sugar alcohol additive is mannitol.
- the sugars or sugar alcohols mentioned above may be used individually or in combination. There is no fixed limit to the amount used, as long as the sugar or sugar alcohol is soluble in the liquid preparation and does not adversely effect the stabilizing effects achieved using the methods of the invention.
- cheating agents may preferably be selected from salts of ethylenediaminetetraacetic acid (EDTA), citric acid, and aspartic acid, and mixtures thereof.
- EDTA ethylenediaminetetraacetic acid
- citric acid citric acid
- aspartic acid and mixtures thereof.
- buffers these are preferably selected from the group consisting of sodium acetate, sodium carbonate, citrate, glycylglycine, histidine, glycine, lysine, arginine, sodium dihydrogen phosphate, disodium hydrogen phosphate, sodium phosphate, and tris(hydroxymethyl)-aminomethane, hepes, bicine, tricine, malic acid, succinate, maleic acid, fumaric acid, tartaric acid, aspartic acid or mixtures thereof.
- Each one of these specific buffers constitutes an alternative embodiment of the invention.
- compositions containing the inventive fusion peptide are conventionally administered parenterally, by injection, for example, either subcutaneously, intradermally, subdermally or intramuscularly.
- a composition for parenteral administration of the inventive peptide may, for example, be prepared as described in WO 03/002136 .
- Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral, buccal, sublinqual, intraperitoneal, intravaginal, anal and intracranial formulations.
- traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 12%.
- Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10-95% of active ingredient, preferably 25-70%.
- Controlled release preparations may be achieved by the use of polymers to complex or absorb a fusion peptide of the present invention.
- the controlled delivery of the active ingredient (fusion peptide) may be exercised by selecting appropriate macromolecules (for example, polyesters, polyamino acids, polyvinylpyrrolidone, ethylene vinylacetate copolymers, methylcellulose, carboxymethylcellulose, and protamine sulfate), the concentration of the macromolecules as well as the methods of incorporation.
- appropriate macromolecules for example, polyesters, polyamino acids, polyvinylpyrrolidone, ethylene vinylacetate copolymers, methylcellulose, carboxymethylcellulose, and protamine sulfate
- Another possible method to control the duration of action by controlled release preparations is to incorporate a peptide of the present invention into particles of a polymeric material such as polyesters, polyamino acids, hydrogels, poly(lactic acid) or ethylene vinylacetate copolymers.
- a polymeric material such as polyesters, polyamino acids, hydrogels, poly(lactic acid) or ethylene vinylacetate copolymers.
- inventive fusion peptides may be formulated as neutral or salt forms.
- a peptide of the present invention may be sufficiently acidic or sufficiently basic to react with any of a number of organic and inorganic bases, and organic and inorganic acids, to form an (addition) salt, e.g. formed with the free amino groups of the peptide.
- Acids commonly employed to form acid addition salts are inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, phosphoric acid, and the like, and organic acids such tartaric, asp-toluenesulfonic acid, methanesulfonic acid, oxalic acid, mandelic, p-bromophenyl-sulfonic acid, carbonic acid, succinic acid, citric acid, benzoic acid.
- inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, phosphoric acid, and the like
- organic acids such tartaric, asp-toluenesulfonic acid, methanesulfonic acid, oxalic acid, mandelic, p-bromophenyl-sulfonic acid, carbonic acid, succinic acid, citric acid, benzoic acid.
- salts include sulfate, pyrosulfate, bisulfate, sulfite, bisulfite, phosphate, monohydrogenphosphate, dihydrogenphosphate, metaphosphate, pyrophosphate, chloride, bromide, iodide, acetate, propionate, decanoate, caprylate, acrylate, formate, isobutyrate, caproate, heptanoate, propiolate, oxalate, malonate, succinate, suberate, sebacate, fumarate, maleat, butyne-1,4-dioate, hexyne-1,6-dioate, benzoate, chlorobenzoate, methylbenzoate, dinitrobenzoate, hydroxybenzoate, methoxybenzoate, phthalate, sulfonate, xylenesulfonate, phenylacetate, phenylpropionate, phenylbutyrate,
- Acid addition salts, carboxylate salts, lower alkyl esters, and amides of the inventive peptides may be formulated according to WO 91/11457 (1991 ); EP 0 733 644 (1996 ); and U.S. 5,512,549 (1996 ).
- Formulations containing the inventive fusion peptide sequences are to be administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective.
- the quantity to be administered depends on the subject to be treated, including, e.g., the severity of the patient's disease.
- Suitable dosage ranges are e.g. of the order of several hundred micrograms active ingredient per therapeutic dose with a preferred range from about 0.1 ⁇ g to 2000 ⁇ g (even though higher amounts in the 1-10 mg range are contemplated), such as in the range from about 0.5 ⁇ g to 1000 ⁇ g, preferably in the range from 1 ⁇ g to 500 ⁇ g and especially in the range from about 10 ⁇ g to 100 ⁇ g.
- Formulations containing the inventive fusion peptides plus e.g. additional excipients, e.g., glycine and mannitol or other additives, may be marketed in a lyophilized form as vials.
- a companion diluent vial is provided, allowing the patient to reconstitute the product to the desired concentration prior to administration of the dose.
- Inventive formulations can also be marketed in other well known manners, such as prefilled syringes, etc.
- the coding sequence for GLP-1(7-37) cDNA was synthesised synthetically, in a sequence including HincII and EcoRI sites as indicated in Fig. 1a .
- the cDNA illustrated in Fig. 1b was synthesised, including the coding sequences for GLP-1(7-37), IP2 and restriction sites for Sfol, EcoRI and Xbal, as illustrated in Fig. 1b .
- the heterologous signal sequence of stromelysin 3 (Acc.No. NM_005940) was used.
- cDNA, encoding stromelysin signal and leader sequence was reverse transcriptase PCR amplified from human RNA, and used with the construct of Fig. 1 a or Fig. 1b to form the construct shown in Fig. 1c and Fig. 1d , respectively.
- the HincII/EcoRI fragment of the Fig. 1 a construct is cloned into the Sfol site of the sequence of Fig. 1d to form the construct Fig. 1e .
- the EcoRI fragment of Fig. 1d is cloned into the EcoRI site of an eukaryotic expression plasmid, to produce the construct shown in Fig. 1f .
- the HincII/XbaI fragment of the construct shown in Fig. 1b is repetitively cloned into the SfoI/XbaI site of the construct shown in Fig. 1d.
- Figure 1h shows a synthesized, codon optimized sequence encoding the stromelysin leader and signal sequences interrupted by a shortened endogenous intron sequence, fused to sequences encoding human GLP-1 (7-37), IP2 and GLP-2(1-35).
- the DNA sequence of the construct Fig. 1h is SEQ ID No.:16, while SEQ ID No.:15 also shows the sequence of the translated peptide.
- Figs 1i and 1j are also synthesised.
- Figs 1i and 1j are then used to form the construct in Fig. 1k , by cloning the NaeI/BssHII fragment of Fig. 1j into the NaeI/BssHII linearised sequence of Fig. 1h .
- the DNA sequence of the construct Fig. 1k is SEQ ID No.: 14, while SEQ ID No.:13 also shows the sequence of the translated peptide.
- the construct of Fig. 1l is formed by BssHII digest and religation of the sequence of Fig. 1h .
- the DNA sequence of the construct Fig. 1l is SEQ ID No.: 18, while SEQ ID No.:17 also shows the sequence of the translated peptide.
- the construct of Fig. 1m is formed by cloning the AfeI/BssHII fragment of the sequence of Fig. 1i into the AfeI/BssHII linearised sequence of Fig. 1h .
- the DNA sequence of the construct Fig. 1m is SEQ ID No.: 20, while SEQ ID No.: 19 also shows the sequence of the translated peptide.
- HEK293 human embryonic kidney cell line, # ACC 305, DSMZ Cell Culture Collection, Germany
- AtT20 Mouse LAF1 pituitary gland tumor cell line, #87021902, European Cell Culture Collection, UK
- hTERT-MSC cells are generated by Prof. Kassem, University Hospital of Odense, Denmark.
- HEK293 cells were transfected by standard calcium phosphate co-precipitation method as described in Current Protocols in Molecular Biology (Ausubel et al. 1994ff Harvard Medical School Vol2., Unit 9.1 ).
- AtT20 cells were transfected using FuGene (Roche) as described in current Protocols in Molecular Biology (Ausubel et. al. 1994ff, Harvard Medical School Vol 2., Unit 9.4 ).
- Transfection of hTERT-MSC cells was performed using the Nucleofector technology (Amaxa), a non-viral method which is based on the combination of electrical parameters and cell-type specific solutions. Using the Nucleofector device (program C17) and the Nucleofector solution VPE-1001 transfection efficiencies >60% have been achieved. 48 hours after transfection selection of cell clones with stable integration of DNA into the chromosome was performed by adding the selective agent blasticidin (2 ⁇ g/ml) into the culture medium. 12-15 days later, stable transfected cell clones could be isolated and expanded for characterisation.
- Table 1 construct cell clone active GLP per 10 6 cells and hour [pmol] #103 -GLP 1 (7-37) 49TM 113/13 0,4 #317 -GLP 1 (7-37) -IP2-11aa 71TM169/1 0,3 #217 -GLP1 (7-37) -IP2-GLP1 (7- 79TM217/13 2,7
- HEK293 and hTERT-MSC cells were transiently transfected with constructs, encoding the heterologous stromelysin signal sequence, which is linked to GLP-1 variants encoding the following peptides:
- HEK293 cells The results are shown in Figures 4 (HEK293 cells) and 5 (hTERT-MSC cells).
- HEK293 and hTERT-MSC cells are both effective hosts for the gene construct.
- the numbering of the results for the transfected cells of types 1 to 3 is as with Example 3 (1: 100 ng synthetic GLP-1 (7-37) dissolved in supernatant of mock transfected hTERT-MSC cells, 2: supernatant of hTERT-MSC cells (clone 79TM217/13) secreting dimeric GLP-1 from construct #217, 3: supernatant of AtT20 cells (clone 81-A-217/3) secreting dimeric GLP-1 from construct #217).
- construct 1 produces wild type GLP-1 which is inactivated by DPP-IV in a similar way to synthetic GLP-1
- inventive C-terminally elongated GLP-1 forms (2 and 3 in Figure 4 , 3 in Figure 5 ) are more resistant to degradation and maintain at least 40% activity.
- the C-terminal extended GLP-1 peptides are significantly stabilised in human plasma in vitro.
- the peptide with the dimeric GLP-1 sequence (3) is nearly fully stabilised to DPP-IV degradation in vitro.
- GLP-1 peptides not according to the claims were produced synthetically by solid phase ( syn ) or recombinant using E.coli (rec).
- GLP-1 peptides 31 ng SEQ ID No:1 and 10 ng of each SEQ ID No:6, SEQ ID No:7, SEQ ID No:8) were separated in a 10%-20% gradient SDS PAGE (120V, 90minutes) and transferred to a PVDF membrane (Immobilon-P Membran 0,45 ⁇ m Millipore IPVH 00010) by semi-dry blotting (2.0 mA/cm 2 , 60 minutes).
- Fig. 6 shows a Western Blot for the peptides indicated.
- SEQ ID No.: 1 corresponds to GLP-1(7-37), 31 aa, 3,3 kD
- SEQ ID No.:8 ID8 syn, CM3
- SEQ ID No.: 7 corresponds to GLP-1(7-37)-IP2-RR-GLP2, 83 aa, 9,4 kD
- SEQ ID No.: 6 ID6syn, CM1 corresponds to GLP-1(7-37)-IP2-RR-GLP1(7-37), 79 aa, 8,7 kD.
- Synthetic GLP-1 peptides (not according to the claims) (SEQ ID No:1 syn , SEQ ID No:6 syn , SEQ ID No:7 rec , SEQ ID No:8 syn ) were incubated at concentrations of 20 ng/ml with human plasma at 37°C and 5% CO 2 for 3 hours. Dipeptidylpeptidase activity of the plasma was inhibited by an DPP-IV inhibitor (#DPP4, Biotrend). Active GLP was measured using the GLP-1 (Active) ELISA (#EGLP-35K, Biotrend).
- RIN-5F cells (rat islet cell tumor; ECACC No. 95090402) were grown in 24-well plates for 4 days reaching 70% confluence. Cells were washed twice with DMEM (E15-009, PAA) before addition of 0.5 ml DMEM (E15-009, PAA) supplemented with 1% HSA (Aventis), 0.2 mM IBMX (858455, Sigma) and the test peptides. After a 20 minute incubation at 25°C, cells were washed twice with ice cold PBS. Cellular cAMP was extracted by addition of 0.1N HCl containing 0.5% Triton X-100. Cyclic AMP was quantified using the cAMP (low pH) EIA (Cat.
- Dipeptidylpeptidase activity was stopped by addition of DPPIV inhibitor (#DPP, Biotrend) and active GLP-1 levels determined using the GLP-1 (active) ELISA (#EGLP-35K, Linco). Results are from triplicates in at least two independent experiments.
- fusion peptides having at least nine amino acids added to the C-terminus of GLP-1 are CM3 (murine, GLP-1(7-37)-IP2) and derivatives thereof with modified sequences in component (II) (IP2), i.e. CM3, CM3-ANA01, CM3-ANA02, CM3-ANA03, CM3-ANA04, CM3-ANA05, CM3-ANA07, CM3-ANA07 (therein CM3, CM3-AVA02, CM3-AVA03, CM3-ANA04, CM3-ANA05 and CM3-ANA07 not according to the claims).
- Peptides LP-1 and CM3-ANA06 reflect control or reference substances.
- the inventive fusion peptides show a considerably longer in vitro plasma stability as compared to the reference substances.
- the C-terminal elongation of GLP-1 introduces a steric hindrance, preventing these analogs to enter the active site of the DPPIV, and thus escape degradation, whereas shorter reference substances do not show this protecting effect for GLP-1 stability.
- This hypothesis is supported by the continuously increasing stability of cumulative C-terminal elongations of the peptides CM3-ANA06 (36aa), CM3-ANA07 (40aa) and CM3 (46aa). Nevertheless this phenomenon is not only dependent on the pure number of amino acids, which has been shown by Alanin substitutions in the IP2 region of CM3.
- CM3-ANA03 peptide which has the same number of amino acids like CM3, has a strongly reduced stability compared to CM3.
- CM3-ANA01 which also consists of 46 amino acids, has a higher plasma stability than CM3. This may indicate that beside the number of amino acids, additional steric effects may influence the stability.
- Particularly preferred are fusion peptides having an elongation comprising IP2 at the C-terminus of GLP-1 or an elongation having a certain degree of homology with IP2, which may result from a specific conformation, which hinders the N-terminal region from entering the active site of DPPIV.
- CM1 syn induced no toxicity and only a minimal T-cell antibody response and antibody titer as shown in the following figure.
- An immunologic effect of by-products (purity of the peptide only 95%) cannot be excluded.
- Fig. 11 shows studies for evaluation of potential immunogenic effects of CM1syn.
- Fig. 11A results of a T-cell recall response assay are shown. Spleens of the treated and control mice were explanted, T-cells isolated and stimulated with increasing amounts of antigene. Proliferative recall response is measured.
- Fig. 11 B the antigen specific IgG antibody titer in the immune sera of the animals was determined.
- mice After a two-hour fastening period diabetic C57BL/KsJ@Rj-db (db/db) mice were treated with five different concentrations of GLP-1, CM1, CM3, CM3-ANA01 and exendin-4. A sixth group was treated with saline only. 7 animals were treated per group. Blood glucose was determined from tail bleeds directly before, 1 hour and 4 hours after injection.
- Fig. 12 Fig. 10A (GLP-1), Fig. 12B (CM1), Fig. 12C (CM3) and Fig. 12D (CM3-ANA01)
- a graph was prepared with the percentage difference of the blood glucose in relation to the start value for the different concentrations.
- the ED 50 value for the different test substances was determined by preparing a dose response curve with the values of the 1h measurements as a percentage reduction in comparison to the basal value.
- CM3-ANA01, CM3 rec and Exendin-4 the Morgan-Mercer-Flodin (MMF) model was used, for CM1 the Richards model was used.
- MMF Morgan-Mercer-Flodin
- the GLP-1 analogs CM1, CM3 and CM3-ANA01 reveal a more than 20fold better in vivo bioactivity, which is most likely a result of the enhanced plasma stability.
- Peptides or vehicle will be given once daily (group A-D) between 2°° - 3°°p.m. subcutaneously in the skin fold of the back.
- the regimen was continued for 18 weeks. From week 12 to 18 treatment was done twice a day in 6 of 12 animals per group.
- mice Various parameters of the mice were investigated, i.e. health status (1), body weight (2), food consumption (3), blood glucose (4), glucose tolerance test (5), insulin data (6), glycosylated hemoglobin (7), pathology (8), and restimulation of T cells (9).
- Body weight (2) was lower in all treated groups after 18 weeks of treatment ( FIG. 13 ). Relative body weight increase is significantly lower in the CM3-ANA01 group.
- Fig. 13A shows the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the body weight of db/db mice. The mean values of 12 animals per group are plotted.
- Fig. 13B shows the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the body weight of db/db mice.
- the relative body weight increase of 12 animals per group after a treatment of 122 days is plotted. Only the treatment with test substance CM3-ANA01 (group B) revealed a significantly lower weight increase (p ⁇ 0.001).
- Fig. 14 shows the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the weekly food consumption of db/db mice during a 122 day treatment period.
- the relative food consumption per mouse is significantly decreased in group B and C (p ⁇ 0.001).
- Non-fasted blood glucose level (1 hour after peptide injection) is shown in Fig. 15A , i.e. the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the non-fasted blood glucose levels.
- Blood glucose was measured from a tail bleed 1 hour after s.c. injection of saline (A) or the peptides CM1 (B), CM3-ANA01 (C) or exendin (D) in a concentration of 24nmol/kg.
- peptide injection is reduced to 55% in group B, 51% in group C and 60% in group D ( Fig. 15B ).
- the blood glucose drecrease in the treated groups treated groups is highly significant (p ⁇ 0.0001).
- Fasted blood glucose level (18 hours after peptide injection) are shown in Fig. 15C , i.e. the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the fasted blood glucose levels.
- Blood glucose was measured from a tail bleed after a 12-hour overnight fast 18 hours after s.c. injection of the test substances. Fasted blood glucose level 18h after peptide injection is reduced in the CM1 and CM3-ANA01 group.
- IPGTT i.p. glucose tolerance test (5)
- the basal blood glucose value (0 min) of 12 hour fasted animals has been determined by tail bleed followed by an s.c. injection of the test substance and an i.p. injection of 20% glucose solution (1g glucose per kg). Blood glucose has been further on determined 15, 30, 45, 60, 90 and 120 minutes after glucose injection.
- a significant normalization of glucose tolerance was shown in all treated groups ( Fig. 16A ).
- FIG. 16A Another presentation of the data presented by Fig. 16A of the blood glucose tolerance test is given in Fig. 16B .
- IPGTT i.p. glucose tolerance test
- Insulin levels (6) were determined from mice after a 12 hour overnight fastening period. After 18 weeks of treatment, all mice of the treated groups produce significantly more insulin than the non-treated control.
- Fig. 17 presents the data for serum insulin levels in mice after 18 week treatment with 0.9% saline (Group A), CM1 peptide (group B), CM3-ANA01 peptide (group C) or exendin-4 (group D). Directly after sampling blood samples have been treated with a protease inhibitor cocktail to avoid insulin degradation. The serum was analysed for insulin with the Insulin Mouse Ultrasensitive ELISA (Cat.# EIA-3440, DRG). Significance has been determine with Student's t-test.
- Glycosylated hemoglobin (7) is formed by excess plasma glucose binding to hemoglobin in red blood cells (RBC). Since RBCs have a 120-day lifespan, measurements of the glycolylated hemoglobin gives a longer-term indication of glucose control and is seen as a better indicator than plasma glucose levels.
- Whole blood was collected from the retro-orbital sinus and analyzed with the Enzymatic HbAlc Test Kit (#DZ121A, Diazyme) to determine the glycosylated hemoglobin levels. Using glycosylated hemoglobin as a parameter, a significant reduction in the increase was seen in all treated groups.
- Fig. 18A shows the relative increase of glycosylated hemoglobin (GHb) in whole blood samples after 6, 12 and 18 weeks of treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D).
- Fig. 18B shows the relative increase of glycosylated hemoglobin (GHb) in whole blood samples after 18 weeks of treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D).
- the increase of the glycosylated hemoglobin levels of all treated groups are significantly lower than the control.
- Pathology (8) of the mice treated was conducted. Necropsy revealed no differences in the organs of the treated groups compared to the non-treated group A, except the pancreas volume. Pancreas weight was determined and revealed to be highly significant higher in all treated groups.
- FIG. 20 shows the in vitro recall response of spleen cells to different concentrations of the test substances CM1 ( Fig. 20A ) and CM3-ANA01 ( Fig. 20B ) and the reference substance exendin-4 ( Fig. 20C ).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Diabetes (AREA)
- Endocrinology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Hematology (AREA)
- Obesity (AREA)
- General Physics & Mathematics (AREA)
- Psychiatry (AREA)
- Hospice & Palliative Care (AREA)
- Emergency Medicine (AREA)
- Physics & Mathematics (AREA)
- Child & Adolescent Psychology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
- The present invention relates to novel GLP-1 fusion peptides which have extended C termini, are resistant to endopeptidase IV inactivation, may be expressed at high levels in transformed animal cells, and are e.g. useful in the treatment of
type 2 diabetes. - The glucagon gene is well studied, see e.g. White, J.W. et al., 1986 Nucleic Acid Res. 14(12) 4719-4730. The preproglucagon molecule as a high molecular weight precursor molecule is synthesised in pancreatic alpha cells and in the jejunum and colon L cells. Preproglucagon is a 180 amino acid long prohormone and its sequence contains, in addition to glucagon, two sequences of related structure: glucagon-like peptide-1 (GLP-1) and glucagon-like peptide-2 (GLP-2). In the preproglucagon molecule, between GLP-1 and GLP-2 is a 17 amino acid peptide sequence (or rather a 15 amino acid sequence plus the C-terminal RR cleavage site), intervening peptide 2 (IP2). The IP2 sequence (located between GLP-1 and -2 in the precursor molecule) is normally cleaved proteolytically after aa 37 of GLP-1. The preproglucagon module is therefore cleaved into various peptides, depending on the cell, and the environment, including GLP-1 (1-37), a 37 amino acid peptide in its unprocessed form. Generally, this processing occurs in the pancreas and the intestine. The GLP-1 (1-37) sequence can be further proteolytically processed into active GLP-1 (7-37), the 31 amino acid processed form, or GLP-1 (7-36) amide. Accordingly, the designation GLP-1(7-37) designates that the fragment in question comprises the amino acid residues from (and including)
number 7 to (and including) number 37 when counted from the N-terminal end of the parent peptide, GLP-1. The amino acid sequence of GLP-1(7-36)amide and of GLP-1(7-37) is given in formula I (SEQ ID No.: 43): - His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-X (I), which shows GLP-1(7-36)amide, when X is NH2, and GLP-1 (7-37), when X is Gly-OH.
- GLP-1 is a gut hormone and is the most potent endogenous insulinotropic agent with actions that include stimulating adenylate cyclase and protein kinase activity in the beta-cell. Physiologically, together with gastric inhibitory polypeptide from the upper gut, it functions as an incretin hormone lowering the blood glucose level. Accordingly, GLP-1, secreted in response to food intake, has e.g. multiple effects on the stomach, liver, pancreas and brain that work in concert to regulate blood sugar. Conseqently, Glucagon-like peptide GLP-1 (7-36) amide, and its non-amidated analogue GLP-1 (7-37) have attracted considerable interest because of their potent actions on carbohydrate metabolism and its potential applicability to the treatment of diabetes, including
type 2diabetes.Type 2 diabetes is characterized by insulin resistance, since cells do not respond appropriately when insulin is present. This is a more complex problem thantype 1 diabetes.Type 2 diabetes may go unnoticed for years in a patient before diagnosis, since the symptoms are typically milder (no ketoacidosis) and can be sporadic. However, severe complications can result fromunnoticed type 2 diabetes, including renal failure, and coronary heart disease. This leads to increased morbidity and mortality. - GLP-1 (7-36) amide or GLP-1(7-37) is short-lived in serum. The peptide is cleaved by dipeptidyl peptidase IV (DPP-IV) between
8 and 9. The cleaved peptide is inactive. Thus GLP-1, administered exogenously, is extremely short-lived and has limited utility in therapeutic applications.residues - Various attempts have been made to synthesise stabilised (against DPP-IV) analogues of naturally occurring GLP-1 (GLP-1(7-37)). In particular, the 8. residue, which in vivo is Ala, was replaced by another residue, for instance, Gly, Ser or Thr (Burcelin, R., et al. (1999) Metabolism 48, 252-258). The Gly8 or G8 analogue has been extensively tested, both as synthesised molecule, and produced by cell lines genetically engineered to secrete the mutant polypeptide (Burcelin, R., et a1 (1999) Annals of the New York Academy of Sciences 875: 277-285). Various other modifications have been introduced into GLP-1 (7-37) to enhance its in vivo stability without compromising its biological activity. However, all of these approaches did not achieve any significant therapeutic significance due to considerable problems involved.
-
discloses GLP-1 fusion proteins, comprising glucagon-like-1 compounds fused to proteins suitable to extend the in vivo half life of the peptides. Particularly,WO 02/46227 describes a fusion protein of GLP-1 with albumin or immunoglobulin. According toWO 02/46227 such proteins may be used to treat non-insulin dependent diabetes mellitus as well as a variety of other conditions. However,WO 02/46227 does not disclose fusion proteins comprising as component (I) N-terminally GLP-1 (7-35, 7-36 or 7-37) or a derivative thereof and as component (II) C-terminally a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI).WO 02/46227 - Likewise,
US 2003/0221201 discloses fusion proteins of transferrin and GLP-1. Similarly,US 2003/0195154 describes a fusion protein of GLP-1 and transthyretin as fusion partners. However, no further GLP-1 fusion proteins are disclosed or suggested inUS 2003/0221201 orUS 2003/0195154 , particularly no further possible fusion partners for GLP-1, capable of stabilizing GLP-1 in vivo. -
describes a pharmacologically active peptide conjugate comprising a pharmacological active peptide sequence (X), like GLP-1, and a stabilising peptide sequence (Z) of 4 to 20 amino acid residues, which are covalently linked to the pharmacologically active peptide sequence (X). The stabilising peptide sequence (Z) may be e.g. Lysp-Xaaq or Xaap-Lysq sequences, wherein p and q are integers in the range from 1 to 14, with the proviso that p+q is in the range of 3-15, and each Xaa is independently selected from the group consisting of Ser, Thr, Tyr, Asn, Gln, Asp, Glu, Arg, His, Orn, 2,4-diaminobutanoic acid, 2,3-diaminopropanoic acid and Met, particularly short peptide sequences of the formulae Lys3-Glu3 or Glu3-Lys3.WO 99/46283 does not disclose fusion proteins comprising as component (I) N-terminally GLP-1(7-35, 7-36 or 7-37) or a derivative thereof and as component (II) C-terminally a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI).WO 99/46283 -
discloses a GLP-1 peptide coupled with an extended C-terminus that provides increased stability. This extended C-terminus comprises at least 6 amino acids, preferably 7 to 9 amino acids.WO 03/058203 does not disclose GLP-1 fusion proteins comprising a sequence according to SEQ ID NO 26 (AADFPEEVAI) as an extended C-terminus.WO 03/058203 -
US 2004/0146985 describes a GLP-1 (7-37) fusion protein containing multiple copies of the GLP-1 (7-37) peptide for producing this therapeutically agent on a larger scale.US 2004/0146985 does not disclose a GLP-1 (7-37) fusion protein comprising as component (I) N-terminally GLP-1 (7-35, 7-36 or 7-37) or a derivative thereof and as component (II) C-terminally a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI). -
US 5,861,284 discloses fusion peptides of GLP-1 (7-37) and an amino acid sequence derived from the fibroblast growth factor at the C-terminus. The invention ofUS 5,861,284 is particularly directed to the production of cysteine free peptides, produced by a fusion protein comprising a protein having cysteine at its N-terminal end and a cysteine-free peptide ligated to the N-terminal end and subsequently cleaving off the cysteine-free peptide.US 5,861,284 does not disclose fusion peptides of GLP-1 (7-37) and a peptide sequence containing a sequence according to SEQ ID NO 26 (AADFPEEVAI). - A review of Kieffer et al. (Endocrine Reviews (1999) Vol. 20, No. 6, Pages 876-913) and a review of Drucker et al. (Mol. Endocrinol. (2003) Vol. 17, No. 2, pages 161-171) disclose the amino acid sequence of proglucagon wherein in this naturally occurring peptide the GLP-1 peptide, IP-2 and the GLP-2 peptide are fused. No fusion peptides of GLP-1 (7-37, 7-36 or 7-35) are disclosed therein.
- Furthermore, a review from Perry et al. (Current Alzheimer's Research, 2005, 2, 377-385) concerns the relation between the GLP receptor pathway and Alzheimer's disease. No fusion peptides of GLP-1 according to the present invention are disclosed in Perry et al. (2005).
-
discloses various GLP-1 derivatives, particularly a GLP-1 derivative, wherein at least one amino acid of GLP-1 has a lipophilic substituent attached. However,WO 98/08871 does neither disclose GLP-1 fusion peptides of GLP-1 (7-37, 7-36 or 7-35) nor a peptidic extension of the C-terminus of GLP-1.WO 98/08871 -
WO 2005/058958 relates to GLP-1 analogues linked to albumin-like agents. discloses a partial peptide of a preproglucagon peptide comprising at least the amino acid sequence at positions 92-97 of a preproglucagon peptide as an effective ingredient of an antidiabetic drug.EP 1 454 629US 6,858,576 relates to methods for regulating gastrointestinal motility, particularly to the use of exendins and analogs and agosists thereof. However, none of these three documents discloses a fusion peptide consisting of a N-terminal GLP-1/GLP-2 fragment and a C-terminal sequence awarding improved resistance to DPP-IV inactivation and according with an identity of at least 90% to the sequence AADFPEEVAI. - Likewise,
WO 2006/010143 discloses a GLP-1/GLP-2 fusion peptide comprising GLP-1 (7-37) at the N-terminus. Further, it contains an IP-2 fragment. However, D15 does not disclose a fusion peptide comprising as a first component N-terminally a sequence according to formula II or formula III as defined below and as a second component C-terminally a peptide sequence of at least 9 amino acids containing sequence according to the sequence AADFPEEVAI or being of at least 90% identity to such a sequence. - In
discloses a strategy for creating a multimeric GLP-1 expression cassette which can be incorporated into a variety of cell types which are publicly available immortalised cell lines and dividing primary cell cultures. Examples include EGF-responsive neurospheres, bFGF-responsive neural progenitor stem cells from the CNS of mammals, while the worked example uses baby hamster kidney, BHK cells. The implanted transfected cells were said to have been used to treat successfully diabetic mice, allowing glucose control equivalent substantially to non-diabetic controls. However, this techniques does not comply with the requirements of a treatment to be administered routinely to diabetes patients.WO/9953064, Thorens, B.
Another approach to stabilize the glucose level exogeneously is based on a new class of medicines known as incretin mimetics under investigation for the treatment oftype 2 diabetes. Exenatide (Byetta®) is a synthetic version of a natural compound found in the saliva of the Gila monster lizard. In clinical trials, an incretin mimetic (exenatide) has demonstrated reductions in blood sugar and improvements in markers of beta cell function. However, Exenatide exhibits only certain effects of human incretin hormone glucagon-like peptide-1 (GLP-1).
In summary, at present there is noefficient diabetes type 2 therapy available, which allows to lower the blood glucose level on the basis of GLP-1, in other words to provide a therapy which reflects the entire spectrum of beneficial effects known for GLP-1, e.g. its activity in physiological concentrations to powerfully reduce the rate of entry of nutrients into the circulation by a reduction of gastric emptying rate in obese subjects or its insulin stimulating activity. Therefore, it is an object of the present invention to provide GLP-1 based peptide molecules which are biologically active and resistant towards proteolytic degradation. - The present invention relates to a fusion peptide comprising as component (I) N-terminally a sequence according to
- (i) formula II
Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa16-Ser-Xaa18-Xaa19-Xaa20-Glu-Xaa22-Xaa23-Ala-Xaa25-Xaa26-Xaa27-Phe-Ile-Xaa30-Trp-Leu-Xaa33-Xaa34-Xaa35-Xaa36-Xaa37,
wherein Xaa7 is L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, 3-hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa8 is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid, whereby Gly is particularly preferred; Xaa16 is Val or Leu; Xaa18 is Ser, Lys or Arg; Xaa19 is Tyr or Gln; Xaa20 is Leu or Met; Xaa22 is Gly, Glu or Aib; Xaa23 is Gln, Glu, Lys or Arg; Xaa25 is Ala or Val; Xaa26 is Lys, Glu or Arg; Xaa27 is Glu or Leu; Xaa30 is Ala, Glu or Arg; Xaa33 is Val or Lys; Xaa34 is Lys, Glu, Asn or Arg; Xaa35 is Gly or Aib; Xaa36 is Arg, Gly or Lys or amide or absent; Xaa37 is Gly, Ala, Glu, Pro, Lys, amide or is absent,
or - (ii) formula III
Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Xaa18-Tyr-Leu-Glu-Xaa22-Xaa23-Ala-Ala-Xaa26-Glu-Phe-Ile-Xaa30-Trp-Leu-Val-Xaa34-Xaa35-Xaa36-Xaa37,
wherein Xaa7 is L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, -hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa8 is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; Xaa18 is Ser, Lys or Arg; Xaa22 is Gly, Glu or Aib; Xaa23 is Gln, Glu, Lys or Arg; Xaa26 is Lys, Glu or Arg; Xaa30 is Ala, Glu or Arg; Xaa34 is Lys, Glu or Arg; Xaa35 is Gly or Aib; Xaa36 is Arg or Lys, amide or is absent; Xaa37 is Gly, Ala, Glu or Lys, amide or is absent,
or - (iii) GLP-1 (7 - 37) of SEQ ID No. 1 or a functional sequence exerting the biological effects of GLP-1 as incretin hormone, its anti-apoptotic action or its neurotrophic properties and having at least 80% sequence identity with GLP-1 (7 - 37),
- Preferably, the present invention relates to a fusion peptide as defined above, wherein component (I) is GLP-1(7-35) or GLP-1(7-36).
- The present invention is based on the finding that the resulting inventive peptide is protected against the proteolytic degradation in vivo, mainly due to proteolytic endopeptidase IV activity. The inventive peptide having at least two components (I) and_(II) as defined above exhibits. GLP-1's biologically activity and, simultaneously, confers stability to the GLP-1 as its component (I) by a C-terminal elongation.
- The term "inventive peptide" as used herein is a fusion peptide as defined herein, a variant, an analog, a fragment or a derivative thereof, including combinations e.g. a derivatized fragment, analog or variant of a fusion peptide. The term "GLP-1 peptide" as used herein means GLP-1(7-35, 36 or 37), whereas "modified GLP-1 peptide" is intended to mean any GLP-1 analogue, a GLP-1 derivative, a GLP-1 variant or GLP-1 fragment, including a derivatized fragment, analog or variant of GLP-1 (7-35, 36 or 37), which may occur in either component (I) and (III) of the inventive peptide. The term "GLP-2 peptide" as used herein means GLP-2 (1-33, 34, or 35), whereas "modified GLP-2 peptide" is intended to mean any GLP-2 analogue, fragment or variant, a GLP-2 derivative or a derivative of a GLP-2 analogue, including a derivatized fragment, analog or variant of GLP-2(1-33, 34 or 35). Variants, analogs, fragments and derivatives are categorized as modifications of the unmodified sequence, e.g. GLP-1(7-35, 36 or 37) or GLP-2(1-33, 34 or 35). Within the meaning of the present invention any variant, analog, fragment or derivative has to be functional, e.g. has to exert the same or a similar biological effects as the unmodified GLP-1 peptide.
- The inventive peptide is a fusion peptide as defined above or a variant, analog, fragment or derivative thereof, wherein component (I) may contain a sequence having at least 80 %, more preferably at least 85 % and even more preferably at least 90 % sequence identity with SEQ ID No.: 1. SEQ ID No.1 represents the native amino acid sequence of GLP-1(7-37) (length of 31 amino acids), which is strictly conserved among mammalians.
- The second component (component (II)) as defined above of the fusion peptide according to the invention contains a sequence length of at least nine amino acids, which may or may not form a ß-turn like structure. A ß-turn structure is a typical secondary structure element of proteins or peptides. It is typically formed by four amino acids, which revert the direction of the peptide's or protein's backbone chain direction. The amino acid sequence of component (II) contains at least nine amino acids and contains at least one proline or alanine residue in its sequence. Proline residues are common amino acids within the ß turn forming tetrameric amino acid sequence. The proline residue is commonly is typically located at
2 or 3, preferably 2, of the tetrameric ß-turn sequence occurring in component (II) of the fusion peptide.position - An inventive fusion may typically have in its component (II) sequence length of 9 to 30, preferably 9 to 20, and most preferably 9 to 15 amino acids. Generally spoken, shorter sequences in component (II) may be preferred due to their superior binding activity to the GLP receptor over longer sequences. The sequence of component (II), even though it is not a prerequisite, may preferably be neutral or may have a negative charge at pH7.
- A fusion peptide according to the invention is preferred, if its component (II) contains a sequence motif selected from the group consisting of PEEV, DFPE and AADX, wherein X represents any amino acid (naturally occurring or a modified non-natural amino acid). These tetrameric motifs may be located anywhere in the sequence of component (II). In a particularly preferred embodiment, the inventive fusion peptide component (II) is a peptide sequence being linked to the C-terminus of component (I) by its N-terminal sequence motif selected from the group consisting of AA, XA and AX, wherein X represents any amino acid (naturally occurring or a modified non-natural amino acid).
- A preferred motif of component (II) in an inventive fusion peptide contains the sequence motif SEQ ID No.: 25 (DFPEEVA) or contains a sequence having at least 80% sequence homology with the sequence motif DFPEEVA, which corresponds to a partial sequence of human or murine IP-2.
- As defined above, in the inventive fusion peptide component (II) is a peptide sequence containing a sequence according to SEQ ID No.: 26 (AADFPEEVAI) (all peptide sequences given in the one-letter-code) or a sequence having at least 90% sequence identity with SEQ ID No.: 26. SEQ ID No.: 26 is derived from a partial sequence of the full-length (human or murine) JP-2 (intervening peptide 2) sequence, which contains the N-
terminal 10 amino acids of the 15 amino acid long full-lenght JP-2 sequence, by substitution of the N-terminal (RR) residues by (AA). IP-2 is a preferred example of a β-turn containing peptide sequence. Accordingly, other stronger preferred sequences being contained in component (II) are longer partial amino acid sequences of IP-2, such as e.g. SEQ ID No.: 27 (AADFPEEVAIVEEL), SEQ ID No.: 28 (AADFPEEVAIAEEL), SEQ ID No.: 29 (AADFPEEVAIVEELG), and SEQ ID NO.: 30 (AADFPEEVAIAEELG), wherein all sequences mentioned in this paragraph may also be provided with the N-terminal motif (AX) or (XA). More than one copy of a sequence being included into component (II) may be provided, e.g. 2, 3 or even more copies of IP2 or a fragment, variant or analog or derivative of IP2. - Accordingly, an inventive fusion peptide is preferred containing a sequence according to SEQ ID No.: 31 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGAADFPEEVAIAEELG) or SEQ ID No.: 38 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGAADFPEEVAIVEELG) i.e. GLP-1(7-37) linked without any linker sequence via its C-terminus to specific analogs or variants of the IP2 sequence.
- Without being bound to any theory, it is concluded by the inventors of the present invention that the instability of GLP-1 (7-35, 36 or 37), if administered to any patient in need thereof, is due to its unprotected 3-dimensional structure. Proteases may cleave the GLP-1(7-35, 36 or 37) peptide and abolish its physiological activity rapidly in vivo. By linking a peptide sequence to the C-Terminus of GLP-1 (7-35, 36 or 37) its structure gains stability towards enzymatic degradation. Gain in stability appears to be enhanced, if the additional C-terminal peptide sequence (being contained in component (II) of the fusion peptide according to the invention) folds back due to the presence of a β-turn structural element formed by its primary structure and providing rigidity to component (II). However, a ß-turn structure in component (II) of the inventive fusion peptide does not appear to be a prerequisite for stabilizing the GLP-1 sequence of component (I) towards enzymatic degradation. The inventive fusion peptide, by virtue of its C-terminal peptide extension, e.g. containing a ß-turn structural element, is found to have improved resistance to DPP-IV inactivation. The C-terminal peptide is either not cleaved from the GLP-1 (7-35, 36 or 37) sequence prior to acting on its receptor in target cells or it may be cleaved enzymatically to form GLP-1 (7-35, 36 or 37) in vivo. Irrespective of the exact form of the inventive fusion peptide bound at the site of the GLP-1 receptor, an inventive fusion peptide exerts its function as an active insulinotropic compound.
- Peptide sequences, which are considered to be suitable for being contained in component (II) due to a primary structure forming a ß-turn element may readily be identified by adequate e.g. spectroscopic methods, e.g. circular dichroism, or other methods known to the skilled person.
- Component (II) and component (I) may be directly linked or linked via a linker sequence. Preferably, both components are directly linked with each other. In case they are linked via a linker (or spacer), the linker is preferably a peptide linker or an organic linker. A peptide linker typically has a length of 1 to 10 amino acids, preferably 1 to 5, even more preferably 1 to 3 amino acids, in some cases the linker sequence may be even longer comprising 11 to 50 amino acids. A peptide linker may be composed of various amino acid sequences. Preferably, a peptide linker will introduce some structural flexibility between components to be linked. Structural flexibility is achieved e.g. by having a peptide linker containing various glycine or proline residues, preferably at least 30%, more preferably at least 40% and even more preferably at least 60 % proline and glycine residues within the linker sequence. Irrespective of the specific sequence the peptide linker may preferably be immunologically inactive.
- In a preferred embodiment of the present invention, an inventive fusion peptide contains a third component (component (III)) which is either linked to the C-terminus of component (II) and/or to the N-terminus of component (I). Preferably, component (III) is located at the C-terminus of component (II). Irrespective of whether component (III) is linked to N-terminus of component (I) (by its C-terminus) or to the C-terminus of component (II) (by its N-terminus), the coupling may be direct or indirect via a linker sequence. With regard to the linker sequence it is referred to the above disclosure for a linker connecting component (I) and component (II). Generally, component (III) comprises at least four amino acid residues, preferably at least 10 additional amino acid residues, more preferably at least 20, or at least 30. In functional terms, component (III) is provided to further enhance the stability of the inventive fusion peptide. Component (III) is expected not to interfere with the biological function of the inventive fusion peptide which is app. comparable to the biological activity of GLP-1(7-37).
- Preferably, component (III) of the inventive fusion peptide comprises at least 4, preferably at least 10, more preferably at least 20 additional amino acid residues of the N-terminal sequence of an isoform of GLP-2 of any mammalian organism (other naturally occurring variant of GLP-2 among mammalian), e.g. murine or human isoforms as shown in SEQ ID Nos: 4 and 5. GLP-2 occurs in pro-glucagon and is also involved in carbohydrate metabolism. As with the biologically active sequence included in component (I) (GLP-1 peptide), component (III) may also comprise analogs, variants or derivatives of naturally occurring forms of GLP-2. Alternatively, component (III) may also comprise at least 4, preferably at least 10, more preferably at least 20 additional amino acid residues of the N-terminal sequence of GLP-1(7-37), correspondingly including all mammalian isoforms or - as disclosed herein - all functional variants, analogs or derivatives thereof. Generally speaking, component (III) may contain any form of a GLP-1 peptide or a modified GLP-1 peptide, which is disclosed herein as suitable for component (I) of the inventive fusion peptide. In a further alternative, component (III) may also contain chimeric forms of GLP-1 (7-37) and GLP-2. A chimeric form may be produced by coupling GLP-1 (7-37) and GLP-2 (or fragments, analogs, variants or derivatives of both) with each other and by subsequently introducing this chimeric form as component (III) into the inventive fusion peptide. Preferably, the chimeric form is composed of a partial sequence of GLP-1 (7-37) and a partial sequence of GLP-2 linked together. E.g. the chimeric form may include the N-
terminal 5 to 30 amino acids of GLP-1 and the C-terminal 5 to 30 amino acids of GLP-2 or vice versa, e.g 7 or 8 to 22, 23, 24, 25, 26, 27, or 28 of GLP-1 (7-37) and amino acid sequence fromamino acids 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 to e.g. the C-terminus of GLP-2.position - If modifications of naturally occurring forms of GLP-2 or GLP-1 (7-37), respectively, are used as component (III), component (III) preferably contains the sequence of SEQ ID Nos.: 4 or 5 or SEQ ID No.: 1, respectively, or a sequence having at least 80% sequence identity with SEQ ID Nos.: 4 or 5 or SEQ ID No.: 1. Derivatives of these preferred sequences, e.g. due to side chain modifications or peptide backbone modifications etc. (as disclosed herein pertaining to "derivatives"), are also encompassed as component (III) by the present invention.
- In another embodiment, component (III) may contain a plurality of sequences as described above. E.g. component (III) may contain at least two, preferably 2, 3, or 4 copies of GLP-1(7-37) and/or GLP-2 or at least two copies of sequences having at least 80% sequence identity with SEQ ID Nos: 1, 4 or 5. Also component (III) may contain more than copy of a chimeric version of GLP-1 (7-37) or GLP-2, as disclosed above, e.g. eventually forming a combination of chimeric version(s) together with GLP-1(7-37) and/or GLP-2 or its modifications with at least 80 % sequence identity. Within the scope of the present invention are also two or more, preferably two component (III), which may e.g. be (1) linked by its N-terminus to the C-terminus of component (II) and (2) linked by its C-terminus to the N-terminus of component (I) via a linker or directly. If two components (III) are provided, these may be identical or different.
- Accordingly, inventive fusion peptides containing three components (I), (II) and (III) are particularly preferred. Four specific embodiments containing all of these components are selected from a group consisting of: SEQ ID No. 6 (N-GLP-1(7-37)-IP2(murine)-RR-GLP-1(7-37)-C, also designated murine CM1 herein), SEQ ID No. 7 (N-GLP-1(7-37)-IP2(murine)-RR-GLP2-C, also designated murine CM2 herein), SEQ ID No. 10 (N-GLP-1(7-37)-IP2(human)-RR-GLP-1(7-37)-C, also designated human CM1), and SEQ ID No. 11 (N-GLP-1(7-37)-IP2(human)-RR-GLP-2-C), also designated human CM2 herein) or a sequence having at least 80% sequence identity with SEQ ID Nos.: 6, 7, 10, or 11 or a derivative thereof. All
6, 7, 10 and 11 contain an RR-Linker (two arginine residues) at the C-terminus of IP2 (component (II)), which may alternatively also be discarded. Component (I) in each of the embodiments according to SEQ ID Nos:6, 7, 10 or 11 is GLP-1 (7-37), whereas component (III) (in each of these embodiments linked to the C-terminus of component (II)) is either GLP-1 (7-37) or GLP-2.sequences - The inventive fusion peptides may occur in various modified forms. These modified forms are disclosed in the following and described in more detail.
- The term "salts" herein refers to both salts of carboxyl groups and to acid addition salts of amino groups of the fusion peptides described above or analogs, fragments, derivatives or variants thereof. Salts of a carboxyl group may be formed by means known in the art and include inorganic salts, for example, sodium, calcium, ammonium, ferric or zinc salts, and the like, and salts with organic bases as those formed, for example, with amines, such ethanolamine, arginine or lysine, piperidine, procaine and the like. Acid addition salts include, for example, salts with mineral acids, such as, for example, hydrochloric acid or sulfuric acid, and salts with organic acids, such as, for example, acetic acid or oxalic acid. Of course, any such salts must retain the biological activity of the inventive peptides relevant to the present invention, i.e. the ability to reduce the rate of entry of nutrients into the circulation. As disclosed below, the salt peptide forms may be contained in a pharmaceutical formulation.
- A "fragment" of a fusion peptide according to the present invention refers to any subset of the molecules, that is, a shorter peptide which retains the desired biological activity. Fragments may readily be prepared by removing amino acids from either end of the molecule and testing the resultant for its properties as a incretin. Proteases for removing one amino acid at a time from either the N-terminal and/or the C-terminal and of a polypeptide are known, and so determining fragments which retain the desired biological activity involves only routine experimentation. Conclusively, fragments may be due to deletions of amino acids at the peptide termini and/or of amino acids positioned within the peptide sequence.
- <
- Additionally, the inventive fusion peptide which has
anti-diabetes type 2 activity, be it a fusion peptide itself, an analog or variant, salt, functional derivative and/or fragment thereof, can also contain additional amino acid residues flanking the inventive peptide. As long as the resultant molecule retains its resistancy or stability towards proteases and its ability to act as incretin, one can determine whether any such flanking residues affect the basic and novel characteristics of the core peptide, e.g. by its effects on pancreas cells, by routine experimentation. The term "consisting essentially of, when referring to a specified sequence, means that additional flanking residues can be present which do not affect the basic and novel characteristic of the specified inventive peptide. This term does not comprehend substitutions, deletions or additions within the specified sequence. - A "variant" according to the present invention refers to a molecule which is substantially similar to either the entire inventive peptide defined above or a fragment thereof. Variant peptides may be conveniently prepared by direct chemical synthesis of the variant peptide, using methods well known in the art. Of course, such variant of an inventive peptide would have similar anti-diabetic, e.g. insulin stimulating activity as the corresponding naturally-occurring GLP-1 peptide.
- Alternatively, amino acid sequence variants of the fusion peptides defined above can be prepared by mutations in the DNAs which encode the synthesized derivatives. Such variants include, for example, deletions from, or insertions or substitutions of, residues within the amino acid sequence. Any combination of deletion, insertion, and substitution may also be made to arrive at the final construct, provided that the final construct possesses the desired activity. Obviously, the mutations that will be made in the DNA encoding the variant peptide must not alter the reading frame and preferably will not create complementary regions that could produce secondary mRNA structure.
- An "analog" of the fusion peptides defined above, according to the present invention, refers to a non-natural molecule which is substantially similar to either the entire molecule or to an active fragment thereof. Such analog would exhibit the same activity as the corresponding naturally-occurring GLP-1 peptide.
- The types of substitutions which may be made in the inventive fusion peptide, according to the present invention, may be based on analysis of the frequencies of amino acid changes between a homologous protein/peptide of different species. Based upon such analysis, conservative substitutions may be defined herein as exchanges within one of the following five groups:
- I. Small, aliphatic, non-polar or slightly polar residues: Ala, Ser, Thr, Pro, Gly; II. Polar, negatively-charged residues and their amides: Asp, Asn, Glu, Gln; III. Polar, positively-charged residues: His, Arg, Lys; IV. Large, aliphatic non-polar residues: Met, Leu, Ile, Val, Cys ; V. Large aromatic residues: Phe, Try, Trp.
- Within the foregoing groups, the following substitutions are considered to be "highly conservative" : Asp/Glu; His/Arg/Lys; Phe/Tyr/Trp; Met/Leu/Ile/Val. Semi-conservative substitutions are defined to be exchanges between two of groups (I) - (IV) above which are limited to supergroup (A), comprising(I), (II), and(III) above, or to supergroup (B), comprising (IV) and (V) above. Substitutions are not limited to the genetically encoded or even the naturally-occurring amino acids.
- In general, analogs or variants of the inventive fusion peptide may also contain amino acid substitutions, made e.g. with the intention of improving solubility (replacement of hydrophobic amino acids with hydrophilic amino acids). In one embodiment of variants/analogs of the GLP-1 peptide of the inventive fusion peptide (occurring in component (I) and/or (III) of the inventive peptide) the (modified) GLP-1 peptide is characterized by one or more substitution(s) at
7, 8, 11, 12, 16, 22, 23, 24, 25, 27, 30, 33, 34, 35, 36, or 37 of the GLP-1 peptide. As an example for the following nomenclature [Arg34-GLP-1 (7-37)] designates a GLP-1 analogue wherein the naturally occurring lysine at position 34 has been substituted with arginine.positions - Specifically, component (I) and/or (III) of an inventive fusion peptide may comprise variants and analogs of GLP-1(7-35, 36 or 37) including, for example, Gln9-GLP-1 (7-37), D-Gln9-GLP-1(7-37), acetyl-Lys9-GLP-1 (7-37), Thr16-Lys18-GLP-1 (7-37), and Lys18-GLP-1 (7-37), Arg34-GLP-1 (7-37), Lys38-Arg26-GLP-1 (7-38)-OH, Lys36-Arg26-GLP-1 (7-36), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34-Lys38-GLP-1(7-38), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34-Lys38-GLP-1 (7-38), Arg26,34-Lys38-GLP-1 (7-38), Arg26-Lys38-GLP-1(7-38), Arg26-Lys38-GLP-1(7-38), Arg26-Lys38-GLP-1 (7-38), Arg34-Lys38-GLP-1 (7-38), Ala37-Lys38-GLP-1 (7-38), and Lys37-GLP-1 (7-37).
- In another embodiment of the invention the inventive fusion peptide contains as component (I) or (III) a modified GLP-1 peptide comprising the amino acid sequence of the following formula II (SEQ ID No.: 44):
- Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa16-Ser-Xaa18-Xaa19-Xaa20-Glu-Xaa22-Xaa23-Ala-Xaa25-Xaa26-Xaa27-Phe-Ile-Xaa30-Trp-Leu-Xaa33-Xaa34-Xaa35-Xaa36-Xaa37,
- In another embodiment of the invention component (I) and/or (III) of the inventive fusion peptide contains a modified GLP-1 peptide comprising the amino acid sequence of the following formula III (SEQ ID No.: 45):
- Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Xaa18-Tyr-Leu-Glu-Xaa22-Xaa23-Ala-Ala-Xaa26-Glu-Phe-Ile-Xaa30-Trp-Leu-Val-Xaa34-Xaa35-Xaa36-Xaa37,
- In a particular preferred embodiment of the invention component (I) and/or (III) of the inventive fusion peptide contain a (modified) GLP-1 peptide, which is selected from GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)-amide, GLP-1 (7-37) or an variant, analogue or derivative thereof. Also preferred are inventive peptides comprising in their components (I) and/or (III) a modified GLP-1 peptide having a Aib residue in
position 8 or an amino acid residue inposition 7 of said GLP-1 peptide, which is selected from the group consisting of D-histidine, desamino-histidine, 2-amino-histidine, hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine and 4-pyridylalanine. - Examples of production of amino acid substitutions in proteins which can be used for obtaining analogs for use in the present invention include any known method steps, such as presented in
U. S. patents RE 33,653 ;4,959,314 ;4,588,585 and4,737,462, to Mark et al ;5,116,943 to Koths et al ;4,965,195 to Namen et al ; and5,017,691 to Lee, et al , and lysine substituted proteins presented inUS patent 4,904,584 (Shaw et al ). - Preferably, the variant or analog, as defined above and contained in component (I), (II) and/or (III), will have a core sequence, which is the same as that of the "native" sequence, e.g. GLP-1(7-37) or GLP-2 or biologically active fragment thereof or any IP2 isoform, which has an amino acid sequence having at least 80% identity to the native amino acid sequence and retains the biological activity thereof. More preferably, such a sequence has at least 90% identity, or most preferably at least 95% identity to the native sequence. Where a particular peptide is said to have a specific percent identity to a reference polypeptide of a defined length, the percent identity is relative to the reference peptide. Thus, a peptide that is 50% identical to a reference polypeptide that is 100 amino acids long can be a 50 amino acid polypeptide that is completely identical to a 50 amino acid long portion of the reference polypeptide. It might also be a 100 amino acid long polypeptide, which is 50% identical to the reference polypeptide over its entire length. Of course, other polypeptides will meet the same criteria. The term "sequence identity" as used herein means that the sequences are compared as follows. The sequences are aligned using
Version 9 of the Genetic Computing Group's GAP (global alignment program), using the default (BLOSUM62) matrix (values-4 to +11) with a gap open penalty of-12 (for the first null of a gap) and a gap extension penalty of-4 (per each additional consecutive null in the gap). After alignment, percentage identity is calculated by expressing the number of matches as a percentage of the number of amino acids in the claimed sequence. - Derivatives of a fusion peptide or an analog, fragment or variant thereof are also encompassed by the present invention. The term "derivatives" of an inventive fusion peptide is intended to include only those modified inventive peptides that do not change one amino acid to another of the twenty commonly-occurring natural amino acids. Correspondingly, a genetically encoded amino acid may be modified by reacting it with an organic derivatizing agent that is capable of reacting with selected side chains of residues or amino or carboxy groups of terminal residues (preferably by covalent modification) or by introducing non-natural amino acids (manufactured by chemical synthesis, i.e. D-isomers of the amino acids encoded by the genetic code, Aib (a-aminoisobutyric acid), Abu (a-aminobutyric acid), Tie (tert-butylglycine), alanine, 3-aminomethyl benzoic acid, anthranilic acid) or natural amino acids which are not encoded by the genetic code, e.g. hydroxyproline, γ-carboxyglutamate, ornithine, phosphoserine, D-alanine and D-glutamine or by a modification of the peptide backbone by alternative peptide backbone arrangements.
- In the following preferred modifications of amino acids of the inventive fusion peptide (which - as defined above - also comprises variants, analogues or fragments of the fusion peptide) are disclosed, which may occur in an inventive fusion peptide at any site (any amino acid), e.g. positioned in component (I), (II) and/or (III).
- Cysteinyl residues, if present in any form of an inventive fusion peptide, e.g. an analogue of an inventive fusion peptide, most commonly are reacted with alpha-haloacetates (and corresponding amines), such as chloroacetic acid or chloroacetamide, to give carboxylmethyl orcarboxyamidomethyl derivatives. Cysteinyl residues also are derivatized by reaction with bromotrifluoroacetone, alpha-bromo-beta-(5-imidazoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl-2-pyridyl disulfide, p-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, orchloro-7-nitrobenzo-2-oxa-1,3-diazole.
- Histidyl residues in an inventive fusion peptide may be derivatized by reaction with diethylprocarbonate at pH 5.5-7.0 because this agent is relatively specific for the histidyl side chain. Parabromophenacyl bromide is also useful; the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0. In particular, the N-terminal histidine residue (His7) of GLP-1(7-37) as contained in component (I) and/or (III) of the inventive fusion peptide is very important to the insulinotropic activity of GLP-1 peptides as shown by Suzuki et. al. (Diabetes Res.; Clinical Practice 5 (Supp. 1): S30 (1988)). Correspondingly, the inventive fusion peptide may be modified at His7 of its GLP-1 as part of component (I) and/or (III) by alkyl or acyl (C1-C6) groups, or replacement of His with functionally-equivalent C5-C6 ring structures. A preferred modification is the introduction of a hydrophobic moiety at the amino terminus of His7 or its histidyl side chain.
- Lysinyl and amino terminal residues of an inventive fusion peptide may e.g. be reacted with succinic or other carboxylic acid anhydrides. Derivatization with these agents has the effect of reversing the charge of the lysinyl residues. By acyl (C12-C18) modifications of the epsilon-amino group of lysine residue(s) in the inventive fusion peptide, their half-life in circulation is increased. Arginyl residues may e.g. be modified by reaction with one or several conventional reagents, among them phenylglyoxal; and ninhydrin. Derivatization of arginine residues requires that the reaction be performed in alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine, as well as the arginine epsilon-amino group.
- The specific modification of tyrosyl residues per se has been studied extensively. Most commonly, N-acetylimidazole and tetranitromethane may be used to form O-acetyl tyrosyl species and e-nitro derivatives, respectively.
- Carboxyl side groups (aspartyl or glutamyl) may be selectively modified by reaction with carbodiimides (R'N-C-N-R') such as 1-cyclohexyl-3-[2-morpholinyl-(4-ethyl)] carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl)carbodiimide.
- Furthermore, aspartyl and glutamyl residues may be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
- Glutaminyl and asparaginyl residues may be deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues may be deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention. Deamidated inventive fusion peptides may undergo an altered susceptibility to proteolysis with protease or peptidase enzymes, suggesting that deamidation may have physiological significance in directing proteolytic cleavage of an inventive fusion peptide. It is noted that bio-synthetic inventive fusion peptides may degrade under certain storage conditions, resulting in deamidation at one more positions in the inventive peptide. Methionine residues in the inventive peptides may be susceptible to oxidation, primarily to the sulfoxide. As the other derivatives mentioned above, both desamide inventive fusion peptides and/or sulfoxide inventive fusion peptides may be used to exhibit full biological activity.
- Other suitable reagents for derivatizing alpha-amino acid-containing residues include imidoesters such as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methyliosurea; 2,4-pentanedione; and transaminase-catalyzed reaction with glyoxylate.
- The terminal amino acid residues of an inventive fusion peptide with their carboxy (C-terminus) and their amine (N-terminus) groups (as well as carboxy or amide amino acid side chain groups, see above) may be present in their protected (e.g. the C terminus by an amide group) and/or unprotected form, using appropriate amino or carboxyl protecting groups. Also, acid-addition salts of the inventive fusion peptide may be provided. Common acid addition salts are hydrohalic acid salts, i.e., HBr, HI, or more preferably, HCl.
- PEGylation of terminal or side chain carboxyl groups or the epsilon-amino group of lysine occurring in the inventive fusion peptide, confers resistance to oxidation and is also within the scope of the present invention
- Other modifications resulting in derivatives of inventive fusion peptides are based on carbohydrates and/or lipids which may be covalently coupled to the inventive fusion peptide. It is preferred to couple lipids and/or carbohydrates to serine, threonine, asparagine, glutamine or tyrosine or glutamate or aspartate via their reactive side chain moieties. Alternatively, carbohydrates and/or lipids may also be linked to the terminal moieties of the inventive fusion peptide. Furthermore, an inventive fusion peptide may be coupled to a functionally different peptide or protein moiety, which may also stabitize the inventive fusion peptide and/or may serve to improve the transport properties of an inventive fusion peptide in body fluids, in particular blood. Suitable peptides or proteins may e.g. be selected from Albumin, Transferrin etc., which are directly coupled (as component IV) to the inventive fusion peptide or via a peptide or organic linker sequence. Preferably, these peptides or protein are linked to one of the termini of the inventive fusion peptide.
- In order to circumvent the problem of degradation of the inventive fusion peptide another embodiment of the present invention provides a retro-inverso isomer of the inventive fusion peptide composed of D amino acids or at least partially composed of D amino acids. The term "retro-inverso isomer" refers to an isomer of a linear peptide in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see, e.g., Jameson et al., Nature, 368, 744-746 (1994); Brady et al., Nature, 368, 692-693 (1994)). With respect to the parent peptide, the retro-inverso peptide is assembled in reverse order of amino acids, typically with F-moc amino acid derivatives. Typically, the crude peptides may be purified by reversed phase HPLC.
- Other modifications, which may be introduced into the inventive fusion peptides relate to modifications of the peptide backbone. The modified inventive fusion peptides are scaffold mimetics. Their backbone is different from the natural occurring backbone, while their side-chain structures are identical with the inventive fusion peptides or their fragments, variants, derivatives or analogs. In general, scaffold mimetics exhibit a modification of one or more of the backbone chain members (NH, CH, CO), either as substitution (preferably) or as an insertion. Substituents are e.g. (I) -O-, -S-, or -CH2- instead of -NH-; (II) -N-, C-Alkyl-, or -BH- instead of -CHR- and (III) -CDS-, -CH2, -SOn-, -P=O(OH)-, or -B(OH)- instead of - CO-. A peptide mimetic of an inventive fusion peptide may be a combination of each of these modifications. In particular, modifications of each the groups I, II and III may be combined. In a peptide mimetic each backbone chain member may be modified or, alternatively, only a certain number of chain members may be exchanged for a non-naturally occurring moiety. Preferably, all backbone chain members of an inventive fusion peptide of either -NH-, -CHR- or CO are exchanged for another non-naturally occurring group. In case the amide bond of -CO-NH-1 of the inventive peptide backbone is substituted (in the entire molecule or at least in one single position), preferable substitution moieties are bioisosteric, e.g. retro-inverse amide bonds (-NH-CO-), hydroxyl ethylene (-CH(OH)-CH2-), alkene (CH2=CH-), carba (CH2-CH2-) and/or -P=O(OH)-CH2-). Alternatively, back-bone chain elongation by insertions may occur in a scaffold mimetic of the inventive fusion peptide, e.g. by moieties flanking the C-alpha atom. On either side of the C-alpha atom e.g. - O-, -S-, -CH-, -NH- may be inserted.
- Particularly preferred are oligocarbamate peptide backbone structure of the inventive fusion peptides. The amide bond is replaced by a carbamate moiety. The monomeric N-protected amino alkyl carbonates are accessible via the corresponding amino acids or amino alcohols. They are converted into active esters, e.g. p-nitro phenyl ester by using the F-moc moiety or a photo sensitive nitroatryloxycarbonyl group by solid phase synthesis.
- Inventive fusion peptides are protected against proteolytic cleavage as outlined above. They are in particular protected against dipeptidyl aminopeptidase-4 (DPP-IV). The term "DPP-IV protected" as used herein refers to a peptide according to
claim 1. Inventive fusion peptides as well as their derivatives, analogs, fragments and variants render GLP-1(7-35, 36 or 37) as part of component (I) and/or (III) of the inventive fusion peptide resistant to the plasma peptidase (DPP-IV). - Resistance of a peptide to degradation by dipeptidyl aminopeptidase IV is determined e.g. by the following degradation assay: Aliquots of the fusion peptides are incubated at 37 C with an aliquot of purified dipeptidyl aminopeptidase IV for 4-22 hours in an appropriate buffer at pH 7-8 (buffer not being albumin). Enzymatic reactions are terminated by the addition of trifluoroacetic acid, and the peptide degradation products are separated and quantified using HPLC or LC-MS analysis. One method for performing this analysis is: The mixtures are applied onto a Zorbax300SB-C18 (30 nm pores, 5 µm particles) 150 x 2.1 mm column and eluted at a flow rate of 0.5 ml/min with a linear gradient of acetonitrile in 0. 1% trifluoroacetic acid (0%-100% acetonitrile over 30 min). Peptides and their degradation products may be monitored by their absorbance at 214 nm (peptide bonds) or 280 nm (aromatic amino acids), and are quantified by integration of their peak areas. The degradation pattern can be determined by using LC-MS where MS spectra of the separated peak can be determined. Percentage intact/degraded compound at a given time is used for estimation of the peptides DPP-IV stability.
- An inventive fusion peptide is defined as DPP-IV stabilised when it is 10 times more stable than the GLP-1 (7-37) based on percentage intact compound at a given time. Thus, a DPP-IV stabilised inventive fusion peptide is preferably at least 10, more preferably at least 20 times more stable than GLP-1 (7-37) as such. Stability may be assessed by any method known to the skilled person, e.g. by adding DPP-IV to a solution of the fusion peptide to be tested and by determining the degradation of the fusion peptide, e.g. over time, by e.g. a spectroscopic method, Westem-Blot analysis, antibody screening etc. In parallel, an inventive fusion peptide is defined as a compound, which exerts the effect of GLP-1 (7-37) by e.g. binding to its native receptor (GLP-1 receptor). Preferably, an inventive fusion peptide has a binding affinity to the GLP-1 receptor, which corresponds to at least 10%, preferably at least 50% of the binding affinity of the naturally occurring GLP-1 peptide. The binding affinity may be determined by any suitable method, e.g. surface plasmon resonance etc. Moreover, it is preferred, if the inventive peptide evokes formation of intracellular cAMP by its binding to its extracellular receptor, which transmits the signal into the cell.
- The fusion peptides of the invention may be produced synthetically, using solid phase peptide synthesis techniques, similar to the manner of production of GLP-1 (7-36) amide and GLP-1 (7-37) in the art and can be purified afterwards on a laboratory scale e.g. by a single purification step on a reversed-phase HPLC column or suitable chromatography methods.
- However, it is preferably formed in engineered cells, either in microbial cells or in animal cell lines to produce the inventive fusion peptide. The inventive fusion peptide may be isolated from the cells from which it is expressed, for instance using conventional separation techniques. Thus cells may be grown under appropriate conditions, for instance including support and nutrients, in vitro, and secreted protein, i.e. the inventive fusion peptide, is recovered from the extracellular medium. The sequences engineered into cells thus preferably include leader sequences and signal peptide sequences directing secretion of the inventive fusion peptide. The cells preferably express protease capable of cleaving the leader and signal sequences, either endogenously or by engineered gene sequences. In an alternative, the engineered gene sequences encoding an inventive fusion peptide do not include such leader and signal peptide sequences, whereby the intracellularly expressed inventive fusion peptide will not be secreted, and is recovered from cells by processes involving cell lysis. In such methods the coding sequences may include purification tags allowing efficient extraction of the product peptide from the medium, which tags may be cleaved to release isolated inventive fusion peptide.
- The invention further provides a nucleic acid, which codes for the inventive fusion peptide, be it the fusion peptide or a fragment, analog or variant thereof. Any nucleic acid coding for an inventive fusion peptides is encompassed by the present invention. Due to degeneracy of the genetic code a plurality of nucleic acid sequences may code for an inventive fusion peptide. A nucleic acid molecule within the scope of the present invention may also contain the nucleic acid coding for the inventive fusion peptide and, additionally, further (functional) nucleotide sequences. In a preferred embodiment of the present invention such a fusion nucleic acid molecule may code (a) for the entire GLP-1 aa sequence (GLP-1(1-37) or the functional GLP-1(7-35, 36 or 37) sequence, (b) a cleavage sequence at the N-terminus of the GLP-1 sequence according to (a) for any protease, upstream from (b) may code for a leader sequence. In another preferred embodiment, upstream from the nucleic acid sequence coding for (b) the nucleic acid molecule may additionally comprise (c) a sequence coding for a signal peptide. Alternatively, the inventive nucleic acid molecule may have sequence (c) fused upstream from (a) without any sequence coding for a leader sequence (b) in between. Preferably, the leader sequence and signal peptide sequence are heterologous to preproglucagon.
- The invention further provides a vector comprising an inventive nucleic acid (molecule) and other functional components for expression of the inventive nucleic acid (molecule). Typically, the inventive nucleic acid (molecule) will be fused to a promoter sequence and, eventually combined with other regulator sequences, e.g. an enhancer sequence. For replication, the plasmid may contain an origin of replication. In order to select cells transfected with the inventive vector, one or more antibiotic resistance gene(s) (e.g. kanamycin, ampicillin) may be provided in the vector. The vector may be a plasmid that includes bacterial original promoter, and antibiotic resistance genes and origin promoter, and antibiotic resistance genes for replication and expression in mammalian cells. The invention further provides a host cell comprising exogenously introduced DNA of the invention capable of translating the said precursor protein. The host cell may be either a prokaryotic host cell or an eukaryotic host cell, e.g. a mammalian cell. However, the host cell is not a human embryonic stem cell & a human germ cell.
- According to a further aspect of the invention there is provide the use of the inventive fusion peptide for the manufacture of a medicament for the treatment of an animal, preferably a human being, by administration of an inventive peptide comprising components (I) and (II) and eventually component (III). It is also provided corresponding use of such inventive peptides in the manufacture of a product for the treatment or prevention of a disease or condition associated with glucose metabolism. Non-limiting examples of glucose disorder include: diabetes mellitus type I or type II (NIDDM), or insulin resistance, weight disorders and diseases or conditions associated thereto, wherein such weight disorders or associated conditions include obesity, overweight-associated conditions, satiety deregulation, reduced plasma insulin levels, increased blood glucose levels, or reduced pancreatic beta cell mass. Preferably, use of inventive fusion peptides for the manufacture of a medicament for the treatment of
type 2 diabetes (NIDDM) is disclosed herewith. As a consequence, the present invention relates to a use of the inventive peptide e.g. for lowering weight of a subject, for reducing satiety of a subject, for post-prandially increasing plasma insulin levels in a subject, for reducing fasting blood glucose level in a subject, for increasing pancreatic beta cell mass in a subject or for treating diabetes type I or II in a subject. - Patients with other diseases or disorders may be treated by inventive fusion peptides, i.e. fusion peptides or its analogs, fragments, variants or derivatives, as well. Inventive fusion peptides may be used for the preparation of a medicament for the treatment of neurodegenerative disorders and diseases or conditions associated thereto and for the treatment of disorders and diseases or conditions associated to apoptosis. The use of the inventive fusion peptide for treating these disorders results from the following: GLP-1 receptors, which are coupled to the cyclic AMP second messenger pathway, are expressed throughout the brains of rodents and humans. The chemoarchitecture of receptor distribution in the brain does not only correlate with a central role for GLP-1 in the regulation of food intake and response to aversive stress. It was also shown that GLP-1 binding at its GLP-1 receptor exerts neurotrophic properties, and offer protection against glutamate-induced apoptosis and oxidative injury in cultured neuronal cells. Furthermore, GLP-1 was shown to modify processing of the amyloid β-protein precursor in cell culture and dose-dependently reduces amyloid β-peptide levels in the brain in vivo. GLP-1 is therefore also known as regulator of the central nervous system. Inventive fusion peptides mimicking the biological activity of physiologically active GLP-1 have therapeutic relevance to the treatment of e.g. Alzheimer's disease (AD) and other central and peripheral neurodegenerative conditions (e.g. amyotrophic lateral sclerosis (ALS), Alexander disease, Alper's disease, Ataxia telangiectasia, Canavan disease, Cockayne syndrome, Creutzfeldt-Jakob disease, Multiple Sclerosis, Sandhoff disease, Pick's disease, Spinocerebellar Ataxia, Schilder's disease and Parkinson's disease).
- Moreover, it was shown that physiologically active GLP-1 exerts anti-apoptotic action on various cells, e.g. GLP-1 is beneficial to the preservation of mass and function of freshly isolated human islets or other cell types. Insofar, the biologically active inventive fusion peptide may be used to treat disorders, which are caused by cell or tissue apoptosis.
- The use of an inventive fusion peptide may be for the manufacture of a composition which is administered exogenously, and comprises the isolated inventive fusion peptide. The resulting composition may be used as well for the treatment of the above disorders. The disorders disclosed herein may also be treated by inventive host cells, nucleic acid (molecules) or vectors or, rather, inventive host cells, nucleic acid (molecules) or vectors may be used for the preparation of a medicament for the treatment of these disorders.
- Preparation of formulations which contain inventive fusion peptide sequences as active ingredients is generally well understood in the art, as exemplified by
US Patents 4,608,251 ;4,601,903 ;4,599,231 ;4,599,230 ;4,596,792 ; and4,578,770 . fusion Typically, such formulations are prepared as injectables either as liquid solutions or suspensions, preferably containing water (aqueous formulation) or may be emulsified. The term "aqueous formulation" is defined as a formulation comprising at least 50 % w/w water. Likewise, the term "aqueous solution" is defined as a solution comprising at least 50% w/w water, and the term "aqueous suspension" is defined as a suspension comprising at least 50 % w/w water. - For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Liquid pharmaceutical compositions generally include a liquid vehicle such as water. Preferably, the liquid vehicle will include a physiological saline solution, dextrose ethanol or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol or combinations thereof may be included. Further examples are other isotonic vehicles such as Ringer's Injection or Lactated Ringer's Injection.
- If the invention relates to a pharmaceutical formulation comprising an aqueous solution of a compound according to the present invention, and a buffer, wherein said compound is present in a concentration from 0.1 mg/ml or above, and wherein said formulation has a pH from about 2.0 to about 10.0, preferably from about 7.0 to about 8. 5. Preferably, the pH of the formulation is at least 1 pH unit from the isoelectric point of the compound according to the present invention, even more preferable the pH of the formulation is at least 2 pH unit from the isoelectric point of the compound according to the present invention.
- Solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared. The pharmaceutical formulation may be a freeze-dried formulation, whereto the physician or the patient adds solvents and/or diluents prior to use. In other words, the formulation once prepared may not of immediately administered to a subject. Rather, following preparation, it is packaged for storage in a frozen state, or in a dried form for later reconstitution into a liquid form or other form suitable for administration to a subject. In another embodiment the pharmaceutical formulation is a dried formulation (e.g. freeze-dried or spray-dried) ready for use without any prior dissolution. By "dried form" is intended the liquid pharmaceutical composition or formulation is dried either by freeze drying (i.e. lyophilization ; see, for example, Williams and Polli (1984) J. Parenteral Sci. Technol. 38: 48-59), spray drying (see Masters (1991) in Spray-Drying Handbook (5th ed; Longman Scientific and Technical, Essez, U. K. ), pp. 491-676; Broadhead et al. (1992) Drug Devel. Ind. Pharm. 18: 1169-1206; and Mumenthaler et al. (1994) Pharm. Res. 11: 12-20), or air drying (Carpenter and Crowe (1988) Cryobiology 25: 459-470; and Roser (1991) Biopharm. 4: 47-53). Aggregate formation by a polypeptide during storage of a liquid pharmaceutical composition can adversely affect biological activity of that polypeptide, resulting in loss of therapeutic efficacy of the pharmaceutical composition. Furthermore, aggregate formation may cause other problems such as blockage of tubing, membranes, or pumps when the polypeptide-containing pharmaceutical composition is administered using an infusion system.
- It is possible that other ingredients may be present in the peptide pharmaceutical formulation of the present invention. Such additional ingredients may include wetting agents, emulsifiers, antioxidants, bulking agents, pH buffering agents (e.g. phosphate or citrate or maleate buffers), preservatives, surfactants, stabilizers, tonicity modifiers, cheating agents, metal ions, oleaginous vehicles, proteins (e.g. human serum albumin, gelatin or proteins) and/or a zwitterion (e.g. an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine).
- With regard to stabilizers for inventive formulations these may preferably be selected from the group of high molecular weight polymers or low molecular compounds. In a further embodiment of the invention the stabilizer is selected from polyethylene glycol (e.g. PEG 3350), polyvinylalcohol (PVA), polyvinylpyrrolidone, carboxy-hydroxycellulose or derivates thereof (e.g. HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, sulphur-containing substances as monothioglycerol, thioglycolic acid and 2-methylthioethanol, and different salts (e.g. sodium chloride). Each one of these specific stabilizers constitutes an alternative embodiment of the invention. The pharmaceutical compositions may also comprise additional stabilizing agents, which further enhance stability of a therapeutical active polypeptide therein. Stabilizing agents of particular interest to the present invention include, but are not limited to, methionine and EDTA, which protect the polypeptide against methionine oxidation, and a nonionic surfactant, which protects the polypeptide against aggregation associated with freeze-thawing or mechanical shearing.
- With regard to surfactants for inventive formulations these may preferably be selected from a detergent, ethoxylated castor oil, polyglycolyzed glycerides, acetylated monoglycerides, sorbitan fatty acid esters, polyoxypropylene-polyoxyethylene block polymers (e.g. poloxamers such as Pluronic F68, poloxamer 188 and 407, TritonX-100), polyoxyethylene sorbitan fatty acid esters, starshaped PEO, polyoxyethylene and polyethylene derivatives such as alkylated and alkoxylated derivatives (tweens, e.g. Tween-20, Tween-40, Tween-80 and Brij-35), polyoxyethylenehydroxystearate, monoglycerides or ethoxylated derivatives thereof, diglycerides or polyoxyethylene derivatives thereof, alcohols, glycerol, lecitins and phospholipids (e.g. phosphatidyl serine, phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl inositol, diphosphatidyl glycerol and sphingomyelin), derivates of phospholipids (e.g. dipalmitoyl phosphatidic acid) and lysophospholipids (e.g. palmitoyllysophosphatidyl-L-serine and 1-acyl-sn-glycero-3-phosphate esters of ethanolamine, choline, serine or threonine) and alkyl, alkoxyl (alkyl ester), alkoxy (alkyl ether)-derivatives of lysophosphatidyl and phosphatidylcholines, e.g. lauroyl and myristoyl derivatives of lysophosphatidylcholine, dipalmitoylphosphatidylcholine, and modifications of the polar head group, that is cholines, ethanolamines, phosphatidic acid, serines, threonines, glycerol, inositol, and the positively charged DODAC, DOTMA, DCP, BISHOP, lysophosphatidylserine and lysophosphatidylthreonine, and glycerophospholipids (e.g. cephalins), glyceroglycolipids (e.g. galactopyransoide), sphingoglycolipids (e.g. ceramides, gangliosides), dodecylphosphocholine, hen egg lysolecithin, fusidic acid derivatives (e.g. sodium tauro-dihydrofusidate etc.), long-chain fatty acids and salts thereof C6-C12 (e.g. oleic acid and caprylic acid), acylcarnitines and derivatives, N'X-acylated derivatives of lysine, arginine or histidine, or side-chain acylated derivatives of lysine or arginine N-acylated derivatives of dipeptides comprising any combination of lysine, arginine or histidine and a neutral or acidic amino acid, N-acylated derivative of a tripeptide comprising any combination of a neutral amino acid and two charged amino acids, DSS (docusate sodium, CAS registry no [577-11- 7]), docusate calcium, CAS registry no [128-49-4] ), docusate potassium, CAS registry no [7491-09-0]), SDS (sodium dodecyl sulfate or sodium lauryl sulfate), sodium caprylate, cholic acid or derivatives thereof, bile acids and salts thereof and glycine or taurine conjugates, ursodeoxycholic acid, sodium cholate, sodium deoxycholate, sodium taurocholate, sodium glycocholate, N-Hexadecyl-N, N-dimethyl-3-ammonio-1-propanesulfonate, anionic (alkyl-aryl-sulphonates) monovalent surfactants, zwitterionic surfactants (e.g. N-alkyl-N, N-dimethylammonio-1-propanesulfonates, 3-cholamido-1-propyldimethylammonio-1-propane-sulfonate, cationic surfactants (quaternary ammonium bases) (e.g. cetyl-trimethylammonium bromide, cetylpyridinium chloride), non-ionic surfactants (e.g. Dodecyl-D-glucopyranoside), poloxamines (e.g. Tetronic's), which are tetrafunctional block copolymers derived from sequential addition of propylene oxide and ethylene oxide to ethylenediamine, or the surfactant may be selected from the group of imidazoline derivatives, or mixtures thereof. Each one of these specific surfactants constitutes an alternative embodiment of the invention. The use of a surfactant in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
- With regard to pharmaceutically acceptable preservative these may preferably be selected from the group consisting of phenol, o-cresol, m-cresol, p-cresol, methyl p-hydroxybenzoate, propyl p-hydroxybenzoate, 2-phenoxyethanol, butyl p-hydroxybenzoate, 2-phenylethanol, benzyl alcohol, ethanol, chlorobutanol, and thiomerosal, bronopol, benzoic acid, imidurea, chlorohexidine, sodium dehydroacetate,chlorocresol, ethyl p-hydroxybenzoate, benzethonium chloride, chlorphenesine (3p-chlorphenoxypropane-1,2-diol) or mixtures thereof.
- With regard to isotonic agents these may preferably be selected from the group consisting of a salt (e.g. sodium chloride), a sugar or sugar alcohol, an amino acid (e.g. L-glycine, L-histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine), an alditol (e.g. glycerol (glycerine), 1,2-propanediol (propyleneglycol), 1,3-propanediol, 1,3-butanediol) polyethyleneglycol (e.g. PEG400), or mixtures thereof. Any sugar such as mono-, di-, or polysaccharides, or water-solubleglucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, soluble starch, hydroxyethyl starch and carboxymethylcellulose-Na may be used. In one embodiment the sugar additive is sucrose. Sugar alcohol is defined as a C4-C8 hydrocarbon having at least one -OH group and includes, for example, mannitol, sorbitol, inositol, galacititol, dulcitol, xylitol, and arabitol. In one embodiment the sugar alcohol additive is mannitol. The sugars or sugar alcohols mentioned above may be used individually or in combination. There is no fixed limit to the amount used, as long as the sugar or sugar alcohol is soluble in the liquid preparation and does not adversely effect the stabilizing effects achieved using the methods of the invention.
- With regard to cheating agents these may preferably be selected from salts of ethylenediaminetetraacetic acid (EDTA), citric acid, and aspartic acid, and mixtures thereof.
- With regard to buffers these are preferably selected from the group consisting of sodium acetate, sodium carbonate, citrate, glycylglycine, histidine, glycine, lysine, arginine, sodium dihydrogen phosphate, disodium hydrogen phosphate, sodium phosphate, and tris(hydroxymethyl)-aminomethane, hepes, bicine, tricine, malic acid, succinate, maleic acid, fumaric acid, tartaric acid, aspartic acid or mixtures thereof. Each one of these specific buffers constitutes an alternative embodiment of the invention.
- The use of all of the afore-mentioned additives in pharmaceutical compositions containing the inventive fusion peptide is well-known to the skilled person, in particular with regard to concentration ranges of the same. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
- The formulations containing the inventive fusion peptide are conventionally administered parenterally, by injection, for example, either subcutaneously, intradermally, subdermally or intramuscularly. A composition for parenteral administration of the inventive peptide may, for example, be prepared as described in
.WO 03/002136 - Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral, buccal, sublinqual, intraperitoneal, intravaginal, anal and intracranial formulations. For suppositories, traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 12%. Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10-95% of active ingredient, preferably 25-70%.
- As mentioned above, additional pharmaceutical methods may be employed to control the duration of action. Controlled release preparations may be achieved by the use of polymers to complex or absorb a fusion peptide of the present invention. The controlled delivery of the active ingredient (fusion peptide) may be exercised by selecting appropriate macromolecules (for example, polyesters, polyamino acids, polyvinylpyrrolidone, ethylene vinylacetate copolymers, methylcellulose, carboxymethylcellulose, and protamine sulfate), the concentration of the macromolecules as well as the methods of incorporation. Such teachings are disclosed in Remington's Pharmaceutical Sciences (see above). Another possible method to control the duration of action by controlled release preparations, is to incorporate a peptide of the present invention into particles of a polymeric material such as polyesters, polyamino acids, hydrogels, poly(lactic acid) or ethylene vinylacetate copolymers.
- The inventive fusion peptides may be formulated as neutral or salt forms. A peptide of the present invention may be sufficiently acidic or sufficiently basic to react with any of a number of organic and inorganic bases, and organic and inorganic acids, to form an (addition) salt, e.g. formed with the free amino groups of the peptide. Acids commonly employed to form acid addition salts are inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, phosphoric acid, and the like, and organic acids such tartaric, asp-toluenesulfonic acid, methanesulfonic acid, oxalic acid, mandelic, p-bromophenyl-sulfonic acid, carbonic acid, succinic acid, citric acid, benzoic acid. Examples of such salts include sulfate, pyrosulfate, bisulfate, sulfite, bisulfite, phosphate, monohydrogenphosphate, dihydrogenphosphate, metaphosphate, pyrophosphate, chloride, bromide, iodide, acetate, propionate, decanoate, caprylate, acrylate, formate, isobutyrate, caproate, heptanoate, propiolate, oxalate, malonate, succinate, suberate, sebacate, fumarate, maleat, butyne-1,4-dioate, hexyne-1,6-dioate, benzoate, chlorobenzoate, methylbenzoate, dinitrobenzoate, hydroxybenzoate, methoxybenzoate, phthalate, sulfonate, xylenesulfonate, phenylacetate, phenylpropionate, phenylbutyrate, citrate, lactate, gamma-hydroxybutyrate, glycolat, tartrate, methanesulfonate, propanesulfonate, Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like. Acid addition salts, carboxylate salts, lower alkyl esters, and amides of the inventive peptides may be formulated according to
);WO 91/11457 (1991 ); andEP 0 733 644 (1996U.S. 5,512,549 (1996 ). - Formulations containing the inventive fusion peptide sequences are to be administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective. The quantity to be administered depends on the subject to be treated, including, e.g., the severity of the patient's disease. Suitable dosage ranges are e.g. of the order of several hundred micrograms active ingredient per therapeutic dose with a preferred range from about 0.1 µg to 2000 µg (even though higher amounts in the 1-10 mg range are contemplated), such as in the range from about 0.5 µg to 1000 µg, preferably in the range from 1 µg to 500 µg and especially in the range from about 10 µg to 100 µg. Formulations containing the inventive fusion peptides plus e.g. additional excipients, e.g., glycine and mannitol or other additives, may be marketed in a lyophilized form as vials. A companion diluent vial is provided, allowing the patient to reconstitute the product to the desired concentration prior to administration of the dose. Inventive formulations can also be marketed in other well known manners, such as prefilled syringes, etc.
- The invention is illustrated further in the accompanying examples.
- The coding sequence for GLP-1(7-37) cDNA was synthesised synthetically, in a sequence including HincII and EcoRI sites as indicated in
Fig. 1a . Separately the cDNA illustrated inFig. 1b was synthesised, including the coding sequences for GLP-1(7-37), IP2 and restriction sites for Sfol, EcoRI and Xbal, as illustrated inFig. 1b . To direct GLP-1 to the secretory pathway, the heterologous signal sequence of stromelysin 3 (Acc.No. NM_005940) was used. Therefore the cDNA, encoding stromelysin signal and leader sequence was reverse transcriptase PCR amplified from human RNA, and used with the construct ofFig. 1 a orFig. 1b to form the construct shown inFig. 1c and Fig. 1d , respectively. - The HincII/EcoRI fragment of the
Fig. 1 a construct is cloned into the Sfol site of the sequence ofFig. 1d to form the constructFig. 1e . Similarly, the EcoRI fragment ofFig. 1d is cloned into the EcoRI site of an eukaryotic expression plasmid, to produce the construct shown inFig. 1f . To form the construct shown inFig. 1g , the HincII/XbaI fragment of the construct shown inFig. 1b is repetitively cloned into the SfoI/XbaI site of the construct shown inFig. 1d. Figure 1h shows a synthesized, codon optimized sequence encoding the stromelysin leader and signal sequences interrupted by a shortened endogenous intron sequence, fused to sequences encoding human GLP-1 (7-37), IP2 and GLP-2(1-35). The DNA sequence of the constructFig. 1h is SEQ ID No.:16, while SEQ ID No.:15 also shows the sequence of the translated peptide. - Also synthesised are the sequences in
Figs 1i and 1j . These are then used to form the construct inFig. 1k , by cloning the NaeI/BssHII fragment ofFig. 1j into the NaeI/BssHII linearised sequence ofFig. 1h . The DNA sequence of the constructFig. 1k is SEQ ID No.: 14, while SEQ ID No.:13 also shows the sequence of the translated peptide. The construct ofFig. 1l is formed by BssHII digest and religation of the sequence ofFig. 1h . The DNA sequence of the constructFig. 1l is SEQ ID No.: 18, while SEQ ID No.:17 also shows the sequence of the translated peptide. The construct ofFig. 1m is formed by cloning the AfeI/BssHII fragment of the sequence ofFig. 1i into the AfeI/BssHII linearised sequence ofFig. 1h . The DNA sequence of the constructFig. 1m is SEQ ID No.: 20, while SEQ ID No.: 19 also shows the sequence of the translated peptide. - The above constructs may be made by a person skilled in the art using routine techniques.
- Source of the cells: HEK293 (human embryonic kidney cell line, # ACC 305, DSMZ Cell Culture Collection, Germany), AtT20 (Mouse LAF1 pituitary gland tumor cell line, #87021902, European Cell Culture Collection, UK), hTERT-MSC cells are generated by Prof. Kassem, University Hospital of Odense, Denmark.
- For transfection of 106
cells 0,5-2 µg plasmid DNA with different GLP-1 constructs was used. The constructs were generated as described in Example 1. HEK293 cells were transfected by standard calcium phosphate co-precipitation method as described in Current Protocols in Molecular Biology (Ausubel et al. 1994ff Harvard Medical School Vol2., Unit 9.1). AtT20 cells were transfected using FuGene (Roche) as described in current Protocols in Molecular Biology (Ausubel et. al. 1994ff, Harvard Medical School Vol 2., Unit 9.4). Transfection of hTERT-MSC cells was performed using the Nucleofector technology (Amaxa), a non-viral method which is based on the combination of electrical parameters and cell-type specific solutions. Using the Nucleofector device (program C17) and the Nucleofector solution VPE-1001 transfection efficiencies >60% have been achieved. 48 hours after transfection selection of cell clones with stable integration of DNA into the chromosome was performed by adding the selective agent blasticidin (2 µg/ml) into the culture medium. 12-15 days later, stable transfected cell clones could be isolated and expanded for characterisation. - Transient expression of different GLP-1 constructs was measured in hTERT-MSC and HEK293 cells. Whereas only marginal active GLP-1 level can be found in the monomeric GLP-1 constructs #103 and #317 (having just one copy of GLP-1 (7-37) an enormous gain in expression can be found in the dimeric GLP-1 construct #217 (having GLP-1(7-37) as component (I) and as component (III)) both in hTERT-MSC and in HEK293 cells. Results are summarized in
Figure 2 . An elongation of the construct to the GLP-1 construct #159 (having four IP2 copies as component (II)) results in no further significant increase (not shown). After transfection of hTERT-MSC cells with different constructs clones were selected, which stably express GLP-1. The expression levels are shown in Table 1 .Table 1 construct cell clone active GLP per 106 cells and hour [pmol] #103 - GLP 1 (7-37)49TM 113/13 0,4 #317 -GLP 1(7-37)-IP2-11aa 71TM169/1 0,3 #217 -GLP1(7-37)-IP2-GLP1(7- 79TM217/13 2,7 - Cell culture supernatant from GLP-1 secreting cells was separated in a 10%-20% gradient SDS PAGE (120V, 90 minutes) and transferred to a PVDF membrane (Immobilon-
0,45 µm Millipore IPVH 00010) by semi-dry blotting (2.0 mA/cm2, 60 minutes). After methanol fixation and blocking (3% (w:v) BSA, 0.1% (v:v) Tween-20 in TBS) the membrane was immunoblotted with 1 µg/ml anti-GLP-1 antibody (HYB 147-12, Antibodyshop) at 4°C o/n. After washing and incubation with 0.02 µg/ml detection antibody (Anti Mouse IgG, HRP conjugated, Perkin Elmer PC 2855-1197) at RT for 4 hours, chemiluminescence detection reveals the location of the protein.P Membrane - Western Blot Analysis is shown in
Figure 3 (1: 100 ng synthetic GLP-1(7-37) dissolved in supernatant of mock transfected hTERT-MSC cells, 2: supernatant of hTERT-MSC cells (clone 79TM217/13) secreting dimeric GLP-1 fromconstruct # 217, 3: supernatant of AtT20 cells (clone 81-A-217/3) secreting dimeric GLP-1 fromconstruct # 217; M: prestained protein marker [kDa]). The results show that inventive peptides containing GLP-1(7-37) and a C-terminal appendix (2 and 3 inFig. 3 ) are secreted from the transfected cell lines and can be detected using an anti-GLP-1 antibody, which binds to the mid-molecular epitopes of GLP-1 (7-37). - HEK293 and hTERT-MSC cells were transiently transfected with constructs, encoding the heterologous stromelysin signal sequence, which is linked to GLP-1 variants encoding the following peptides:
- 1: GLP-1 (7-37)
- 2: GLP-1 (7-37)-IP2-extended with 11 AA
- 3: GLP1(7-37)-IP2-GLP1(7-37)
- The results are shown in
Figures 4 (HEK293 cells) and 5 (hTERT-MSC cells). HEK293 and hTERT-MSC cells are both effective hosts for the gene construct. The numbering of the results for the transfected cells oftypes 1 to 3 is as with Example 3 (1: 100 ng synthetic GLP-1 (7-37) dissolved in supernatant of mock transfected hTERT-MSC cells, 2: supernatant of hTERT-MSC cells (clone 79TM217/13) secreting dimeric GLP-1 fromconstruct # 217, 3: supernatant of AtT20 cells (clone 81-A-217/3) secreting dimeric GLP-1 from construct #217). Whileconstruct 1 produces wild type GLP-1 which is inactivated by DPP-IV in a similar way to synthetic GLP-1, the inventive C-terminally elongated GLP-1 forms (2 and 3 inFigure 4 ,3 inFigure 5 ) are more resistant to degradation and maintain at least 40% activity. The C-terminal extended GLP-1 peptides are significantly stabilised in human plasma in vitro. The peptide with the dimeric GLP-1 sequence (3) is nearly fully stabilised to DPP-IV degradation in vitro. - Various GLP-1 peptides not according to the claims were produced synthetically by solid phase (syn) or recombinant using E.coli (rec). GLP-1 peptides (31 ng SEQ ID No:1 and 10 ng of each SEQ ID No:6, SEQ ID No:7, SEQ ID No:8) were separated in a 10%-20% gradient SDS PAGE (120V, 90minutes) and transferred to a PVDF membrane (Immobilon-
0,45 µm Millipore IPVH 00010) by semi-dry blotting (2.0 mA/cm2, 60 minutes). After methanol fixation and blocking (3% (w:v) BSA, 0.1% (v:v) Tween-20 in TBS) the membrane was immunoblotted with 1 µg/ml anti-GLP-1 antibody (HYB 147-12, Antibodyshop) at 4°C o/n. After washing and incubation with 0.02 µg/ml detection antibody (Anti Mouse IgG, HRP conjugated, Perkin Elmer PC 2855-1197) at RT for 4 hours, chemiluminescence detection reveals the location of the protein.P Membran Fig. 6 shows a Western Blot for the peptides indicated. The following values can be given: SEQ ID No.: 1 (ID1syn) corresponds to GLP-1(7-37), 31 aa, 3,3 kD; SEQ ID No.:8 (ID8 syn, CM3) corresponds to GLP-1(7-37)-IP2, 46 aa, 5,1 kD; SEQ ID No.: 7 (ID7rec, CM2) corresponds to GLP-1(7-37)-IP2-RR-GLP2, 83 aa, 9,4 kD; SEQ ID No.: 6 (ID6syn, CM1) corresponds to GLP-1(7-37)-IP2-RR-GLP1(7-37), 79 aa, 8,7 kD. - Synthetic GLP-1 peptides (not according to the claims) (SEQ ID No:1syn, SEQ ID No:6syn, SEQ ID No:7rec, SEQ ID No:8syn) were incubated at concentrations of 20 ng/ml with human plasma at 37°C and 5% CO2 for 3 hours. Dipeptidylpeptidase activity of the plasma was inhibited by an DPP-IV inhibitor (#DPP4, Biotrend). Active GLP was measured using the GLP-1 (Active) ELISA (#EGLP-35K, Biotrend).
- In contrast to the native GLP-1(7-37) (SEQ ID No:1) the inventive C-terminal elongated GLP-1 peptides SEQ ID No:6, SEQ ID No:7, and SEQ ID No:8 are significantly stabilized in human plasma in vitro (
Fig. 7 ). As control (on the right hand side) the results obtained for experiments with addition of DPP-IV are shown. GLP-1 activity is completely maintained in these control experiments. - RIN-5F cells (rat islet cell tumor; ECACC No. 95090402) were grown in 24-well plates for 4 days reaching 70% confluence. Cells were washed twice with DMEM (E15-009, PAA) before addition of 0.5 ml DMEM (E15-009, PAA) supplemented with 1% HSA (Aventis), 0.2 mM IBMX (858455, Sigma) and the test peptides. After a 20 minute incubation at 25°C, cells were washed twice with ice cold PBS. Cellular cAMP was extracted by addition of 0.1N HCl containing 0.5% Triton X-100. Cyclic AMP was quantified using the cAMP (low pH) EIA (Cat. DE0355, R&D). For
stimulation 3*10-8 M SEQ ID No:1, SEQ ID No:6syn, SEQ ID No:6rec, SEQ ID No:7rec, SEQ ID No:8syn (not according to the claims) have been used. - Results are shown in
Fig. 8 . 100% cAMP production corresponds to the basal production in the absence of GLP-1. GLP-1 binds to G protein-coupled receptors and stimulates cAMP production. All molecules tested increase the cellular cAMP production. - 11-week-old type II diabetic mice (C57BL/Ks-Leprdb/db, Harlan) were treated with 5 µg peptide by subcutaneous injection twice a day at 9 a.m. and 5 p.m. (n=5 per group). Blood glucose was measured before (day 0) and after treatment with GLPCM peptides (
2, 4, 7, 10) at 10 a.m. after an overnight fastening period. Data were presented in relation to blood glucose levels measured atDay day 0. - All fusion peptides tested (SEQ ID No.:6 (synthetic or recombinant) and SEQ ID No.:7 (synthetic or recombinant) (not according to the claims) have an anti-hyperglycemia effect. Best results were obtained with recombinant SEQ ID No.:6 (CM1) and synthetic SEQ ID No.:8 (CM3). In
Fig. 9 (y-axis) the relative effect of the treatment is shown. Blood glucose at day = 0 was set to 1. Untreated animals undergo continuous increase in blood glucose level over time, whereas animals treated with inventive peptides display grosso modo a continuous decrease of the blood glucose level over time. - Aliquots of 1 µM peptide in incubation buffer (50mM Triethanolamin-HCl (
pH 7,8), 0.2% HSA) from CM3, Alanin substituted CM3 analogs (CM3-ANA01, CM3-ANA02, CM3-ANA03, CM3-ANA04), C-terminally shortened CM3 analogs (CM3-ANA06, CM3-ANA07) or C-terminally elongated CM3 analogs (CM3-ANA09) were incubated with 10% human plasma at 37°C and 5% CO2 for 0, 3, 6 and 9 hours. Dipeptidylpeptidase activity was stopped by addition of DPPIV inhibitor (#DPP, Biotrend) and active GLP-1 levels determined using the GLP-1 (active) ELISA (#EGLP-35K, Linco). Results are from triplicates in at least two independent experiments. - fusion peptides having at least nine amino acids added to the C-terminus of GLP-1 are CM3 (murine, GLP-1(7-37)-IP2) and derivatives thereof with modified sequences in component (II) (IP2), i.e. CM3, CM3-ANA01, CM3-ANA02, CM3-ANA03, CM3-ANA04, CM3-ANA05, CM3-ANA07, CM3-ANA07 (therein CM3, CM3-AVA02, CM3-AVA03, CM3-ANA04, CM3-ANA05 and CM3-ANA07 not according to the claims). Peptides LP-1 and CM3-ANA06 reflect control or reference substances.
-
Fig. 10 shows the active portion of active GLP-1 as a % of the 0h value (0h = 100%). It is clearly seen that GLP-1 has the worst plasma stability with only 9% left after 9h plasma exposure. CM3-ANA01 shows the best stability values with 84% material left after 9h. Inventive fusion peptides have a remainder of at least 30% after 9h, whereas peptides with shorter extensions do not reach these values. From the kinetics, a time can be determined, which is needed to degrade active GLP-1 to 80% of the 0h value (DT80: 80% degradation time) for the substances tested. -
- The inventive fusion peptides show a considerably longer in vitro plasma stability as compared to the reference substances. Without being bound to any theory, the C-terminal elongation of GLP-1 introduces a steric hindrance, preventing these analogs to enter the active site of the DPPIV, and thus escape degradation, whereas shorter reference substances do not show this protecting effect for GLP-1 stability. This hypothesis is supported by the continuously increasing stability of cumulative C-terminal elongations of the peptides CM3-ANA06 (36aa), CM3-ANA07 (40aa) and CM3 (46aa). Nevertheless this phenomenon is not only dependent on the pure number of amino acids, which has been shown by Alanin substitutions in the IP2 region of CM3. The CM3-ANA03 peptide, which has the same number of amino acids like CM3, has a strongly reduced stability compared to CM3. On the other hand CM3-ANA01, which also consists of 46 amino acids, has a higher plasma stability than CM3. This may indicate that beside the number of amino acids, additional steric effects may influence the stability. Particularly preferred are fusion peptides having an elongation comprising IP2 at the C-terminus of GLP-1 or an elongation having a certain degree of homology with IP2, which may result from a specific conformation, which hinders the N-terminal region from entering the active site of DPPIV.
- To elucidate potential immunogenicity of test substance CM1 a mouse study was performed at Parabioscience (Groningen, Germany). The trial was done in BALB/c mice receiving 5 repeated injections (70µg peptide / dose, i.v.) over 22d (n=5).
- CM1syn induced no toxicity and only a minimal T-cell antibody response and antibody titer as shown in the following figure. An immunologic effect of by-products (purity of the peptide only 95%) cannot be excluded.
Fig. 11 shows studies for evaluation of potential immunogenic effects of CM1syn. On the left hand side (Fig. 11A ), results of a T-cell recall response assay are shown. Spleens of the treated and control mice were explanted, T-cells isolated and stimulated with increasing amounts of antigene. Proliferative recall response is measured. On the right hand side (Fig. 11 B) , the antigen specific IgG antibody titer in the immune sera of the animals was determined. - After a two-hour fastening period diabetic C57BL/KsJ@Rj-db (db/db) mice were treated with five different concentrations of GLP-1, CM1, CM3, CM3-ANA01 and exendin-4. A sixth group was treated with saline only. 7 animals were treated per group. Blood glucose was determined from tail bleeds directly before, 1 hour and 4 hours after injection.
- The results are shown in dose-response curves according to
Fig. 12 (Fig. 10A (GLP-1),Fig. 12B (CM1),Fig. 12C (CM3) andFig. 12D (CM3-ANA01)). For every test substance a graph was prepared with the percentage difference of the blood glucose in relation to the start value for the different concentrations. The ED50 value for the different test substances was determined by preparing a dose response curve with the values of the 1h measurements as a percentage reduction in comparison to the basal value. To evaluate the ED50 value for GLP-1, CM3-ANA01, CM3rec and Exendin-4 the Morgan-Mercer-Flodin (MMF) model was used, for CM1 the Richards model was used. Both models are sigmoidal fit models suitable for dose response evaluation. For every peptide the plasma glucose ED50 values (single s.c. dose in µg / mouse) have been determined from the percentage decrease of blood glucose. They are summarized in table 1.Table 1: Peptide ED50 [µg/mouse] GLP-1(7-37) 12,76 CM1 0,61 CM3 0,25 CM3- ANA01 0,55 exendin-4 0,03 - Deduced from the ED50 values, the GLP-1 analogs CM1, CM3 and CM3-ANA01 reveal a more than 20fold better in vivo bioactivity, which is most likely a result of the enhanced plasma stability.
- All peptides tested lead to a significant decrease of blood glucose levels in hyperglycaemic db/db mice at least for the highest concentrations. The fall in plasma glucose after a single s.c. injection of 1.1 - 3.0 nmol peptide (versus control) is summarized in table 2. Table 2 exhibits the glucose lowering effects of the test substances (versus control). The fall in plasma glucose and the corresponding significance levels are given for the
time period 1 hour (@1h) and 4 hours (@4h) after peptide injection. Differences have been observed in the long-term efficacy of the peptides. Only exendin-4 and CM3 revealed a significant decrease of the blood glucose levels after 4 hours.Table 2: Peptide concentration fall in plasma glucose p value (independent t-test) GLP-1(7-37) 3.0nmol 15%±24%@1h not significant 3.0nmol 0%@4h not significant CM1 1.1 nmol 50%±14%@1h p < 0.0001 1.1 nmol 0%@4h not significant CM3 2.0nmol 46%±6%@1h p < 0.01 2.0nmol 21%±10%@4h p < 0.05 CM3-ANA01 2.0nmol 62%±12%@1h p < 0.001 2.0nmol 18%±11%@4h not significant exendin-4 2.4nmol 32% ± 14%@1h p<0.01 2.4nmol 129% ± 9%@4h p < 0.01 - Four groups with n=12 C57BUKsJ@Rj-db (db/db) mice have been investigated:
- Group A
- treatment with vehicle (0.9% saline) once daily
- Group B
- treatment with 24nmol/kg test substance 1: CM1rec once daily
- Group C
- treatment with 24nmol/kg test substance 2: CM3-ANA01 once daily
- Group D
- treatment with 24nmol/kg reference substance exendin-4 (known in the art and approved (however, exendin-4 is not an GLP-1 analog)) once daily
- Peptides or vehicle will be given once daily (group A-D) between 2°° - 3°°p.m. subcutaneously in the skin fold of the back. The regimen was continued for 18 weeks. From
week 12 to 18 treatment was done twice a day in 6 of 12 animals per group. - Various parameters of the mice were investigated, i.e. health status (1), body weight (2), food consumption (3), blood glucose (4), glucose tolerance test (5), insulin data (6), glycosylated hemoglobin (7), pathology (8), and restimulation of T cells (9).
- Health status (1) was good in all groups, no side effects of the treatment have been seen.
- Body weight (2) was lower in all treated groups after 18 weeks of treatment (
Fig. 13 ). Relative body weight increase is significantly lower in the CM3-ANA01 group.Fig. 13A shows the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the body weight of db/db mice. The mean values of 12 animals per group are plotted.Fig. 13B shows the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the body weight of db/db mice. The relative body weight increase of 12 animals per group after a treatment of 122 days is plotted. Only the treatment with test substance CM3-ANA01 (group B) revealed a significantly lower weight increase (p<0.001). - Food consumption (3) was significantly lower in the CM1 and CM3-ANA01 group compared to the control.
Fig. 14 shows the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the weekly food consumption of db/db mice during a 122 day treatment period. The relative food consumption per mouse is significantly decreased in group B and C (p<0.001). - Blood glucose (4) levels were determined in a variety of situations. Non-fasted blood glucose level (1 hour after peptide injection) is shown in
Fig. 15A , i.e. the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the non-fasted blood glucose levels. Blood glucose was measured from atail bleed 1 hour after s.c. injection of saline (A) or the peptides CM1 (B), CM3-ANA01 (C) or exendin (D) in a concentration of 24nmol/kg. Compared to control non fastedblood glucose level 1h after s.c. peptide injection is reduced to 55% in group B, 51% in group C and 60% in group D (Fig. 15B ). The blood glucose drecrease in the treated groups treated groups is highly significant (p < 0.0001). - Fasted blood glucose level (18 hours after peptide injection) are shown in
Fig. 15C , i.e. the effect of a treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) on the fasted blood glucose levels. Blood glucose was measured from a tail bleed after a 12-hour overnight fast 18 hours after s.c. injection of the test substances. Fasted blood glucose level 18h after peptide injection is reduced in the CM1 and CM3-ANA01 group. - An i.p. glucose tolerance test (5) (IPGTT) was conducted after 8 weeks of treatment on mice of the groups A-D. The basal blood glucose value (0 min) of 12 hour fasted animals has been determined by tail bleed followed by an s.c. injection of the test substance and an i.p. injection of 20% glucose solution (1g glucose per kg). Blood glucose has been further on determined 15, 30, 45, 60, 90 and 120 minutes after glucose injection. A significant normalization of glucose tolerance was shown in all treated groups (
Fig. 16A ). InFig. 16A absolute blood glucose levels during an i.p. glucose tolerance test (IPGTT) after 8 weeks of treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) is shown (mean values of each group (n=12)). - Another presentation of the data presented by
Fig. 16A of the blood glucose tolerance test is given inFig. 16B . Relative blood glucose levels during an i.p. glucose tolerance test (IPGTT) after 8 weeks of treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D) normalized on the starting blood glucose level (100%). - Insulin levels (6) were determined from mice after a 12 hour overnight fastening period. After 18 weeks of treatment, all mice of the treated groups produce significantly more insulin than the non-treated control.
Fig. 17 presents the data for serum insulin levels in mice after 18 week treatment with 0.9% saline (Group A), CM1 peptide (group B), CM3-ANA01 peptide (group C) or exendin-4 (group D). Directly after sampling blood samples have been treated with a protease inhibitor cocktail to avoid insulin degradation. The serum was analysed for insulin with the Insulin Mouse Ultrasensitive ELISA (Cat.# EIA-3440, DRG). Significance has been determine with Student's t-test. - Glycosylated hemoglobin (7) is formed by excess plasma glucose binding to hemoglobin in red blood cells (RBC). Since RBCs have a 120-day lifespan, measurements of the glycolylated hemoglobin gives a longer-term indication of glucose control and is seen as a better indicator than plasma glucose levels. Whole blood was collected from the retro-orbital sinus and analyzed with the Enzymatic HbAlc Test Kit (#DZ121A, Diazyme) to determine the glycosylated hemoglobin levels. Using glycosylated hemoglobin as a parameter, a significant reduction in the increase was seen in all treated groups.
-
Fig. 18A shows the relative increase of glycosylated hemoglobin (GHb) in whole blood samples after 6, 12 and 18 weeks of treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D).Fig. 18B shows the relative increase of glycosylated hemoglobin (GHb) in whole blood samples after 18 weeks of treatment with saline (A), CM1 (B), CM3-ANA01 (C) or exendin (D). The mean value of all animals per group (n=12) is given. The increase of the glycosylated hemoglobin levels of all treated groups are significantly lower than the control. - Pathology (8) of the mice treated was conducted. Necropsy revealed no differences in the organs of the treated groups compared to the non-treated group A, except the pancreas volume. Pancreas weight was determined and revealed to be highly significant higher in all treated groups.
Figure 19 presents the pancreas weight determined at day of scarification of the animals after 18 weeks of treatment with 0.9% saline (Group A, n=11), CM1 peptide (group B, n=12), CM3-ANA01 peptide (group C, n=12) or exendin-4 (group D, n=12). - To evaluate potential immunological effects of the tested substances, type IV immunogenicity (9) was examined by T cell restimulation. Therefore, the spleen of 8 animals per group was explanted, T-cells isolated and restimulated with different concentrations of the corresponding test substance. Compared to non-treated controls no significant increase in peptide restimulated T-cell proliferation was found.
Figure 20 shows the in vitro recall response of spleen cells to different concentrations of the test substances CM1 (Fig. 20A ) and CM3-ANA01 (Fig. 20B ) and the reference substance exendin-4 (Fig. 20C ). Using a non-radioactive cell proliferation assay (Cell Proliferation ELISA, BrdU, chemiluminescent) the in vitro recall response of spleen cells of mice of group A to D to 3-fold dilutions of the test substances CM1 and CM3-ANA01 and the reference substance exendin-4, starting at 50 µg/ml, were measured in triplicates of individual mice. The stimulation index (SI) was calculated as the quotient of the response in the presence of the respective peptide and the response in the absence of peptides. Mean values ± standard deviations of the respective treated group and control group are shown (group A: n=3, group B: n=6, group C: n=7, group D: n=6). For the calculation of the mean values only mice, with a SI of more than 6.5 in the positive control cultures with 5 µg/ml Con A were analysed. - The long-term study in diabetic mice further supports the efficacy of the inventive C-terminally elongated peptides. In all parameters tested (body weight, food consumption, blood glucose levels, glycosylated hemoglobin, glucose tolerance, insulin secretion, pancreas weight) the C-terminally elongated peptides revealed a significant therapeutic effect. Taking in account the homology of the C-terminally elongated CellMed peptides with the endogenously occurring sequence it was shown that these inventive peptides are advantageous in terms of immunogenicity compared to non-mammalian exendin-4. Data from an immunogenicity study in mice support the absence of any clinically relevant immunogenicity of the CM1 peptide.
-
- HAEGTFTSDV SSYLEGQAAK EFIAWLVKGR G
Sequence ID No.:1 - HADGSFSDEM NTILDNLAAR DFINWLIQTK ITDRK
Sequence ID No.:4 - HADGSFSDEM STILDNLATR DFINWLIQTK ITDKK
Sequence ID No.:5 - HAEGTFTSDV SSYLEGQAAK EFIAWLVKGR GRRDFPEEVA IAEELG
Sequence ID No.:8 - HGEGTFTSDV SSYLEGQAAK EFIAWLVKGR G
Sequence ID No.:21 - Asp Phe Pro Glu Glu Val Ala
Sequence ID No: 25 - Ala Ala Asp Phe Pro Glu Glu Val Ala Ile
Sequence ID No: 26 - Ala Ala Asp Phe Pro Glu Glu Val Ala Ile Val Glu Glu Leu
Sequence ID No: 27 - Ala Ala Asp Phe Pro Glu Glu Val Ala Ile Ala Glu Glu Leu
Sequence ID No: 28 - Ala Ala Asp Phe Pro Glu Glu Val Ala Ile Val Glu Glu Leu Gly
Sequence ID No: 29 - Ala Ala Asp Phe Pro Glu Glu Val Ala Ile Ala Glu Glu Leu Gly
Sequence ID No: 30 -
- <110> Biocompatibles UK Limited
- <120> GLP-1 fusion peptides, their production and use
- <130> BI07P001WO
- <140>
<141> - <150>
EP050207.18.2
<151> 2005-09-22 - <160> 45
- <170> PatentIn version 3.3
- <210> 1
<211> 31
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: synthetic peptide corresponding to GLP-1(7-37) (see description p. 36) - <400> 1
- <210> 2
<211> 15
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: full-length IP-2 sequence having all 15 amino acids of the naturally occurring IP-2 sequence, human; (see description p. 36) - <400> 2
- <210> 3
<211> 15
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: full-length IP-2 sequence having all 15 amino acids of the naturally occurring IP-2 sequence, murine; (see description p. 36) - <400> 3
- <210> 4
<211> 35
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: murine isoform of GLP-2 (see description p. 36) - <400> 4
- <210> 5
<211> 35
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: human isoform of GLP-2 (see description p. 36) - <400> 5
- <210> 6
<211> 79
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: SEQ ID No: 6 (ID6syn, CM1) corresponds to GLP-1(7-37)-IP2-RR-GLP1(7-37), 79 aa, 8,7 kD (see description p. 36) - <400> 6
- <210> 7
<211> 83
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: SEQ ID No: 7 (ID7rec, CM2) corresponds
to GLP-1(7-37)-IP2-RR-GLP2, 83 aa, 9,4 kD (see description p. 36) - <400> 7
- <210> 8
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: SEQ ID No:8 (ID8 syn, CM3) corresponds to GLP-1(7-37)-IP2, 46 aa, 5,1 kD; - <400> 8
- <210> 9
<211> 97
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: artificial - <400> 9
- <210> 10
<211> 79
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: SEQ ID No: 10 (N-GLP-1(7-37)-IP2(human)-RR-GLP-1(7-37)-C, also designated human CM1), (see description p. 36) - <400> 10
- <210> 11
<211> 83
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: SEQ ID No: 11 (N-GLP-1(7-37)-IP2(human)-RR-GLP-2-C), also designated human CM2 herein), (see description p. 36) - <400> 11
- <210> 12
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: SEQ ID No: 12, GLP-1(7-37) linked without any linker sequence via its C-terminus to human IP2 (see description p. 36) - <400> 12
- <210> 13
<211> 815
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: (SEQ ID NO:13) represents the translated peptide sequence of the construct according toFig. 1k (SEQ ID No: 14), (see description p. 37); - <220>
<221> CDS
<222> (11)..(118) - <220>
<221> CDS
<222> (387)..(809) - <400> 13
- <210> 14
<211> 815
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence of the construct according toFig. 1k , (see description p. 37); - <400> 14
- <210> 15
<211> 834
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence and sequence of the translated peptide according to the constructFig. 1h , (see description p. 38); - <220>
<221> CDS
<222> (11)..(118) - <220>
<221> CDS
<222> (387)..(821) - <400> 15
- <210> 16
<211> 834
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence of the construct according toFig. 1h , (see description p. 38); - <400> 16
- <210> 17
<211> 780
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence sequence and translated peptide sequence of the construct according toFig. 11 , . (see description p. 35, 38); - <220>
<221> CDS
<222> (11)..(118) - <220>
<221> CDS
<222> (387)..(776) - <400> 17
- <210> 18
<211> 720
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence of the construct according toFig. 11 , (see description p. 39); - <400> 18
- <210> 19
<211> 716
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence and sequence of the translated peptide according toFig. 1m ., (see description p. 39, 40); - <220>
<221> CDS
<222> (11)..(118) - <220>
<221> CDS
<222> (387)..(710) - <400> 19
- <210> 20
<211> 716
<212> DNA
<213> Artificial - <220>
<223> Description of sequence: DNA sequence of the construct according toFig. 1m , (see description p. 40); - <400> 20
- <210> 21
<211> 31
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: artificial, (see description p. 40); - <400> 21
- <210> 22
<211> 10
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: artificial, (see description p. 40); - <400> 22
- <210> 23
<211> 14
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: artificial, (see description p. 40); - <400> 23
- <210> 24
<211> 14
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: artificial, (see description p. 40); - <400> 24
- <210> 25
<211> 7
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: partial sequence derived from IP2 - <400> 25
- <210> 26
<211> 10
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from SEQ ID NO: 22, wherein the first two alanines have been replaced by two arginines - <400> 26
- <210> 27
<211> 14
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from SEQ ID NO: 23, wherein the first two alanines have been replaced by two arginines - <400> 27
- <210> 28
<211> 14
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from SEQ ID NO: 24, wherein the first two alanines have been replaced by two arginines - <400> 28
- <210> 29
<211> 15
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from SEQ ID NO: 2, wherein the first two arginines have been replaced by two alanines - <400> 29
- <210> 30
<211> 15
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from SEQ ID NO: 3, wherein the first two arginines have been replaced by two alanines - <400> 30
- <210> 31
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (murine) - <400> 31
- <210> 32
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (murine) - <400> 32
- <210> 33
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (murine) - <400> 33
- <210> 34
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (murine) - <400> 34
- <210> 35
<211> 36
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (murine) - <400> 35
- <210> 36
<211> 40
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (murine) - <400> 36
- <210> 37
<211> 51
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP=1-IP2-fragment (murine) - <400> 37
- <210> 38
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (human) - <400> 38
- <210> 39
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (human) - <400> 39
- <210> 40
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (human) - <400> 40
- <210> 41
<211> 46
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (human) - <400> 41
- <210> 42
<211> 51
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence derived from GLP-1-IP2-fragment (human) - <400> 42
- <210> 43
<211> 31
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence according to formula (I) (see description, p. 1) - <220>
<221> misc_feature
<222> (31)..(31)
<223> xaa = NH2, when sequence is GLP-1(7-36) amide, or xaa = Gly-OH, when sequence is GLP-1(7-37) amide, - <400> 43
- <210> 44
<211> 31
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence according to formula (II) (see description, p. 13) - <220>
<221> misc_feature
<222> (1)..(1)
<223> xaa is L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, 3-hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; - <220>
<221> misc_feature
<222> (2)..(2)
<223> xaa is Ala, Gly, val, Leu, Ile, Lys, or Aib; - <220>
<221> misc_feature
<222> (2)..(2)
<223> xaa is alternatively (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid, - <220>
<221> misc_feature
<222> (10)..(10)
<223> xaa is val or Leu; xaa is is Ser, Lys or Arg; - <220>
<221> misc_feature
<222> (12)..(12)
<223> xaa is Ser, Lys or Arg; - <220>
<221> misc_feature
<222> (13)..(13)
<223> xaa is Tyr or Gln - <220>
<221> misc_feature
<222> (14)..(14)
<223> xaa is Leu or Met; - <220>
<221> misc_feature
<222> (16)..(16)
<223> xaa is Gly, Glu or Aib; - <220>
<221> misc_feature
<222> (17)..(17)
<223> xaa is Gln, Glu, Lys or Arg ; - <220>
<221> misc_feature
<222> (19)..(19)
<223> xaa is Ala or val ; - <220>
<221> misc_feature
<222> (20)..(20)
<223> xaa is Lys, Glu or Arg; - <220>
<221> misc_feature
<222> (21)..(21)
<223> xaa is Glu or Leu; - <220>
<221> misc_feature
<222> (24)..(24)
<223> xaa is Ala, Glu or Arg; - <220>
<221> misc_feature
<222> (27)..(27)
<223> xaa is val or Lys; - <220>
<221> misc_feature
<222> (28)..(28)
<223> xaa is Lys, Glu, Asn or Arg; - <220>
<221> misc_feature
<222> (29)..(29)
<223> xaa is Gly or Aib; - <220>
<221> misc_feature
<222> (30)..(30)
<223> xaa is Arg, Gly or Lys or amide or absent; - <220>
<221> misc_feature
<222> (31)..(31)
<223> xaa is Gly, Ala, Glu, Pro, Lys, amide or is absent; - <400> 44
- <210> 45
<211> 31
<212> PRT
<213> Artificial - <220>
<223> Description of sequence: sequence according to formula (III) (see description, p. 13) - <220>
<221> misc_feature
<222> (1)..(1)
<223> xaa is L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, -hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; - <220>
<221> misc_feature
<222> (2)..(2)
<223> xaa is Ala, Gly, val, Leu, Ile, Lys or Aib; - <220>
<221> misc_feature
<222> (2)..(2)
<223> xaa is alternatively (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; - <220>
<221> misc_feature
<222> (12)..(12)
<223> xaa is Ala, Gly, val, Leu, Ile, Lys or Aib; - <220>
<221> misc_feature
<222> (12)..(12)
<223> xaa is alternatively (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; - <220>
<221> misc_feature
<222> (16)..(16)
<223> xaa is Gly, Glu or Aib; - <220>
<221> misc_feature
<222> (17)..(17)
<223> Xaa is Gln, Glu, Lys or Arg; - <220>
<221> misc_feature
<222> (20)..(20)
<223> xaa is Lys, Glu or Arg; - <220>
<221> misc_feature
<222> (24)..(24)
<223> xaa is Ala, Glu or Arg; - <220>
<221> misc_feature
<222> (28)..(28)
<223> Xaa is Lys, Glu or Arg; - <220>
<221> misc_feature
<222> (29)..(29)
<223> Xaa is Gly or Aib; - <220>
<221> misc_feature
<222> (30)..(30)
<223> Xaa is Arg or Lys, amide or is absent; - <220>
<221> misc_feature
<222> (31)..(31)
<223> Xaa is Gly, Ala, Glu or Lys, amide or is absent, - <400> 45
or
a fusion peptide comprising components (I) and (II) as defined before, wherein at least one of the amino acids is derivatized by a modification of the peptide backbone, whereby the modification of the peptide backbone results in scaffold mimetics, whose backbone is different from the naturally-occurring backbone, and whose side chains are identical with the unmodified fusion peptide, or a fusion peptide comprising components (I) and (II) as defined above, wherein a retro-inverso isomer of the fusion peptide is provided.
Claims (32)
- A fusion peptide comprising
as component (I) N-terminally a sequence according to(i) formula II
Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Xaa16-Ser-Xaa18-Xaa19-Xaa20-Glu-Xaa22-Xaa23-Ala-Xaa25-Xaa26-Xaa27-Phe-Ile-Xaa30-Trp-Leu-Xaa33-Xaa34-Xaa35-Xaa36-Xaa37,
wherein Xaa7 is L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, 3-hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa8 is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid, whereby Gly is particularly preferred; Xaa16 is Val or Leu; Xaa18 is Ser, Lys or Arg; Xaa19 is Tyr or Gln; Xaa20 is Leu or Met; Xaa22 is Gly, Glu or Aib; Xaa23 is Gln, Glu, Lys or Arg; Xaa25 is Ala or Val; Xaa26 is Lys, Glu or Arg; Xaa27 is Glu or Leu; Xaa30 is Ala, Glu or Arg; Xaa33 is Val or Lys; Xaa34 is Lys, Glu, Asn or Arg; Xaa35 is Gly or Aib; Xaa36 is Arg, Gly or Lys or amide or absent; Xaa37 is Gly, Ala, Glu, Pro, Lys, amide or is absent;
or(ii) formula III
Xaa7-Xaa8-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Xaa18-Tyr-Leu-Glu-Xaa22-Xaa23-Ala-Ala-Xaa26-Glu-Phe-Ile-Xaa30-Trp-Leu-Val-Xaa34-Xaa35-Xaa36-Xaa37,
wherein Xaa7 is L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, -hydroxy-histidine, homohistidine, N-acetyl-histidine, a-fluoromethyl-histidine, a-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine or 4-pyridylalanine; Xaa8 is Ala, Gly, Val, Leu, Ile, Lys, Aib, (1-aminocyclopropyl) carboxylic acid, (1-aminocyclobutyl) carboxylic acid, (1-aminocyclopentyl) carboxylic acid, (1-aminocyclohexyl) carboxylic acid, (1-aminocycloheptyl) carboxylic acid, or (1-aminocyclooctyl) carboxylic acid; Xaa18 is Ser, Lys or Arg; Xaa22 is Gly, Glu or Aib; Xaa23 is Gln, Glu, Lys or Arg; Xaa26 is Lys, Glu or Arg; Xaa30 is Ala, Glu or Arg; Xaa34 is Lys, Glu or Arg; Xaa35 is Gly or Aib; Xaa36 is Arg or Lys, amide or is absent; Xaa37 is Gly, Ala, Glu or Lys, amide or is absent;
or(iii) GLP-1(7-37) of SEQ ID No. 1 or a functional sequence exerting the biological effects of GLP-1 as incretin hormone, its anti-apoptotic action or its neurotrophic properties and having at least 80% sequence identity with GLP-1 (7-37);and as component (II) C-terminally a peptide sequence of at least 9 amino acids, and containing a sequence according to SEQ ID No.: 26 (AADFPEEVAI) or a sequence having at least 90% sequence identity with SEQ ID No.: 26 awarding improved resistance to DPP-IV inactivation of the fusion peptide,
or
a fusion peptide comprising components (I) and (II) as defined before, wherein at least one of the amino acids is derivatized by a modification of the peptide backbone,
whereby the modification of the peptide backbone results in scaffold mimetics, whose backbone is different from the naturally-occurring backbone, and whose side chains are identical with the unmodified fusion peptide,
or
a fusion peptide comprising components (I) and (II) as defined above, wherein a retro-inverso isomer of the fusion peptide is provided. - The fusion peptide according to claim 1 comprising as component (I) N-terminally a GLP-1(7-35, 7-36 or 7-37) sequence and as component (II) C-terminally a peptide sequence of at least 9 amino acids, and containing a sequence according to SEQ ID No.: 26 (AADFPEEVAI) awarding improved resistance to DPP-IV inactivation of the fusion peptide.
- A fusion peptide according to claim 2, wherein component (I) contains a sequence having at least 80 % sequence identity with SEQ ID No.: 1.
- A fusion peptide according to any of preceding claims 1 to 3, wherein component (II) has an N-terminal sequence motif selected from the group consisting of XA or AX, wherein X is a naturally occurring or a modified non-natural amino acid.
- A fusion peptide according to any of preceding claims 1 to 4, wherein component (II) is a peptide sequence containing a sequence selected from a group consisting of SEQ ID No.: 27 (AADFPEEVAIVEEL) and and SEQ ID No.: 28 (AADFPEEVAIAEEL), or a sequence having at least 80% sequence identity with any of SEQ ID Nos.: 27 or 28.
- A fusion peptide according to any of preceding claims 1 to 5, wherein component (II) is a peptide sequence containing a sequence selected from the group consisting of SEQ ID No.: 29 (AADFPEEVAIVEELG) and SEQ ID NO.: 30 (AADFPEEVAIAEELG) or a sequence having at least 80% sequence identity with SEQ ID Nos.: 29 or 30.
- A fusion peptide according to claim 6, wherein component (II) is a peptide sequence selected from the group consisting of SEQ ID No. 29 and SEQ ID No. 30 or a sequence having at least 80 % sequence identity with SEQ ID Nos.: 29 or 30.
- A fusion peptide according to any of preceding claims 1 to 7, wherein component (II) is a peptide sequence having 9 to 30, preferably 9 to 20, and most preferably 9 to 15 amino acids.
- A fusion peptide according to any of preceding claims 1 to 8, wherein component (I) and component (II) are directly linked or linked via a linker sequence.
- A fusion peptide according to claim 9, wherein the linker sequence has a length of 1 to 10 amino acids.
- A fusion peptide according to any of claims 1 to 10, wherein the fusion peptide contains a sequence selected from the group consisting of SEQ ID No.: 31 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGAADFPEEVAIAEELG) and SEQ ID No.: 38 (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGAADFPEEVAIVEELG).
- A fusion peptide according to claim 11, wherein the fusion peptide consists of SEQ ID No. 31 or consists of SEQ ID No. 38.
- A fusion peptide according to any of preceding claims 1 to 12, wherein the fusion peptide contains another component (III) linked to the C-terminus of component (II) and/or to the N-terminus of component (I).
- A fusion peptide according to claim 13, wherein component (III) comprises at least four amino acid residues, preferably at least 10 additional amino acid residues, more preferably at least 20, or at least 30.
- A fusion peptide according to claim 13 or 14, wherein component (III) comprises at least 4, preferably at least 10, more preferably at least 20 additional amino acid residues of the N-terminal sequence of GLP-2 as in proglucagon or of GLP-1 (7-37) .
- A fusion peptide according to any of claims 13 to 15, wherein component (III) contains the sequence of SEQ ID Nos.: 4 or 5 or a sequence having at least 80% sequence identity with SEQ ID Nos.: 4 or 5.
- A fusion peptide according to any of preceding claims 1 to 16, wherein at least one of the amino acids is derivatized by a covalent modification of a side chain of a naturally occurring amino acid or by modification of the NH2 or carboxy terminal groups.
- A fusion peptide according to any of preceding claim 1 to 17, wherein at least one of the amino acids is derivatized by a lipyl or carbohydrate group.
- A fusion peptide according to any of preceding claim 1 to 18, wherein the N-terminal His residue of GLP-1 (GLP-1(7)) is chemically modified at its NH2 terminus and/or at its histidyl side chain, in particular by a hydrophobic moiety.
- A fusion peptide according to any of preceding claims 1 to 19, wherein the fusion peptide comprises a carrier protein, in particular transferrin or albumin, as component (IV).
- A fusion peptide according to any of preceding claims 1 to 20, wherein the amino acid sequence of components (I), (II) and/or (III) is reversed and wherein said amino acid sequence(s) is at least partially composed of D amino acid isomers.
- A method of producing a fusion peptide according to any of preceding claims 1 to 21, by solid state peptide synthesis.
- A nucleic acid encoding a fusion peptide according to any of preceding claims 1 to 16 or 20.
- A vector comprising a nucleic acid according to claim 23.
- A host cell comprising exogenously introduced DNA according to claim 23, in particular a vector according to claim 24, being capable of expressing said fusion peptide, wherein such cells do not comprise human embryonic stem cells.
- A method for producing a fusion peptide according to any of preceding claims 1 to 16 or 20 in which microbial or animal cells transformed to include a nucleic acid encoding the fusion peptide are fermented and the fusion peptide is recovered.
- The method of producing a fusion peptide according to claim 26 in which microbial or animal cells are grown under conditions in which the fusion peptide is exported from the cells.
- Formulation containing the fusion peptide of any of claims 1 to 21 whereby the fusion peptide is formulated as neutral or salt form, in particular as acetate salt.
- Fusion peptide according to any of preceding claims 1 to 21 as a medicament for use in human or animal therapy.
- Fusion peptide according to any of preceding claims 1 to 21, a nucleic acid according to claim 23, a vector according to claim 24, a host cell according to claim 25 or a formulation according to claim 28 for use for the treatment of diabetes mellitus type I or type II, insulin resistance, weight disorders and diseases or conditions associated thereto.
- Fusion peptide according to any of preceding claims 1 to 21, a nucleic acid according to claim 23, a vector according to claim 24, a host cell according to claim 25 or a formulation according to claim 28 for use for the treatment of neurodegenerative disorders and diseases or conditions associated thereto.
- Fusion peptide according to any of preceding claims 1 to 21, a nucleic acid according to claim 23, a vector according to claim 24, a host cell according to claim 25 or a formulation according to claim 28 for use for the treatment of disorders and diseases or conditions associated to apoptosis.
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP10009718A EP2261245A1 (en) | 2005-09-22 | 2006-09-22 | GLP-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP06792228A EP1926748B1 (en) | 2005-09-22 | 2006-09-22 | Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance |
| EP09014513A EP2174952A3 (en) | 2005-09-22 | 2006-09-22 | glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP05020718A EP1767545B1 (en) | 2005-09-22 | 2005-09-22 | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP06792228A EP1926748B1 (en) | 2005-09-22 | 2006-09-22 | Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance |
| PCT/EP2006/009226 WO2007039140A1 (en) | 2005-09-22 | 2006-09-22 | Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP10009718A Division-Into EP2261245A1 (en) | 2005-09-22 | 2006-09-22 | GLP-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP09014513A Division-Into EP2174952A3 (en) | 2005-09-22 | 2006-09-22 | glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP1926748A1 EP1926748A1 (en) | 2008-06-04 |
| EP1926748B1 true EP1926748B1 (en) | 2012-08-29 |
Family
ID=35700191
Family Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP05020718A Expired - Lifetime EP1767545B1 (en) | 2005-09-22 | 2005-09-22 | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP08021837A Expired - Lifetime EP2045265B1 (en) | 2005-09-22 | 2005-09-22 | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP09014513A Withdrawn EP2174952A3 (en) | 2005-09-22 | 2006-09-22 | glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP06792228A Not-in-force EP1926748B1 (en) | 2005-09-22 | 2006-09-22 | Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance |
| EP10009718A Withdrawn EP2261245A1 (en) | 2005-09-22 | 2006-09-22 | GLP-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
Family Applications Before (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP05020718A Expired - Lifetime EP1767545B1 (en) | 2005-09-22 | 2005-09-22 | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP08021837A Expired - Lifetime EP2045265B1 (en) | 2005-09-22 | 2005-09-22 | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP09014513A Withdrawn EP2174952A3 (en) | 2005-09-22 | 2006-09-22 | glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP10009718A Withdrawn EP2261245A1 (en) | 2005-09-22 | 2006-09-22 | GLP-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
Country Status (23)
| Country | Link |
|---|---|
| US (2) | US8431533B2 (en) |
| EP (5) | EP1767545B1 (en) |
| JP (2) | JP5222729B2 (en) |
| KR (1) | KR20080064840A (en) |
| CN (1) | CN101273058A (en) |
| AT (1) | ATE448247T1 (en) |
| AU (1) | AU2006299134B2 (en) |
| BR (1) | BRPI0616107A2 (en) |
| CA (1) | CA2619053A1 (en) |
| CY (1) | CY1109778T1 (en) |
| DE (1) | DE602005017628D1 (en) |
| DK (1) | DK1767545T3 (en) |
| EA (1) | EA013796B1 (en) |
| ES (3) | ES2397289T3 (en) |
| HR (1) | HRP20100062T1 (en) |
| IL (1) | IL188904A0 (en) |
| PL (1) | PL1767545T3 (en) |
| PT (1) | PT1767545E (en) |
| RS (1) | RS51319B (en) |
| SG (1) | SG165414A1 (en) |
| SI (1) | SI1767545T1 (en) |
| WO (1) | WO2007039140A1 (en) |
| ZA (1) | ZA200803488B (en) |
Families Citing this family (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RS51319B (en) | 2005-09-22 | 2010-12-31 | Biocompatibles Uk Limited | GLP-1 (GLUCAGON-LIKE PEPTID-1) FUSION POLYPEPTIDES WITH INCREASED RESISTANCE TO PEPTIDASES |
| US20100021480A1 (en) * | 2005-10-27 | 2010-01-28 | Peptron Co., Ltd | Bioactive substance-blood protein conjugate and stabilization of a bioactive substance using the same |
| US20130172274A1 (en) | 2005-12-20 | 2013-07-04 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
| US8178495B2 (en) | 2008-06-27 | 2012-05-15 | Duke University | Therapeutic agents comprising a GLP-1 receptor agonist and elastin-like peptide |
| US8841255B2 (en) | 2005-12-20 | 2014-09-23 | Duke University | Therapeutic agents comprising fusions of vasoactive intestinal peptide and elastic peptides |
| EP1854455B1 (en) | 2006-05-10 | 2009-10-07 | Biocompatibles UK Limited | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| EP1972349A1 (en) * | 2007-03-21 | 2008-09-24 | Biocompatibles UK Limited | GLP-1 fusion peptides conjugated to polymer(s), their production and use |
| EP1975176A1 (en) * | 2007-03-27 | 2008-10-01 | Biocompatibles UK Limited | Novel glp-1 fusion peptides, their production and use |
| EP2163243A1 (en) * | 2008-09-12 | 2010-03-17 | Biocompatibles UK Limited | Treatment of acute myocardial infarction (AMI) using encapsulated cells encoding and secreting GLP-1 peptides or analogs thereof |
| CN101993485B (en) * | 2009-08-20 | 2013-04-17 | 重庆富进生物医药有限公司 | Peptide analog homologous dimer capable of accelerating insulin secretion and application thereof |
| US9587006B2 (en) * | 2010-02-11 | 2017-03-07 | Hoffmann-La Roche Inc. | IGF-I poly (ethylene glycol) conjugates |
| CN103237806A (en) * | 2010-10-01 | 2013-08-07 | 株式会社Mmt | Peptides with Immunoglobulin Binding Ability |
| CN102766204B (en) * | 2011-05-05 | 2014-10-15 | 天津药物研究院 | Glucagon-like peptide-1 mutant polypeptide, its preparation method and application thereof |
| CN102363633B (en) * | 2011-11-16 | 2013-11-20 | 天津拓飞生物科技有限公司 | Glucagon like peptide-1 mutant polypeptide and preparation method, medicinal composition and use thereof |
| JP6525456B2 (en) | 2012-11-20 | 2019-06-05 | メデリス ダイアビーティーズ,エルエルシー | Improved peptide formulations for insulin resistance |
| CN104371019B (en) * | 2013-08-13 | 2019-09-10 | 鸿运华宁(杭州)生物医药有限公司 | It is a kind of can with GLP-1R specifically bind antibody and its with the fused protein of GLP-1 |
| CN104707131A (en) * | 2013-12-13 | 2015-06-17 | 上海建华精细生物制品有限公司 | Pharmaceutical composition and preparation method and use thereof |
| PT3155017T (en) | 2014-05-28 | 2024-05-14 | Mederis Diabetes Llc | Improved peptide pharmaceuticals for insulin resistance |
| ES2833099T3 (en) | 2015-02-11 | 2021-06-14 | Gmax Biopharm Llc | Preparation of stabilized solution of a fusion protein of a pharmaceutical GLP-1R antibody |
| KR101661332B1 (en) * | 2015-05-28 | 2016-09-29 | (의료)길의료재단 | Pharmaceutical composition for treating muscle atrophy comprising glucagon like-peptide-1 receptor agonist |
| EP3393496B1 (en) | 2015-12-23 | 2023-10-11 | The Johns Hopkins University | Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions |
| CN107818433B (en) * | 2016-09-14 | 2022-07-05 | 菜鸟智能物流控股有限公司 | Pickup method, logistics information processing method, device and system |
| SG10201911851VA (en) * | 2016-12-09 | 2020-02-27 | Zealand Pharma As | Acylated glp-1/glp-2 dual agonists |
| WO2018104559A1 (en) * | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Glp-1/glp-2 dual agonists |
| WO2018104558A1 (en) * | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
| CN108341880B (en) * | 2017-01-23 | 2023-07-04 | 天津药物研究院有限公司 | Chimeric polypeptides comprising glucagon-like peptide-1 and fragment analogs of glucagon and uses thereof |
| KR101827245B1 (en) * | 2017-12-26 | 2018-02-08 | (주)제이유타이드 | Curing agent for uremia comprising alarin |
| FI3735295T3 (en) | 2018-01-03 | 2024-11-20 | Mederis Diabetes Llc | Improved peptide pharmaceuticals for treatment of nash and other disorders |
| KR101903564B1 (en) * | 2018-01-31 | 2018-11-13 | 한국지질자원연구원 | Method of recycling by-products from papermaking process |
| UA128210C2 (en) | 2018-04-05 | 2024-05-08 | Сан Фармасьютікал Індастріз Лімітед | Novel glp-1 analogues |
| CA3123979A1 (en) | 2018-12-21 | 2020-06-25 | Jiangsu Hengrui Medicine Co., Ltd. | Bispecific protein |
| KR102349717B1 (en) * | 2020-03-12 | 2022-01-11 | 주식회사 에스엘메타젠 | A novel pharmaceutical composition for treating metabolic syndrome and diseases related thereto |
| EP4119571A4 (en) * | 2020-03-12 | 2024-04-03 | SL Metagen | Novel bispecific protein and use thereof |
| WO2022015039A1 (en) * | 2020-07-14 | 2022-01-20 | (주)지아이이노베이션 | Fusion protein including glucagon-like peptide-1 and glucagon-like peptide-2 and use thereof |
| EP4252781A1 (en) * | 2020-11-27 | 2023-10-04 | D&D Pharmatech Inc. | Oral formulation of biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto |
| CA3200366A1 (en) * | 2020-11-27 | 2022-06-02 | D&D Pharmatech Inc. | Biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto |
| US12171806B2 (en) | 2021-09-28 | 2024-12-24 | Spitfire Pharma Llc | Therapeutic regimens and methods for lowering blood glucose and/or body weight using GLP-1R and GCGR balanced agonists |
| CN112661862B (en) * | 2020-12-25 | 2023-03-31 | 深圳大学 | Fusion protein and preparation method and application thereof |
| CN113846124A (en) * | 2021-09-26 | 2021-12-28 | 康霖生物科技(杭州)有限公司 | Nucleic acid construct for gene therapy of diseases related to glycometabolism |
| CN115873124A (en) * | 2021-09-29 | 2023-03-31 | 合肥天汇生物科技有限公司 | Fusion polypeptide of GLP-1 analog |
| CN115850438B (en) * | 2021-12-28 | 2023-05-12 | 北京惠之衡生物科技有限公司 | Long-acting GLP-1 derivative |
| CN115920004B (en) * | 2022-11-11 | 2025-09-30 | 深圳市图微安创科技开发有限公司 | Pharmaceutical composition and preparation method thereof |
| WO2024135375A1 (en) | 2022-12-22 | 2024-06-27 | Dic株式会社 | Water-insoluble pigment composition |
| WO2024144431A1 (en) * | 2022-12-29 | 2024-07-04 | Авва Фармасьютикалс Лтд | New escherichia coli production strain for producing a cbd-hs-es-glp1 fusion protein and method for producing a glp-1 polypeptide |
| EP4741420A1 (en) * | 2023-06-30 | 2026-05-13 | Huonslab Co., Ltd. | Pharmaceutical composition for preventing or treating obesity comprising glp analogue as active ingredient |
| WO2025047443A1 (en) | 2023-08-31 | 2025-03-06 | Dic株式会社 | Water-insoluble pigment composition |
| CN121127541A (en) | 2023-08-31 | 2025-12-12 | Dic株式会社 | Non-water-soluble pigment composition |
| WO2025147630A1 (en) * | 2024-01-05 | 2025-07-10 | Fractyl Health, Inc. | Glp-1 gene therapies for metabolic disorders |
Family Cites Families (83)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US586128A (en) * | 1897-07-13 | Toilet-paper holder | ||
| US4352883A (en) * | 1979-03-28 | 1982-10-05 | Damon Corporation | Encapsulation of biological material |
| EP0018435B1 (en) | 1979-10-16 | 1984-03-07 | Winfried Dr. med. Stöcker | Microanalytic device |
| US4596792A (en) | 1981-09-04 | 1986-06-24 | The Regents Of The University Of California | Safe vaccine for hepatitis containing polymerized serum albumin |
| JPS5938877A (en) | 1982-08-30 | 1984-03-02 | Musashi Eng Kk | Paper leaf discriminating method |
| US4588585A (en) | 1982-10-19 | 1986-05-13 | Cetus Corporation | Human recombinant cysteine depleted interferon-β muteins |
| US4737462A (en) | 1982-10-19 | 1988-04-12 | Cetus Corporation | Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β |
| US4518584A (en) | 1983-04-15 | 1985-05-21 | Cetus Corporation | Human recombinant interleukin-2 muteins |
| DD224119A1 (en) | 1983-11-07 | 1985-06-26 | Univ Schiller Jena | TEMPERABLE SAMPLE SUPPLIER |
| US4599230A (en) | 1984-03-09 | 1986-07-08 | Scripps Clinic And Research Foundation | Synthetic hepatitis B virus vaccine including both T cell and B cell determinants |
| US4599231A (en) | 1984-03-09 | 1986-07-08 | Scripps Clinic And Research Foundation | Synthetic hepatitis B virus vaccine including both T cell and B cell determinants |
| US4608251A (en) | 1984-11-09 | 1986-08-26 | Pitman-Moore, Inc. | LHRH analogues useful in stimulating anti-LHRH antibodies and vaccines containing such analogues |
| US4959314A (en) | 1984-11-09 | 1990-09-25 | Cetus Corporation | Cysteine-depleted muteins of biologically active proteins |
| US5116943A (en) | 1985-01-18 | 1992-05-26 | Cetus Corporation | Oxidation-resistant muteins of Il-2 and other protein |
| US4601903A (en) | 1985-05-01 | 1986-07-22 | The United States Of America As Represented By The Department Of Health And Human Services | Vaccine against Neisseria meningitidis Group B serotype 2 invasive disease |
| US5144139A (en) | 1985-08-05 | 1992-09-01 | Biotrack, Inc. | Capillary flow device |
| US4687529A (en) | 1985-08-30 | 1987-08-18 | Miles Laboratories, Inc. | Method of making a reagent test device containing hydrophobic barriers |
| CA1292176C (en) | 1985-09-18 | 1991-11-19 | Joel M. Blatt | Volume metering capillary gap device for applying a liquid sample onto a reactive surface |
| US5017691A (en) | 1986-07-03 | 1991-05-21 | Schering Corporation | Mammalian interleukin-4 |
| US6849708B1 (en) | 1986-05-05 | 2005-02-01 | The General Hospital Corporation | Insulinotropic hormone and uses thereof |
| US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
| US4904584A (en) | 1987-12-23 | 1990-02-27 | Genetics Institute, Inc. | Site-specific homogeneous modification of polypeptides |
| ATE164852T1 (en) | 1990-01-24 | 1998-04-15 | Douglas I Buckley | GLP-1 ANALOGUE USABLE IN DIABETES TREATMENT |
| ATE138102T1 (en) | 1991-02-19 | 1996-06-15 | Takeda Chemical Industries Ltd | METHOD FOR PRODUCING CYSTEIN-FREE PEPTIDES |
| CA2062338A1 (en) | 1991-03-15 | 1992-09-16 | Zia Yassinzadeh | Electronic control cartridge and method of simulating light transmission patterns |
| GB9311147D0 (en) | 1993-05-28 | 1993-07-14 | Long Ashton Research Station | Regulation of plant growth |
| US5705483A (en) | 1993-12-09 | 1998-01-06 | Eli Lilly And Company | Glucagon-like insulinotropic peptides, compositions and methods |
| US5512549A (en) | 1994-10-18 | 1996-04-30 | Eli Lilly And Company | Glucagon-like insulinotropic peptide analogs, compositions, and methods of use |
| BE1008987A3 (en) | 1995-01-06 | 1996-10-01 | Robyn Pierre | Block for glass pipe refractory ovens floor and installation in soils circuit cooling or heating for improving thermal control of soil and quality of glass. |
| JP3643863B2 (en) | 1995-08-09 | 2005-04-27 | アークレイ株式会社 | Liquid holder and manufacturing method thereof |
| DK1975177T3 (en) | 1996-03-01 | 2011-07-25 | Novo Nordisk As | Appetite suppressant peptide, formulations thereof and use thereof |
| US6165739A (en) | 1996-03-13 | 2000-12-26 | Compucyte Corporation | Multiple simultaneous testing media |
| DE69739172D1 (en) | 1996-08-08 | 2009-01-29 | Amylin Pharmaceuticals Inc | REGULATION OF GASTROINTESTINAL MOBILITY |
| JP3149958B2 (en) | 1996-08-30 | 2001-03-26 | ノボ ノルディスク アクティーゼルスカブ | GLP-1 derivative |
| ES2237790T3 (en) | 1996-11-12 | 2005-08-01 | Novo Nordisk A/S | USE OF GLP-1 PEPTIDES. |
| CA2318376A1 (en) | 1998-01-12 | 1999-07-15 | Betagene, Inc. | Compositions and methods for regulated secretion from neuroendocrine cell lines |
| EP1059882B1 (en) | 1998-03-06 | 2007-10-17 | SPECTRX, Inc. | Integrated tissue poration, fluid harvesting and analysis device |
| AU757658B2 (en) * | 1998-03-09 | 2003-02-27 | Zealand Pharma A/S | Pharmacologically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis |
| AU3047299A (en) | 1998-04-13 | 1999-11-01 | Modex Therapeutiques, S.A. | Methods of delivering glp-1 |
| US7259136B2 (en) | 1999-04-30 | 2007-08-21 | Amylin Pharmaceuticals, Inc. | Compositions and methods for treating peripheral vascular disease |
| US6267954B1 (en) | 1999-11-24 | 2001-07-31 | Universite De Paris V Rene-Descartes | Intraocular transplantation of encapsulated cells |
| US6706159B2 (en) | 2000-03-02 | 2004-03-16 | Diabetes Diagnostics | Combined lancet and electrochemical analyte-testing apparatus |
| DE60114996T2 (en) | 2000-03-08 | 2006-08-10 | Novo Nordisk A/S | LOWERING OF THE SERUM CHOLESTEROL |
| DE10039643A1 (en) * | 2000-08-14 | 2002-02-28 | Max Planck Gesellschaft | Functionalized perylene tetracarboxylic acid diimides |
| ES2311560T3 (en) | 2000-12-07 | 2009-02-16 | Eli Lilly And Company | GLP-1 FUSION PROTEINS. |
| CA2430651C (en) | 2001-02-09 | 2010-10-12 | Wisconsin Alumni Research Foundation | Method and structure for microfluidic flow guiding |
| US20020183253A1 (en) | 2001-02-22 | 2002-12-05 | Brazzell Romulus Kimbro | Method of treating ocular neovascularization |
| US20030034147A1 (en) | 2001-05-31 | 2003-02-20 | Houck Glenn M. | Apparatus which eliminates the need for idling by trucks |
| US20030119734A1 (en) | 2001-06-28 | 2003-06-26 | Flink James M. | Stable formulation of modified GLP-1 |
| CN1363654A (en) | 2001-07-19 | 2002-08-14 | 上海华谊生物技术有限公司 | Genetically engineered bacteria and process for preparing insulinotropic hormone secretion peptide GLP-1 (7-36) |
| EP1430115A1 (en) | 2001-07-27 | 2004-06-23 | Arhus Amt | Immortilized stem cells |
| JP2005501058A (en) | 2001-07-31 | 2005-01-13 | ザ ガバメント オブ ザ ユナイテッドステイツ オブ アメリカ アズ リプレゼンテッド バイ ザ セクレタリー デパートメント オブ ヘルス アンド ヒューマン サービシーズ ザ ナショナル インステ | GLP-1, EXENDIN-4, peptide analogue thereof and use thereof |
| US20040143104A1 (en) | 2001-08-08 | 2004-07-22 | Wadsworth Samuel C. | Methods of treating diabetes and other blood sugar disorders |
| CA2452044A1 (en) | 2001-08-28 | 2003-03-13 | Eli Lilly And Company | Pre-mixes of glp-1 and basal insulin |
| US7176278B2 (en) | 2001-08-30 | 2007-02-13 | Biorexis Technology, Inc. | Modified transferrin fusion proteins |
| US7166208B2 (en) | 2004-03-03 | 2007-01-23 | Stephen Eliot Zweig | Apoenzyme reactivation electrochemical detection method and assay |
| WO2003059372A2 (en) | 2001-12-29 | 2003-07-24 | Novo Nordisk A/S | Combined use of a glp-1 compound and a modulator of diabetic late complications |
| BR0306706A (en) * | 2002-01-08 | 2007-03-27 | Lilly Co Eli | glp-1 peptide extended, methods of glp-1 receptor stimulation in an individual requiring blood glucose normalization, treatment of an individual prophylactically for insulin-independent diabetes, reduction or maintenance of body weight, treatment of obesity , and treatment of diseases, in an individual in need thereof, use of a glp-1 compound, process of preparing a pharmaceutical formulation, and, pharmaceutical formulation. |
| GB2388898B (en) | 2002-04-02 | 2005-10-05 | Inverness Medical Ltd | Integrated sample testing meter |
| US20030191056A1 (en) * | 2002-04-04 | 2003-10-09 | Kenneth Walker | Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins |
| US20030143113A2 (en) | 2002-05-09 | 2003-07-31 | Lifescan, Inc. | Physiological sample collection devices and methods of using the same |
| JP2006501820A (en) | 2002-09-06 | 2006-01-19 | バイエル・フアーマシユーチカルズ・コーポレーシヨン | Modified GLP-1 receptor agonists and their pharmacological uses |
| JP4548335B2 (en) * | 2003-03-07 | 2010-09-22 | 味の素株式会社 | Inducing agent for converting intestinal cells into insulin-producing cells, and therapeutic agent for diabetes |
| US6969166B2 (en) | 2003-05-29 | 2005-11-29 | 3M Innovative Properties Company | Method for modifying the surface of a substrate |
| US7057116B2 (en) | 2003-06-02 | 2006-06-06 | Intel Corporation | Selective reference plane bridge(s) on folded package |
| JP4629047B2 (en) * | 2003-06-12 | 2011-02-09 | イーライ リリー アンド カンパニー | GLP-1 analog complex protein |
| EP1498143A1 (en) | 2003-07-18 | 2005-01-19 | Aventis Pharma S.A. | Self-emulsifying and self-microemulsifying formulations for the oral administration of taxoids |
| JP2007501812A (en) | 2003-08-08 | 2007-02-01 | ノボ ノルディスク アクティーゼルスカブ | Synthesis and application of new structurally well-defined branched polymers as binders for peptides |
| WO2005035553A2 (en) | 2003-10-10 | 2005-04-21 | Novo Nordisk A/S | Conjugation of peptides |
| CA2550050A1 (en) * | 2003-12-18 | 2005-06-30 | Novo Nordisk A/S | Novel glp-1 analogues linked to albumin-like agents |
| US7670844B2 (en) | 2004-01-20 | 2010-03-02 | The Curators Of The University Of Missouri | Supported molecular biofluid viscosity sensors for in vitro and in vivo use |
| US20060094652A1 (en) | 2004-02-11 | 2006-05-04 | Levy Odile E | Hybrid polypeptides with selectable properties |
| WO2005098431A1 (en) | 2004-03-05 | 2005-10-20 | Egomedical Swiss Ag | Analyte test system for determining the concentration of an analyte in a physiological fluid |
| EA011583B1 (en) | 2004-03-31 | 2009-04-28 | Сентокор, Инк. | Human glp-1 mimetibodies, compositions, methods and uses |
| WO2006010143A2 (en) * | 2004-07-13 | 2006-01-26 | Neose Technologies, Inc. | Branched peg remodeling and glycosylation of glucagon-like peptide-1 [glp-1] |
| ES2334671T3 (en) | 2004-08-13 | 2010-03-15 | Egomedical Technologies Ag | ANALYTES TEST SYSTEM TO DETERMINE THE CONCENTRATION OF AN ANALYTE IN A PHYSIOLOGICAL OR AQUOUS FLUID. |
| US7442682B2 (en) | 2004-10-19 | 2008-10-28 | Nitto Denko Corporation | Transepithelial delivery of peptides with incretin hormone activities |
| AU2006279276A1 (en) | 2005-07-29 | 2007-02-15 | Amprotein Corporation | Chimeric therapeutic agents |
| RS51319B (en) | 2005-09-22 | 2010-12-31 | Biocompatibles Uk Limited | GLP-1 (GLUCAGON-LIKE PEPTID-1) FUSION POLYPEPTIDES WITH INCREASED RESISTANCE TO PEPTIDASES |
| EP1854455B1 (en) | 2006-05-10 | 2009-10-07 | Biocompatibles UK Limited | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| EP1972349A1 (en) | 2007-03-21 | 2008-09-24 | Biocompatibles UK Limited | GLP-1 fusion peptides conjugated to polymer(s), their production and use |
| EP1975176A1 (en) | 2007-03-27 | 2008-10-01 | Biocompatibles UK Limited | Novel glp-1 fusion peptides, their production and use |
| EP2163243A1 (en) | 2008-09-12 | 2010-03-17 | Biocompatibles UK Limited | Treatment of acute myocardial infarction (AMI) using encapsulated cells encoding and secreting GLP-1 peptides or analogs thereof |
-
2005
- 2005-09-22 RS RSP-2010/0039A patent/RS51319B/en unknown
- 2005-09-22 DK DK05020718.2T patent/DK1767545T3/en active
- 2005-09-22 ES ES08021837T patent/ES2397289T3/en not_active Expired - Lifetime
- 2005-09-22 PL PL05020718T patent/PL1767545T3/en unknown
- 2005-09-22 EP EP05020718A patent/EP1767545B1/en not_active Expired - Lifetime
- 2005-09-22 PT PT05020718T patent/PT1767545E/en unknown
- 2005-09-22 AT AT05020718T patent/ATE448247T1/en active
- 2005-09-22 EP EP08021837A patent/EP2045265B1/en not_active Expired - Lifetime
- 2005-09-22 DE DE602005017628T patent/DE602005017628D1/en not_active Expired - Lifetime
- 2005-09-22 ES ES05020718T patent/ES2336575T3/en not_active Expired - Lifetime
- 2005-09-22 SI SI200530887T patent/SI1767545T1/en unknown
-
2006
- 2006-09-22 CA CA002619053A patent/CA2619053A1/en not_active Abandoned
- 2006-09-22 ZA ZA200803488A patent/ZA200803488B/en unknown
- 2006-09-22 ES ES06792228T patent/ES2394218T3/en active Active
- 2006-09-22 SG SG201006921-9A patent/SG165414A1/en unknown
- 2006-09-22 EP EP09014513A patent/EP2174952A3/en not_active Withdrawn
- 2006-09-22 EP EP06792228A patent/EP1926748B1/en not_active Not-in-force
- 2006-09-22 US US11/991,562 patent/US8431533B2/en not_active Expired - Fee Related
- 2006-09-22 JP JP2008531616A patent/JP5222729B2/en not_active Expired - Fee Related
- 2006-09-22 WO PCT/EP2006/009226 patent/WO2007039140A1/en not_active Ceased
- 2006-09-22 BR BRPI0616107-3A patent/BRPI0616107A2/en not_active IP Right Cessation
- 2006-09-22 CN CNA2006800350367A patent/CN101273058A/en active Pending
- 2006-09-22 AU AU2006299134A patent/AU2006299134B2/en not_active Ceased
- 2006-09-22 EA EA200800699A patent/EA013796B1/en not_active IP Right Cessation
- 2006-09-22 EP EP10009718A patent/EP2261245A1/en not_active Withdrawn
- 2006-09-22 KR KR1020087009543A patent/KR20080064840A/en not_active Ceased
-
2008
- 2008-01-21 IL IL188904A patent/IL188904A0/en unknown
-
2010
- 2010-02-02 HR HR20100062T patent/HRP20100062T1/en unknown
- 2010-02-11 CY CY20101100139T patent/CY1109778T1/en unknown
-
2012
- 2012-05-29 US US13/482,354 patent/US8853159B2/en not_active Expired - Fee Related
-
2013
- 2013-01-25 JP JP2013012558A patent/JP2013099352A/en active Pending
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8431533B2 (en) | GLP-1 fusion peptides, their production and use | |
| EP1975176A1 (en) | Novel glp-1 fusion peptides, their production and use | |
| EP1972349A1 (en) | GLP-1 fusion peptides conjugated to polymer(s), their production and use | |
| KR101231431B1 (en) | Insulinotropic peptide derivative wherein its N-terminal amino acid is modified | |
| US20070093417A1 (en) | Novel GLP-1 analogues linked to albumin-like agents | |
| KR20210005674A (en) | Glucagon-like peptide 1 (GLP-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof | |
| KR20140088837A (en) | Insulinotropic peptide derivative wherein its N-terminal charge is modified | |
| AU2012202972A1 (en) | GLP-1 fusion peptides, their production and use | |
| HK1143170A (en) | Glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance | |
| HK1151542A (en) | Glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance | |
| HK1129121B (en) | Glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20080110 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR |
|
| 17Q | First examination report despatched |
Effective date: 20091113 |
|
| DAX | Request for extension of the european patent (deleted) | ||
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
| GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
| AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR |
|
| REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: EP |
|
| REG | Reference to a national code |
Ref country code: AT Ref legal event code: REF Ref document number: 573051 Country of ref document: AT Kind code of ref document: T Effective date: 20120915 |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R096 Ref document number: 602006031756 Country of ref document: DE Effective date: 20121025 |
|
| REG | Reference to a national code |
Ref country code: AT Ref legal event code: MK05 Ref document number: 573051 Country of ref document: AT Kind code of ref document: T Effective date: 20120829 |
|
| REG | Reference to a national code |
Ref country code: NL Ref legal event code: VDEP Effective date: 20120829 |
|
| REG | Reference to a national code |
Ref country code: ES Ref legal event code: FG2A Ref document number: 2394218 Country of ref document: ES Kind code of ref document: T3 Effective date: 20130123 |
|
| REG | Reference to a national code |
Ref country code: LT Ref legal event code: MG4D Effective date: 20120829 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20121229 Ref country code: AT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: FI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: CY Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: LT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: DE Payment date: 20121129 Year of fee payment: 7 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LV Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: PT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20121231 Ref country code: BE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: GR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20121130 Ref country code: SI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: SE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: GB Payment date: 20121114 Year of fee payment: 7 Ref country code: ES Payment date: 20121129 Year of fee payment: 7 Ref country code: IT Payment date: 20121129 Year of fee payment: 7 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: FR Payment date: 20121213 Year of fee payment: 7 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: EE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: NL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: RO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: CZ Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: DK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: MC Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120930 |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: PL |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: PL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 Ref country code: SK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: MM4A |
|
| PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: CH Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120930 Ref country code: BG Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20121129 Ref country code: LI Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120930 Ref country code: IE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120922 |
|
| 26N | No opposition filed |
Effective date: 20130530 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R097 Ref document number: 602006031756 Country of ref document: DE Effective date: 20130530 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: TR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20120829 |
|
| GBPC | Gb: european patent ceased through non-payment of renewal fee |
Effective date: 20130922 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LU Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120922 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R119 Ref document number: 602006031756 Country of ref document: DE Effective date: 20140401 |
|
| REG | Reference to a national code |
Ref country code: FR Ref legal event code: ST Effective date: 20140530 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: GB Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20130922 Ref country code: HU Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20060922 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: FR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20130930 Ref country code: DE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20140401 Ref country code: IT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20130922 |
|
| REG | Reference to a national code |
Ref country code: ES Ref legal event code: FD2A Effective date: 20141008 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: ES Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20130923 |


























































