EP1664286A1 - Alcohol dehydrogenases with increased solvent and temperature stability - Google Patents
Alcohol dehydrogenases with increased solvent and temperature stabilityInfo
- Publication number
- EP1664286A1 EP1664286A1 EP04766745A EP04766745A EP1664286A1 EP 1664286 A1 EP1664286 A1 EP 1664286A1 EP 04766745 A EP04766745 A EP 04766745A EP 04766745 A EP04766745 A EP 04766745A EP 1664286 A1 EP1664286 A1 EP 1664286A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- sequence
- alcohol dehydrogenase
- oxidation
- enzyme
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108010021809 Alcohol dehydrogenase Proteins 0.000 title claims abstract description 62
- 102000007698 Alcohol dehydrogenase Human genes 0.000 title claims abstract description 61
- 239000002904 solvent Substances 0.000 title description 7
- 102000004190 Enzymes Human genes 0.000 claims abstract description 155
- 108090000790 Enzymes Proteins 0.000 claims abstract description 155
- 230000000694 effects Effects 0.000 claims abstract description 107
- 238000007254 oxidation reaction Methods 0.000 claims abstract description 46
- 230000003647 oxidation Effects 0.000 claims abstract description 45
- 150000002576 ketones Chemical class 0.000 claims abstract description 41
- 230000009467 reduction Effects 0.000 claims abstract description 41
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 35
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 34
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 34
- 244000005700 microbiome Species 0.000 claims abstract description 33
- 150000003333 secondary alcohols Chemical class 0.000 claims abstract description 27
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 52
- 239000000758 substrate Substances 0.000 claims description 46
- 150000001413 amino acids Chemical class 0.000 claims description 43
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 40
- 238000006243 chemical reaction Methods 0.000 claims description 39
- 229920001184 polypeptide Polymers 0.000 claims description 34
- 108091033319 polynucleotide Proteins 0.000 claims description 30
- 102000040430 polynucleotide Human genes 0.000 claims description 30
- 239000002157 polynucleotide Substances 0.000 claims description 30
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 claims description 27
- 101710088194 Dehydrogenase Proteins 0.000 claims description 26
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 claims description 25
- BAWFJGJZGIEFAR-NNYOXOHSSA-O NAD(+) Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 BAWFJGJZGIEFAR-NNYOXOHSSA-O 0.000 claims description 21
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 claims description 19
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 claims description 17
- WAPNOHKVXSQRPX-UHFFFAOYSA-N 1-phenylethanol Chemical compound CC(O)C1=CC=CC=C1 WAPNOHKVXSQRPX-UHFFFAOYSA-N 0.000 claims description 16
- 150000001298 alcohols Chemical class 0.000 claims description 15
- XPNGNIFUDRPBFJ-UHFFFAOYSA-N alpha-methylbenzylalcohol Natural products CC1=CC=CC=C1CO XPNGNIFUDRPBFJ-UHFFFAOYSA-N 0.000 claims description 14
- 239000002773 nucleotide Substances 0.000 claims description 13
- 125000003729 nucleotide group Chemical group 0.000 claims description 13
- 239000013598 vector Substances 0.000 claims description 13
- 238000013519 translation Methods 0.000 claims description 8
- 238000012217 deletion Methods 0.000 claims description 7
- 230000037430 deletion Effects 0.000 claims description 7
- 238000003780 insertion Methods 0.000 claims description 7
- 230000037431 insertion Effects 0.000 claims description 7
- 230000008859 change Effects 0.000 claims description 4
- 230000000295 complement effect Effects 0.000 claims description 4
- 108010084715 isopropanol dehydrogenase (NADP) Proteins 0.000 claims 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 239000012429 reaction media Substances 0.000 claims 2
- 239000011942 biocatalyst Substances 0.000 abstract description 50
- 241000187563 Rhodococcus ruber Species 0.000 abstract description 29
- 238000002360 preparation method Methods 0.000 abstract description 7
- 230000001590 oxidative effect Effects 0.000 abstract description 2
- 229940088598 enzyme Drugs 0.000 description 105
- 238000000034 method Methods 0.000 description 50
- 210000004027 cell Anatomy 0.000 description 44
- 238000006722 reduction reaction Methods 0.000 description 36
- 238000007792 addition Methods 0.000 description 32
- -1 sec-propyl Chemical group 0.000 description 31
- 108020004414 DNA Proteins 0.000 description 29
- 108090000623 proteins and genes Proteins 0.000 description 29
- 125000000217 alkyl group Chemical group 0.000 description 26
- 229940024606 amino acid Drugs 0.000 description 25
- 239000000872 buffer Substances 0.000 description 25
- KWOLFJPFCHCOCG-UHFFFAOYSA-N Acetophenone Chemical compound CC(=O)C1=CC=CC=C1 KWOLFJPFCHCOCG-UHFFFAOYSA-N 0.000 description 24
- 230000008569 process Effects 0.000 description 21
- 235000018102 proteins Nutrition 0.000 description 20
- 102000004169 proteins and genes Human genes 0.000 description 20
- 238000000746 purification Methods 0.000 description 19
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 18
- 239000013615 primer Substances 0.000 description 18
- 125000001424 substituent group Chemical group 0.000 description 17
- 125000004432 carbon atom Chemical group C* 0.000 description 16
- 125000003545 alkoxy group Chemical group 0.000 description 14
- 125000003282 alkyl amino group Chemical group 0.000 description 12
- 150000003839 salts Chemical class 0.000 description 12
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 11
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 10
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 10
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 10
- 239000000203 mixture Substances 0.000 description 10
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 10
- 238000010561 standard procedure Methods 0.000 description 10
- 229920002684 Sepharose Polymers 0.000 description 9
- 238000010828 elution Methods 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- 230000002378 acidificating effect Effects 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 8
- 239000000284 extract Substances 0.000 description 8
- 239000000499 gel Substances 0.000 description 8
- 229960004592 isopropanol Drugs 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 8
- 238000012216 screening Methods 0.000 description 8
- 238000000926 separation method Methods 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 7
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 7
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 7
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 7
- 108091034117 Oligonucleotide Proteins 0.000 description 7
- 238000005119 centrifugation Methods 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 229960000310 isoleucine Drugs 0.000 description 7
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 7
- 239000012528 membrane Substances 0.000 description 7
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 7
- 238000012163 sequencing technique Methods 0.000 description 7
- 230000009466 transformation Effects 0.000 description 7
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 7
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 6
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 6
- 239000012505 Superdex™ Substances 0.000 description 6
- 239000007983 Tris buffer Substances 0.000 description 6
- 229910052799 carbon Inorganic materials 0.000 description 6
- 239000003480 eluent Substances 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 229910052736 halogen Inorganic materials 0.000 description 6
- 150000002367 halogens Chemical class 0.000 description 6
- 125000000623 heterocyclic group Chemical group 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 239000011541 reaction mixture Substances 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 6
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 6
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 5
- GUBGYTABKSRVRQ-WFVLMXAXSA-N DEAE-cellulose Chemical compound OC1C(O)C(O)C(CO)O[C@H]1O[C@@H]1C(CO)OC(O)C(O)C1O GUBGYTABKSRVRQ-WFVLMXAXSA-N 0.000 description 5
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 5
- 241000235058 Komagataella pastoris Species 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 239000001888 Peptone Substances 0.000 description 5
- 108010080698 Peptones Proteins 0.000 description 5
- 241000316848 Rhodococcus <scale insect> Species 0.000 description 5
- XJLXINKUBYWONI-DQQFMEOOSA-N [[(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-3-hydroxy-4-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2s,3r,4s,5s)-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate Chemical compound NC(=O)C1=CC=C[N+]([C@@H]2[C@H]([C@@H](O)[C@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-DQQFMEOOSA-N 0.000 description 5
- 125000004453 alkoxycarbonyl group Chemical group 0.000 description 5
- 229940041514 candida albicans extract Drugs 0.000 description 5
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 239000013611 chromosomal DNA Substances 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 5
- 229910052751 metal Inorganic materials 0.000 description 5
- 239000002184 metal Substances 0.000 description 5
- 229910052757 nitrogen Inorganic materials 0.000 description 5
- 125000004043 oxo group Chemical group O=* 0.000 description 5
- 235000019319 peptone Nutrition 0.000 description 5
- 229920006395 saturated elastomer Polymers 0.000 description 5
- 229910000162 sodium phosphate Inorganic materials 0.000 description 5
- 230000000707 stereoselective effect Effects 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 239000012138 yeast extract Substances 0.000 description 5
- 108020005199 Dehydrogenases Proteins 0.000 description 4
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 4
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 4
- 125000004423 acyloxy group Chemical group 0.000 description 4
- 125000005236 alkanoylamino group Chemical group 0.000 description 4
- 125000006193 alkinyl group Chemical group 0.000 description 4
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 125000003118 aryl group Chemical group 0.000 description 4
- 230000002210 biocatalytic effect Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 125000001589 carboacyl group Chemical group 0.000 description 4
- 239000003054 catalyst Substances 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 230000029087 digestion Effects 0.000 description 4
- AZOCECCLWFDTAP-UHFFFAOYSA-N dihydrocarvone Chemical compound CC1CCC(C(C)=C)CC1=O AZOCECCLWFDTAP-UHFFFAOYSA-N 0.000 description 4
- 229920001971 elastomer Polymers 0.000 description 4
- 230000007717 exclusion Effects 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 4
- 229910052740 iodine Inorganic materials 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 125000000468 ketone group Chemical group 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 4
- 125000001624 naphthyl group Chemical group 0.000 description 4
- SJWFXCIHNDVPSH-UHFFFAOYSA-N octan-2-ol Chemical compound CCCCCCC(C)O SJWFXCIHNDVPSH-UHFFFAOYSA-N 0.000 description 4
- 229920002401 polyacrylamide Polymers 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- UHEPJGULSIKKTP-UHFFFAOYSA-N sulcatone Chemical compound CC(C)=CCCC(C)=O UHEPJGULSIKKTP-UHFFFAOYSA-N 0.000 description 4
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- ZPVFWPFBNIEHGJ-UHFFFAOYSA-N 2-octanone Chemical compound CCCCCCC(C)=O ZPVFWPFBNIEHGJ-UHFFFAOYSA-N 0.000 description 3
- ZCFOBLITZWHNNC-UHFFFAOYSA-N 3-Octen-2-one Natural products CCCCC=CC(C)=O ZCFOBLITZWHNNC-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 239000003155 DNA primer Substances 0.000 description 3
- 102100031780 Endonuclease Human genes 0.000 description 3
- 241000701959 Escherichia virus Lambda Species 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 238000006036 Oppenauer oxidation reaction Methods 0.000 description 3
- 101710118538 Protease Proteins 0.000 description 3
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 125000003342 alkenyl group Chemical group 0.000 description 3
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- WPGPCDVQHXOMQP-UHFFFAOYSA-N carvotanacetone Natural products CC(C)C1CC=C(C)C(=O)C1 WPGPCDVQHXOMQP-UHFFFAOYSA-N 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000000287 crude extract Substances 0.000 description 3
- ZAJNGDIORYACQU-UHFFFAOYSA-N decan-2-one Chemical compound CCCCCCCCC(C)=O ZAJNGDIORYACQU-UHFFFAOYSA-N 0.000 description 3
- 239000003599 detergent Substances 0.000 description 3
- 235000014113 dietary fatty acids Nutrition 0.000 description 3
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 229930195729 fatty acid Natural products 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 150000004665 fatty acids Chemical class 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- CATSNJVOTSVZJV-UHFFFAOYSA-N heptan-2-one Chemical compound CCCCCC(C)=O CATSNJVOTSVZJV-UHFFFAOYSA-N 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 229910052500 inorganic mineral Inorganic materials 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 230000000813 microbial effect Effects 0.000 description 3
- 235000010755 mineral Nutrition 0.000 description 3
- 239000011707 mineral Substances 0.000 description 3
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 3
- VKCYHJWLYTUGCC-UHFFFAOYSA-N nonan-2-one Chemical compound CCCCCCCC(C)=O VKCYHJWLYTUGCC-UHFFFAOYSA-N 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 238000001556 precipitation Methods 0.000 description 3
- 238000001742 protein purification Methods 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 239000011701 zinc Substances 0.000 description 3
- DNXHEGUUPJUMQT-UHFFFAOYSA-N (+)-estrone Natural products OC1=CC=C2C3CCC(C)(C(CC4)=O)C4C3CCC2=C1 DNXHEGUUPJUMQT-UHFFFAOYSA-N 0.000 description 2
- BQPPJGMMIYJVBR-UHFFFAOYSA-N (10S)-3c-Acetoxy-4.4.10r.13c.14t-pentamethyl-17c-((R)-1.5-dimethyl-hexen-(4)-yl)-(5tH)-Delta8-tetradecahydro-1H-cyclopenta[a]phenanthren Natural products CC12CCC(OC(C)=O)C(C)(C)C1CCC1=C2CCC2(C)C(C(CCC=C(C)C)C)CCC21C BQPPJGMMIYJVBR-UHFFFAOYSA-N 0.000 description 2
- CHGIKSSZNBCNDW-UHFFFAOYSA-N (3beta,5alpha)-4,4-Dimethylcholesta-8,24-dien-3-ol Natural products CC12CCC(O)C(C)(C)C1CCC1=C2CCC2(C)C(C(CCC=C(C)C)C)CCC21 CHGIKSSZNBCNDW-UHFFFAOYSA-N 0.000 description 2
- 239000001764 (E)-oct-3-en-2-one Substances 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- RIFKADJTWUGDOV-UHFFFAOYSA-N 1-cyclohexylethanone Chemical compound CC(=O)C1CCCCC1 RIFKADJTWUGDOV-UHFFFAOYSA-N 0.000 description 2
- XYTLYKGXLMKYMV-UHFFFAOYSA-N 14alpha-methylzymosterol Natural products CC12CCC(O)CC1CCC1=C2CCC2(C)C(C(CCC=C(C)C)C)CCC21C XYTLYKGXLMKYMV-UHFFFAOYSA-N 0.000 description 2
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 2
- ZCFOBLITZWHNNC-VOTSOKGWSA-N 3-Octen-2-one Chemical compound CCCC\C=C\C(C)=O ZCFOBLITZWHNNC-VOTSOKGWSA-N 0.000 description 2
- RHLVCLIPMVJYKS-UHFFFAOYSA-N 3-octanone Chemical compound CCCCCC(=O)CC RHLVCLIPMVJYKS-UHFFFAOYSA-N 0.000 description 2
- FPTJELQXIUUCEY-UHFFFAOYSA-N 3beta-Hydroxy-lanostan Natural products C1CC2C(C)(C)C(O)CCC2(C)C2C1C1(C)CCC(C(C)CCCC(C)C)C1(C)CC2 FPTJELQXIUUCEY-UHFFFAOYSA-N 0.000 description 2
- QGXBDMJGAMFCBF-HLUDHZFRSA-N 5α-Androsterone Chemical compound C1[C@H](O)CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC[C@H]21 QGXBDMJGAMFCBF-HLUDHZFRSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- PQSUYGKTWSAVDQ-ZVIOFETBSA-N Aldosterone Chemical compound C([C@@]1([C@@H](C(=O)CO)CC[C@H]1[C@@H]1CC2)C=O)[C@H](O)[C@@H]1[C@]1(C)C2=CC(=O)CC1 PQSUYGKTWSAVDQ-ZVIOFETBSA-N 0.000 description 2
- PQSUYGKTWSAVDQ-UHFFFAOYSA-N Aldosterone Natural products C1CC2C3CCC(C(=O)CO)C3(C=O)CC(O)C2C2(C)C1=CC(=O)CC2 PQSUYGKTWSAVDQ-UHFFFAOYSA-N 0.000 description 2
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 2
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- OMFXVFTZEKFJBZ-UHFFFAOYSA-N Corticosterone Natural products O=C1CCC2(C)C3C(O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 OMFXVFTZEKFJBZ-UHFFFAOYSA-N 0.000 description 2
- NOOLISFMXDJSKH-UHFFFAOYSA-N DL-menthol Natural products CC(C)C1CCC(C)CC1O NOOLISFMXDJSKH-UHFFFAOYSA-N 0.000 description 2
- 102000004594 DNA Polymerase I Human genes 0.000 description 2
- 108010017826 DNA Polymerase I Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- DNXHEGUUPJUMQT-CBZIJGRNSA-N Estrone Chemical compound OC1=CC=C2[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1 DNXHEGUUPJUMQT-CBZIJGRNSA-N 0.000 description 2
- QGXBDMJGAMFCBF-UHFFFAOYSA-N Etiocholanolone Natural products C1C(O)CCC2(C)C3CCC(C)(C(CC4)=O)C4C3CCC21 QGXBDMJGAMFCBF-UHFFFAOYSA-N 0.000 description 2
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- GLZPCOQZEFWAFX-UHFFFAOYSA-N Geraniol Chemical compound CC(C)=CCCC(C)=CCO GLZPCOQZEFWAFX-UHFFFAOYSA-N 0.000 description 2
- BKLIAINBCQPSOV-UHFFFAOYSA-N Gluanol Natural products CC(C)CC=CC(C)C1CCC2(C)C3=C(CCC12C)C4(C)CCC(O)C(C)(C)C4CC3 BKLIAINBCQPSOV-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 229930010555 Inosine Natural products 0.000 description 2
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical group O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 2
- LOPKHWOTGJIQLC-UHFFFAOYSA-N Lanosterol Natural products CC(CCC=C(C)C)C1CCC2(C)C3=C(CCC12C)C4(C)CCC(C)(O)C(C)(C)C4CC3 LOPKHWOTGJIQLC-UHFFFAOYSA-N 0.000 description 2
- 102000003960 Ligases Human genes 0.000 description 2
- 108090000364 Ligases Proteins 0.000 description 2
- 101710122864 Major tegument protein Proteins 0.000 description 2
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 2
- CAHGCLMLTWQZNJ-UHFFFAOYSA-N Nerifoliol Natural products CC12CCC(O)C(C)(C)C1CCC1=C2CCC2(C)C(C(CCC=C(C)C)C)CCC21C CAHGCLMLTWQZNJ-UHFFFAOYSA-N 0.000 description 2
- DFPAKSUCGFBDDF-UHFFFAOYSA-N Nicotinamide Chemical compound NC(=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-UHFFFAOYSA-N 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 108010058846 Ovalbumin Proteins 0.000 description 2
- 101710148592 PTS system fructose-like EIIA component Proteins 0.000 description 2
- 101710169713 PTS system fructose-specific EIIA component Proteins 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 2
- 101710199973 Tail tube protein Proteins 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 229960002478 aldosterone Drugs 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229940061641 androsterone Drugs 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 2
- 125000000499 benzofuranyl group Chemical group O1C(=CC2=C1C=CC=C2)* 0.000 description 2
- 230000036983 biotransformation Effects 0.000 description 2
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 2
- 229910052794 bromium Inorganic materials 0.000 description 2
- 150000001721 carbon Chemical group 0.000 description 2
- ULDHMXUKGWMISQ-UHFFFAOYSA-N carvone Chemical compound CC(=C)C1CC=C(C)C(=O)C1 ULDHMXUKGWMISQ-UHFFFAOYSA-N 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000000460 chlorine Substances 0.000 description 2
- 229910052801 chlorine Inorganic materials 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 125000004230 chromenyl group Chemical group O1C(C=CC2=CC=CC=C12)* 0.000 description 2
- YKCWQPZFAFZLBI-UHFFFAOYSA-N cibacron blue Chemical compound C1=2C(=O)C3=CC=CC=C3C(=O)C=2C(N)=C(S(O)(=O)=O)C=C1NC(C=C1S(O)(=O)=O)=CC=C1NC(N=1)=NC(Cl)=NC=1NC1=CC=CC=C1S(O)(=O)=O YKCWQPZFAFZLBI-UHFFFAOYSA-N 0.000 description 2
- OMFXVFTZEKFJBZ-HJTSIMOOSA-N corticosterone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@H](CC4)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OMFXVFTZEKFJBZ-HJTSIMOOSA-N 0.000 description 2
- 239000013601 cosmid vector Substances 0.000 description 2
- 125000004093 cyano group Chemical group *C#N 0.000 description 2
- JHIVVAPYMSGYDF-UHFFFAOYSA-N cyclohexanone Chemical compound O=C1CCCCC1 JHIVVAPYMSGYDF-UHFFFAOYSA-N 0.000 description 2
- XCIXKGXIYUWCLL-UHFFFAOYSA-N cyclopentanol Chemical compound OC1CCCC1 XCIXKGXIYUWCLL-UHFFFAOYSA-N 0.000 description 2
- BGTOWKSIORTVQH-UHFFFAOYSA-N cyclopentanone Chemical compound O=C1CCCC1 BGTOWKSIORTVQH-UHFFFAOYSA-N 0.000 description 2
- AZOCECCLWFDTAP-RKDXNWHRSA-N dihydrocarvone Natural products C[C@@H]1CC[C@@H](C(C)=C)CC1=O AZOCECCLWFDTAP-RKDXNWHRSA-N 0.000 description 2
- QBSJHOGDIUQWTH-UHFFFAOYSA-N dihydrolanosterol Natural products CC(C)CCCC(C)C1CCC2(C)C3=C(CCC12C)C4(C)CCC(C)(O)C(C)(C)C4CC3 QBSJHOGDIUQWTH-UHFFFAOYSA-N 0.000 description 2
- 238000004821 distillation Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 239000012149 elution buffer Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 229960003399 estrone Drugs 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 229910052731 fluorine Inorganic materials 0.000 description 2
- 239000011737 fluorine Substances 0.000 description 2
- 230000037433 frameshift Effects 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 235000001727 glucose Nutrition 0.000 description 2
- 125000005842 heteroatom Chemical group 0.000 description 2
- 229960000890 hydrocortisone Drugs 0.000 description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- XLSMFKSTNGKWQX-UHFFFAOYSA-N hydroxyacetone Chemical compound CC(=O)CO XLSMFKSTNGKWQX-UHFFFAOYSA-N 0.000 description 2
- 125000002883 imidazolyl group Chemical group 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 229960003786 inosine Drugs 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- PHTQWCKDNZKARW-UHFFFAOYSA-N isoamylol Chemical compound CC(C)CCO PHTQWCKDNZKARW-UHFFFAOYSA-N 0.000 description 2
- CAHGCLMLTWQZNJ-RGEKOYMOSA-N lanosterol Chemical compound C([C@]12C)C[C@@H](O)C(C)(C)[C@H]1CCC1=C2CC[C@]2(C)[C@H]([C@H](CCC=C(C)C)C)CC[C@@]21C CAHGCLMLTWQZNJ-RGEKOYMOSA-N 0.000 description 2
- 229940058690 lanosterol Drugs 0.000 description 2
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- NMRPBPVERJPACX-UHFFFAOYSA-N octan-3-ol Chemical compound CCCCCC(O)CC NMRPBPVERJPACX-UHFFFAOYSA-N 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 229940092253 ovalbumin Drugs 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- QCCDLTOVEPVEJK-UHFFFAOYSA-N phenylacetone Chemical compound CC(=O)CC1=CC=CC=C1 QCCDLTOVEPVEJK-UHFFFAOYSA-N 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000002203 pretreatment Methods 0.000 description 2
- 238000002731 protein assay Methods 0.000 description 2
- 125000003373 pyrazinyl group Chemical group 0.000 description 2
- 125000002294 quinazolinyl group Chemical group N1=C(N=CC2=CC=CC=C12)* 0.000 description 2
- 238000004064 recycling Methods 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 239000012723 sample buffer Substances 0.000 description 2
- 238000007086 side reaction Methods 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 2
- 239000012453 solvate Chemical class 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 239000011593 sulfur Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000004885 tandem mass spectrometry Methods 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 229960003604 testosterone Drugs 0.000 description 2
- 150000003648 triterpenes Chemical class 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- FQTLCLSUCSAZDY-UHFFFAOYSA-N (+) E(S) nerolidol Natural products CC(C)=CCCC(C)=CCCC(C)(O)C=C FQTLCLSUCSAZDY-UHFFFAOYSA-N 0.000 description 1
- NOOLISFMXDJSKH-UTLUCORTSA-N (+)-Neomenthol Chemical compound CC(C)[C@@H]1CC[C@@H](C)C[C@@H]1O NOOLISFMXDJSKH-UTLUCORTSA-N 0.000 description 1
- DTGKSKDOIYIVQL-WEDXCCLWSA-N (+)-borneol Chemical compound C1C[C@@]2(C)[C@@H](O)C[C@@H]1C2(C)C DTGKSKDOIYIVQL-WEDXCCLWSA-N 0.000 description 1
- NFLGAXVYCFJBMK-RKDXNWHRSA-N (+)-isomenthone Natural products CC(C)[C@H]1CC[C@@H](C)CC1=O NFLGAXVYCFJBMK-RKDXNWHRSA-N 0.000 description 1
- NZGWDASTMWDZIW-MRVPVSSYSA-N (+)-pulegone Chemical compound C[C@@H]1CCC(=C(C)C)C(=O)C1 NZGWDASTMWDZIW-MRVPVSSYSA-N 0.000 description 1
- PROQIPRRNZUXQM-UHFFFAOYSA-N (16alpha,17betaOH)-Estra-1,3,5(10)-triene-3,16,17-triol Natural products OC1=CC=C2C3CCC(C)(C(C(O)C4)O)C4C3CCC2=C1 PROQIPRRNZUXQM-UHFFFAOYSA-N 0.000 description 1
- LABTWGUMFABVFG-ONEGZZNKSA-N (3E)-pent-3-en-2-one Chemical compound C\C=C\C(C)=O LABTWGUMFABVFG-ONEGZZNKSA-N 0.000 description 1
- RHAXCOKCIAVHPB-JTQLQIEISA-N (4s)-2-methyl-6-methylideneoct-7-en-4-ol Chemical compound CC(C)C[C@H](O)CC(=C)C=C RHAXCOKCIAVHPB-JTQLQIEISA-N 0.000 description 1
- QYIXCDOBOSTCEI-BPAAZKTESA-N (8r,9s,10s,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-3-ol Chemical compound C1CC2CC(O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 QYIXCDOBOSTCEI-BPAAZKTESA-N 0.000 description 1
- DCSCXTJOXBUFGB-JGVFFNPUSA-N (R)-(+)-Verbenone Natural products CC1=CC(=O)[C@@H]2C(C)(C)[C@H]1C2 DCSCXTJOXBUFGB-JGVFFNPUSA-N 0.000 description 1
- DCSCXTJOXBUFGB-SFYZADRCSA-N (R)-(+)-verbenone Chemical compound CC1=CC(=O)[C@H]2C(C)(C)[C@@H]1C2 DCSCXTJOXBUFGB-SFYZADRCSA-N 0.000 description 1
- DSSYKIVIOFKYAU-XCBNKYQSSA-N (R)-camphor Chemical compound C1C[C@@]2(C)C(=O)C[C@@H]1C2(C)C DSSYKIVIOFKYAU-XCBNKYQSSA-N 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical class C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- VXNZUUAINFGPBY-UHFFFAOYSA-N 1-Butene Chemical group CCC=C VXNZUUAINFGPBY-UHFFFAOYSA-N 0.000 description 1
- DZFNSCGIRLNKLF-UHFFFAOYSA-N 1-dodecyl-4,5-dihydroimidazole-4,5-dicarboxylic acid;sodium Chemical compound [Na].CCCCCCCCCCCCN1C=NC(C(O)=O)C1C(O)=O DZFNSCGIRLNKLF-UHFFFAOYSA-N 0.000 description 1
- 125000001637 1-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C(*)=C([H])C([H])=C([H])C2=C1[H] 0.000 description 1
- YBYIRNPNPLQARY-UHFFFAOYSA-N 1H-indene Natural products C1=CC=C2CC=CC2=C1 YBYIRNPNPLQARY-UHFFFAOYSA-N 0.000 description 1
- OWDHNYUHCPSQFR-UHFFFAOYSA-N 2,4-diphenylpentan-3-one Chemical compound C=1C=CC=CC=1C(C)C(=O)C(C)C1=CC=CC=C1 OWDHNYUHCPSQFR-UHFFFAOYSA-N 0.000 description 1
- ZWEHNKRNPOVVGH-UHFFFAOYSA-N 2-Butanone Chemical compound CCC(C)=O ZWEHNKRNPOVVGH-UHFFFAOYSA-N 0.000 description 1
- QQZOPKMRPOGIEB-UHFFFAOYSA-N 2-Oxohexane Chemical compound CCCCC(C)=O QQZOPKMRPOGIEB-UHFFFAOYSA-N 0.000 description 1
- IEMMBWWQXVXBEU-UHFFFAOYSA-N 2-acetylfuran Chemical compound CC(=O)C1=CC=CO1 IEMMBWWQXVXBEU-UHFFFAOYSA-N 0.000 description 1
- CETWDUZRCINIHU-UHFFFAOYSA-N 2-heptanol Chemical compound CCCCCC(C)O CETWDUZRCINIHU-UHFFFAOYSA-N 0.000 description 1
- LFSAPCRASZRSKS-UHFFFAOYSA-N 2-methylcyclohexan-1-one Chemical compound CC1CCCCC1=O LFSAPCRASZRSKS-UHFFFAOYSA-N 0.000 description 1
- 125000001622 2-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C(*)C([H])=C([H])C2=C1[H] 0.000 description 1
- NGDNVOAEIVQRFH-UHFFFAOYSA-N 2-nonanol Chemical compound CCCCCCCC(C)O NGDNVOAEIVQRFH-UHFFFAOYSA-N 0.000 description 1
- JYVLIDXNZAXMDK-UHFFFAOYSA-N 2-pentanol Substances CCCC(C)O JYVLIDXNZAXMDK-UHFFFAOYSA-N 0.000 description 1
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 1
- NMRPBPVERJPACX-QMMMGPOBSA-N 3-Octanol Natural products CCCCC[C@@H](O)CC NMRPBPVERJPACX-QMMMGPOBSA-N 0.000 description 1
- VSBUQMYYRYOPLH-UHFFFAOYSA-N 3-methyl-2-oxo-4-phenylbutanoic acid Chemical compound OC(=O)C(=O)C(C)CC1=CC=CC=C1 VSBUQMYYRYOPLH-UHFFFAOYSA-N 0.000 description 1
- CNJLMVZFWLNOEP-UHFFFAOYSA-N 4,7,7-trimethylbicyclo[4.1.0]heptan-5-one Chemical compound O=C1C(C)CCC2C(C)(C)C12 CNJLMVZFWLNOEP-UHFFFAOYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- GDWRKZLROIFUML-UHFFFAOYSA-N 4-phenylbutan-2-ol Chemical compound CC(O)CCC1=CC=CC=C1 GDWRKZLROIFUML-UHFFFAOYSA-N 0.000 description 1
- 125000001572 5'-adenylyl group Chemical group C=12N=C([H])N=C(N([H])[H])C=1N=C([H])N2[C@@]1([H])[C@@](O[H])([H])[C@@](O[H])([H])[C@](C(OP(=O)(O[H])[*])([H])[H])([H])O1 0.000 description 1
- FYMBAYNKBWGEIK-UHFFFAOYSA-N 5-methylheptan-2-ol Chemical compound CCC(C)CCC(C)O FYMBAYNKBWGEIK-UHFFFAOYSA-N 0.000 description 1
- WYDAUGNQLUXTFB-UHFFFAOYSA-N 5-methylheptan-2-one Chemical compound CCC(C)CCC(C)=O WYDAUGNQLUXTFB-UHFFFAOYSA-N 0.000 description 1
- RXGJTUSBYWCRBK-UHFFFAOYSA-M 5-methylphenazinium methyl sulfate Chemical compound COS([O-])(=O)=O.C1=CC=C2[N+](C)=C(C=CC=C3)C3=NC2=C1 RXGJTUSBYWCRBK-UHFFFAOYSA-M 0.000 description 1
- RLYSXAZAJUMULG-UHFFFAOYSA-N 6-methyl-3-propan-2-ylcyclohex-2-en-1-one Chemical compound CC(C)C1=CC(=O)C(C)CC1 RLYSXAZAJUMULG-UHFFFAOYSA-N 0.000 description 1
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 1
- IKHGUXGNUITLKF-UHFFFAOYSA-N Acetaldehyde Chemical compound CC=O IKHGUXGNUITLKF-UHFFFAOYSA-N 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- FVVDKUPCWXUVNP-UHFFFAOYSA-M Aminosalicylate sodium anhydrous Chemical compound [Na+].NC1=CC=C(C([O-])=O)C(O)=C1 FVVDKUPCWXUVNP-UHFFFAOYSA-M 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- 101001053395 Arabidopsis thaliana Acid beta-fructofuranosidase 4, vacuolar Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 239000002028 Biomass Substances 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- VOZHMAYHYHEWBW-NVOOAVKYSA-N Bufotalin Chemical compound C=1([C@@H]2[C@@]3(C)CC[C@@H]4[C@@]5(C)CC[C@H](O)C[C@H]5CC[C@H]4[C@@]3(O)C[C@@H]2OC(=O)C)C=CC(=O)OC=1 VOZHMAYHYHEWBW-NVOOAVKYSA-N 0.000 description 1
- VOZHMAYHYHEWBW-UHFFFAOYSA-N Bufotalin Natural products CC(=O)OC1CC2(O)C3CCC4CC(O)CCC4(C)C3CCC2(C)C1C=1C=CC(=O)OC=1 VOZHMAYHYHEWBW-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 102000003846 Carbonic anhydrases Human genes 0.000 description 1
- 108090000209 Carbonic anhydrases Proteins 0.000 description 1
- 102000003670 Carboxypeptidase B Human genes 0.000 description 1
- 108090000087 Carboxypeptidase B Proteins 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 108010080937 Carboxypeptidases A Proteins 0.000 description 1
- 102000000496 Carboxypeptidases A Human genes 0.000 description 1
- 239000005973 Carvone Substances 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 108010038061 Chymotrypsinogen Proteins 0.000 description 1
- 241000723346 Cinnamomum camphora Species 0.000 description 1
- 241001478240 Coccus Species 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 108010059378 Endopeptidases Proteins 0.000 description 1
- 102000005593 Endopeptidases Human genes 0.000 description 1
- 102000005486 Epoxide hydrolase Human genes 0.000 description 1
- 108020002908 Epoxide hydrolase Proteins 0.000 description 1
- QSVJYFLQYMVBDR-UHFFFAOYSA-N Ergosterin Natural products C1C(O)CCC2(C)C3=CCC4(C)C(C(C)C=CC(C)C(C)C)CCC4C3=CC=C21 QSVJYFLQYMVBDR-UHFFFAOYSA-N 0.000 description 1
- DNVPQKQSNYMLRS-NXVQYWJNSA-N Ergosterol Natural products CC(C)[C@@H](C)C=C[C@H](C)[C@H]1CC[C@H]2C3=CC=C4C[C@@H](O)CC[C@]4(C)[C@@H]3CC[C@]12C DNVPQKQSNYMLRS-NXVQYWJNSA-N 0.000 description 1
- 101000617479 Escherichia coli (strain K12) PTS system fructose-like EIIA component Proteins 0.000 description 1
- 241000701533 Escherichia virus T4 Species 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- XXRCUYVCPSWGCC-UHFFFAOYSA-N Ethyl pyruvate Chemical compound CCOC(=O)C(C)=O XXRCUYVCPSWGCC-UHFFFAOYSA-N 0.000 description 1
- 239000005977 Ethylene Substances 0.000 description 1
- 108010091443 Exopeptidases Proteins 0.000 description 1
- 102000018389 Exopeptidases Human genes 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 239000005792 Geraniol Substances 0.000 description 1
- GLZPCOQZEFWAFX-YFHOEESVSA-N Geraniol Natural products CC(C)=CCC\C(C)=C/CO GLZPCOQZEFWAFX-YFHOEESVSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- RHAXCOKCIAVHPB-UHFFFAOYSA-N Ipsenol-d Natural products CC(C)CC(O)CC(=C)C=C RHAXCOKCIAVHPB-UHFFFAOYSA-N 0.000 description 1
- DTGKSKDOIYIVQL-MRTMQBJTSA-N Isoborneol Natural products C1C[C@@]2(C)[C@H](O)C[C@@H]1C2(C)C DTGKSKDOIYIVQL-MRTMQBJTSA-N 0.000 description 1
- RRHGJUQNOFWUDK-UHFFFAOYSA-N Isoprene Chemical class CC(=C)C=C RRHGJUQNOFWUDK-UHFFFAOYSA-N 0.000 description 1
- 102000004407 Lactalbumin Human genes 0.000 description 1
- 108090000942 Lactalbumin Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102100033468 Lysozyme C Human genes 0.000 description 1
- NFLGAXVYCFJBMK-UHFFFAOYSA-N Menthone Chemical compound CC(C)C1CCC(C)CC1=O NFLGAXVYCFJBMK-UHFFFAOYSA-N 0.000 description 1
- WRQNANDWMGAFTP-UHFFFAOYSA-N Methylacetoacetic acid Chemical compound COC(=O)CC(C)=O WRQNANDWMGAFTP-UHFFFAOYSA-N 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- FQTLCLSUCSAZDY-ATGUSINASA-N Nerolidol Chemical compound CC(C)=CCC\C(C)=C\CC[C@](C)(O)C=C FQTLCLSUCSAZDY-ATGUSINASA-N 0.000 description 1
- 108010033272 Nitrilase Proteins 0.000 description 1
- 241001306288 Ophrys fuciflora Species 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 108010030544 Peptidyl-Lys metalloendopeptidase Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- NZGWDASTMWDZIW-UHFFFAOYSA-N Pulegone Natural products CC1CCC(=C(C)C)C(=O)C1 NZGWDASTMWDZIW-UHFFFAOYSA-N 0.000 description 1
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical class C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- NLDBCFRIELDMRO-UHFFFAOYSA-N Stigmasterin Natural products CCCC(CC)C=CC(C)C1CCC2C3CC=C4CC(O)CCC4(C)C3CCC12C NLDBCFRIELDMRO-UHFFFAOYSA-N 0.000 description 1
- ODJLBQGVINUMMR-UHFFFAOYSA-N Strophanthidin Natural products CC12CCC(C3(CCC(O)CC3(O)CC3)C=O)C3C1(O)CCC2C1=CC(=O)OC1 ODJLBQGVINUMMR-UHFFFAOYSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 108090001109 Thermolysin Proteins 0.000 description 1
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 108010027252 Trypsinogen Proteins 0.000 description 1
- 102000018690 Trypsinogen Human genes 0.000 description 1
- XZTUSOXSLKTKJQ-UHFFFAOYSA-N Uzarigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C1(O)CCC2C1=CC(=O)OC1 XZTUSOXSLKTKJQ-UHFFFAOYSA-N 0.000 description 1
- IJCWFDPJFXGQBN-RYNSOKOISA-N [(2R)-2-[(2R,3R,4S)-4-hydroxy-3-octadecanoyloxyoxolan-2-yl]-2-octadecanoyloxyethyl] octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCCCCCCCCCCCC IJCWFDPJFXGQBN-RYNSOKOISA-N 0.000 description 1
- XAKBSHICSHRJCL-UHFFFAOYSA-N [CH2]C(=O)C1=CC=CC=C1 Chemical group [CH2]C(=O)C1=CC=CC=C1 XAKBSHICSHRJCL-UHFFFAOYSA-N 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 150000001338 aliphatic hydrocarbons Chemical class 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 125000005210 alkyl ammonium group Chemical group 0.000 description 1
- 125000005115 alkyl carbamoyl group Chemical group 0.000 description 1
- 125000004390 alkyl sulfonyl group Chemical group 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- QYIXCDOBOSTCEI-UHFFFAOYSA-N alpha-cholestanol Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(C)CCCC(C)C)C1(C)CC2 QYIXCDOBOSTCEI-UHFFFAOYSA-N 0.000 description 1
- USMNOWBWPHYOEA-UHFFFAOYSA-N alpha-thujone Natural products CC1C(=O)CC2(C(C)C)C1C2 USMNOWBWPHYOEA-UHFFFAOYSA-N 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 125000004397 aminosulfonyl group Chemical group NS(=O)(=O)* 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 125000005428 anthryl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C3C(*)=C([H])C([H])=C([H])C3=C([H])C2=C1[H] 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229960004405 aprotinin Drugs 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 150000004945 aromatic hydrocarbons Chemical class 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 238000010533 azeotropic distillation Methods 0.000 description 1
- 125000004045 azirinyl group Chemical group 0.000 description 1
- 125000003828 azulenyl group Chemical group 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000000721 bacterilogical effect Effects 0.000 description 1
- 238000010923 batch production Methods 0.000 description 1
- RWCCWEUUXYIKHB-UHFFFAOYSA-N benzophenone Chemical compound C=1C=CC=CC=1C(=O)C1=CC=CC=C1 RWCCWEUUXYIKHB-UHFFFAOYSA-N 0.000 description 1
- 239000012965 benzophenone Substances 0.000 description 1
- 125000004196 benzothienyl group Chemical group S1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 description 1
- NJKOMDUNNDKEAI-UHFFFAOYSA-N beta-sitosterol Natural products CCC(CCC(C)C1CCC2(C)C3CC=C4CC(O)CCC4C3CCC12C)C(C)C NJKOMDUNNDKEAI-UHFFFAOYSA-N 0.000 description 1
- CKDOCTFBFTVPSN-UHFFFAOYSA-N borneol Natural products C1CC2(C)C(C)CC1C2(C)C CKDOCTFBFTVPSN-UHFFFAOYSA-N 0.000 description 1
- ZADPBFCGQRWHPN-UHFFFAOYSA-N boronic acid Chemical compound OBO ZADPBFCGQRWHPN-UHFFFAOYSA-N 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 125000001246 bromo group Chemical group Br* 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- BTANRVKWQNVYAZ-UHFFFAOYSA-N butan-2-ol Chemical compound CCC(C)O BTANRVKWQNVYAZ-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 229930008380 camphor Natural products 0.000 description 1
- 229960000846 camphor Drugs 0.000 description 1
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 1
- 125000000609 carbazolyl group Chemical group C1(=CC=CC=2C3=CC=CC=C3NC12)* 0.000 description 1
- 150000001728 carbonyl compounds Chemical class 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 108010054847 carboxypeptidase P Proteins 0.000 description 1
- 235000021466 carotenoid Nutrition 0.000 description 1
- 150000001747 carotenoids Chemical class 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000003850 cellular structure Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 1
- YMKDRGPMQRFJGP-UHFFFAOYSA-M cetylpyridinium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 YMKDRGPMQRFJGP-UHFFFAOYSA-M 0.000 description 1
- 238000011944 chemoselective reduction Methods 0.000 description 1
- 125000001309 chloro group Chemical group Cl* 0.000 description 1
- CRQQGFGUEAVUIL-UHFFFAOYSA-N chlorothalonil Chemical compound ClC1=C(Cl)C(C#N)=C(Cl)C(C#N)=C1Cl CRQQGFGUEAVUIL-UHFFFAOYSA-N 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 235000019416 cholic acid Nutrition 0.000 description 1
- 239000002812 cholic acid derivative Substances 0.000 description 1
- 150000001842 cholic acids Chemical class 0.000 description 1
- 125000003016 chromanyl group Chemical group O1C(CCC2=CC=CC=C12)* 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 125000000259 cinnolinyl group Chemical group N1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 239000006184 cosolvent Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- CGZZMOTZOONQIA-UHFFFAOYSA-N cycloheptanone Chemical compound O=C1CCCCCC1 CGZZMOTZOONQIA-UHFFFAOYSA-N 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 1
- 230000009849 deactivation Effects 0.000 description 1
- ACUZDYFTRHEKOS-UHFFFAOYSA-N decan-2-ol Chemical compound CCCCCCCCC(C)O ACUZDYFTRHEKOS-UHFFFAOYSA-N 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- 238000011026 diafiltration Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 125000005509 dibenzothiophenyl group Chemical group 0.000 description 1
- 235000013681 dietary sucrose Nutrition 0.000 description 1
- XZTUSOXSLKTKJQ-CESUGQOBSA-N digitoxigenin Chemical compound C1([C@H]2CC[C@]3(O)[C@H]4[C@@H]([C@]5(CC[C@H](O)C[C@H]5CC4)C)CC[C@@]32C)=CC(=O)OC1 XZTUSOXSLKTKJQ-CESUGQOBSA-N 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- QILSFLSDHQAZET-UHFFFAOYSA-N diphenylmethanol Chemical compound C=1C=CC=CC=1C(O)C1=CC=CC=C1 QILSFLSDHQAZET-UHFFFAOYSA-N 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 125000005303 dithiazolyl group Chemical group S1SNC(=C1)* 0.000 description 1
- DTGKSKDOIYIVQL-UHFFFAOYSA-N dl-isoborneol Natural products C1CC2(C)C(O)CC1C2(C)C DTGKSKDOIYIVQL-UHFFFAOYSA-N 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 239000006167 equilibration buffer Substances 0.000 description 1
- DNVPQKQSNYMLRS-APGDWVJJSA-N ergosterol Chemical compound C1[C@@H](O)CC[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@H](C)/C=C/[C@H](C)C(C)C)CC[C@H]33)C)C3=CC=C21 DNVPQKQSNYMLRS-APGDWVJJSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- PROQIPRRNZUXQM-ZXXIGWHRSA-N estriol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H]([C@H](O)C4)O)[C@@H]4[C@@H]3CCC2=C1 PROQIPRRNZUXQM-ZXXIGWHRSA-N 0.000 description 1
- 229960001348 estriol Drugs 0.000 description 1
- VICYTAYPKBLQFB-UHFFFAOYSA-N ethyl 3-bromo-2-oxopropanoate Chemical compound CCOC(=O)C(=O)CBr VICYTAYPKBLQFB-UHFFFAOYSA-N 0.000 description 1
- CKTYYUQUWFEUCO-UHFFFAOYSA-N ethyl 3-methyl-2-oxobutanoate Chemical compound CCOC(=O)C(=O)C(C)C CKTYYUQUWFEUCO-UHFFFAOYSA-N 0.000 description 1
- XYIBRDXRRQCHLP-UHFFFAOYSA-N ethyl acetoacetate Chemical compound CCOC(=O)CC(C)=O XYIBRDXRRQCHLP-UHFFFAOYSA-N 0.000 description 1
- FGMDOUDLWLDKSF-UHFFFAOYSA-N ethyl hydrogen sulfate;10-methyl-5h-phenazine Chemical compound CCOS(O)(=O)=O.C1=CC=C2N(C)C3=CC=CC=C3NC2=C1 FGMDOUDLWLDKSF-UHFFFAOYSA-N 0.000 description 1
- QKLCQKPAECHXCQ-UHFFFAOYSA-N ethyl phenylglyoxylate Chemical compound CCOC(=O)C(=O)C1=CC=CC=C1 QKLCQKPAECHXCQ-UHFFFAOYSA-N 0.000 description 1
- 229940117360 ethyl pyruvate Drugs 0.000 description 1
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 125000003838 furazanyl group Chemical group 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 238000004817 gas chromatography Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229940113087 geraniol Drugs 0.000 description 1
- 102000034238 globular proteins Human genes 0.000 description 1
- 108091005896 globular proteins Proteins 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- IFSYJVQRVQMRKN-UHFFFAOYSA-N hept-5-en-2-ol Chemical compound CC=CCCC(C)O IFSYJVQRVQMRKN-UHFFFAOYSA-N 0.000 description 1
- RTYRONIMTRDBLT-UHFFFAOYSA-N hept-5-en-2-one Chemical compound CC=CCCC(C)=O RTYRONIMTRDBLT-UHFFFAOYSA-N 0.000 description 1
- QNVRIHYSUZMSGM-UHFFFAOYSA-N hexan-2-ol Chemical compound CCCCC(C)O QNVRIHYSUZMSGM-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 239000012761 high-performance material Substances 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 125000002632 imidazolidinyl group Chemical group 0.000 description 1
- 150000002462 imidazolines Chemical class 0.000 description 1
- 230000014726 immortalization of host cell Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 125000003453 indazolyl group Chemical group N1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000003454 indenyl group Chemical group C1(C=CC2=CC=CC=C12)* 0.000 description 1
- 125000003406 indolizinyl group Chemical group C=1(C=CN2C=CC=CC12)* 0.000 description 1
- 125000001041 indolyl group Chemical group 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000001095 inductively coupled plasma mass spectrometry Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 125000001977 isobenzofuranyl group Chemical group C=1(OC=C2C=CC=CC12)* 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 125000003384 isochromanyl group Chemical group C1(OCCC2=CC=CC=C12)* 0.000 description 1
- 125000000904 isoindolyl group Chemical group C=1(NC=C2C=CC=CC12)* 0.000 description 1
- 125000001786 isothiazolyl group Chemical group 0.000 description 1
- 125000000842 isoxazolyl group Chemical group 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 150000004668 long chain fatty acids Chemical class 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229940041616 menthol Drugs 0.000 description 1
- 229930007503 menthone Natural products 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- YLHXLHGIAMFFBU-UHFFFAOYSA-N methyl phenylglyoxalate Chemical compound COC(=O)C(=O)C1=CC=CC=C1 YLHXLHGIAMFFBU-UHFFFAOYSA-N 0.000 description 1
- 125000004170 methylsulfonyl group Chemical group [H]C([H])([H])S(*)(=O)=O 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- SYSQUGFVNFXIIT-UHFFFAOYSA-N n-[4-(1,3-benzoxazol-2-yl)phenyl]-4-nitrobenzenesulfonamide Chemical class C1=CC([N+](=O)[O-])=CC=C1S(=O)(=O)NC1=CC=C(C=2OC3=CC=CC=C3N=2)C=C1 SYSQUGFVNFXIIT-UHFFFAOYSA-N 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003136 n-heptyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000004593 naphthyridinyl group Chemical group N1=C(C=CC2=CC=CN=C12)* 0.000 description 1
- WASNIKZYIWZQIP-AWEZNQCLSA-N nerolidol Natural products CC(=CCCC(=CCC[C@@H](O)C=C)C)C WASNIKZYIWZQIP-AWEZNQCLSA-N 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229960003966 nicotinamide Drugs 0.000 description 1
- 235000005152 nicotinamide Nutrition 0.000 description 1
- 239000011570 nicotinamide Substances 0.000 description 1
- JPXMTWWFLBLUCD-UHFFFAOYSA-N nitro blue tetrazolium(2+) Chemical compound COC1=CC(C=2C=C(OC)C(=CC=2)[N+]=2N(N=C(N=2)C=2C=CC=CC=2)C=2C=CC(=CC=2)[N+]([O-])=O)=CC=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=C([N+]([O-])=O)C=C1 JPXMTWWFLBLUCD-UHFFFAOYSA-N 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- YJJIVDCKSZMHGZ-UHFFFAOYSA-N oct-3-en-2-ol Chemical compound CCCCC=CC(C)O YJJIVDCKSZMHGZ-UHFFFAOYSA-N 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 125000002971 oxazolyl group Chemical group 0.000 description 1
- 125000000466 oxiranyl group Chemical group 0.000 description 1
- 229930007459 p-menth-8-en-3-one Natural products 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- PNJWIWWMYCMZRO-UHFFFAOYSA-N pent‐4‐en‐2‐one Natural products CC(=O)CC=C PNJWIWWMYCMZRO-UHFFFAOYSA-N 0.000 description 1
- 238000005325 percolation Methods 0.000 description 1
- 125000005327 perimidinyl group Chemical group N1C(=NC2=CC=CC3=CC=CC1=C23)* 0.000 description 1
- 125000004934 phenanthridinyl group Chemical group C1(=CC=CC2=NC=C3C=CC=CC3=C12)* 0.000 description 1
- 125000004625 phenanthrolinyl group Chemical group N1=C(C=CC2=CC=C3C=CC=NC3=C12)* 0.000 description 1
- 125000001791 phenazinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3N=C12)* 0.000 description 1
- 125000001484 phenothiazinyl group Chemical group C1(=CC=CC=2SC3=CC=CC=C3NC12)* 0.000 description 1
- 125000001644 phenoxazinyl group Chemical group C1(=CC=CC=2OC3=CC=CC=C3NC12)* 0.000 description 1
- UYWQUFXKFGHYNT-UHFFFAOYSA-N phenylmethyl ester of formic acid Natural products O=COCC1=CC=CC=C1 UYWQUFXKFGHYNT-UHFFFAOYSA-N 0.000 description 1
- 125000001476 phosphono group Chemical group [H]OP(*)(=O)O[H] 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 125000004592 phthalazinyl group Chemical group C1(=NN=CC2=CC=CC=C12)* 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 125000005936 piperidyl group Chemical group 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000008057 potassium phosphate buffer Substances 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 125000001042 pteridinyl group Chemical group N1=C(N=CC2=NC=CN=C12)* 0.000 description 1
- 238000001853 pulsed-field electrophoresis Methods 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 125000004309 pyranyl group Chemical group O1C(C=CC=C1)* 0.000 description 1
- 125000003072 pyrazolidinyl group Chemical group 0.000 description 1
- 125000003226 pyrazolyl group Chemical group 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 125000000714 pyrimidinyl group Chemical group 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- 125000001422 pyrrolinyl group Chemical group 0.000 description 1
- 125000000168 pyrrolyl group Chemical group 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 125000001567 quinoxalinyl group Chemical group N1=C(C=NC2=CC=CC=C12)* 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000006479 redox reaction Methods 0.000 description 1
- 238000011946 reduction process Methods 0.000 description 1
- 239000004627 regenerated cellulose Substances 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 239000012465 retentate Substances 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 125000006413 ring segment Chemical group 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 239000004460 silage Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229940083575 sodium dodecyl sulfate Drugs 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- XZTJQQLJJCXOLP-UHFFFAOYSA-M sodium;decyl sulfate Chemical compound [Na+].CCCCCCCCCCOS([O-])(=O)=O XZTJQQLJJCXOLP-UHFFFAOYSA-M 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 229950003429 sorbitan palmitate Drugs 0.000 description 1
- 229950011392 sorbitan stearate Drugs 0.000 description 1
- 229960004129 sorbitan tristearate Drugs 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000012192 staining solution Substances 0.000 description 1
- 238000001256 steam distillation Methods 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- HCXVJBMSMIARIN-PHZDYDNGSA-N stigmasterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)/C=C/[C@@H](CC)C(C)C)[C@@]1(C)CC2 HCXVJBMSMIARIN-PHZDYDNGSA-N 0.000 description 1
- BFDNMXAIBMJLBB-UHFFFAOYSA-N stigmasterol Natural products CCC(C=CC(C)C1CCCC2C3CC=C4CC(O)CCC4(C)C3CCC12C)C(C)C BFDNMXAIBMJLBB-UHFFFAOYSA-N 0.000 description 1
- ODJLBQGVINUMMR-HZXDTFASSA-N strophanthidin Chemical compound C1([C@H]2CC[C@]3(O)[C@H]4[C@@H]([C@]5(CC[C@H](O)C[C@@]5(O)CC4)C=O)CC[C@@]32C)=CC(=O)OC1 ODJLBQGVINUMMR-HZXDTFASSA-N 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 125000005017 substituted alkenyl group Chemical group 0.000 description 1
- 125000000547 substituted alkyl group Chemical group 0.000 description 1
- 125000003107 substituted aryl group Chemical group 0.000 description 1
- 125000005346 substituted cycloalkyl group Chemical group 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229960004793 sucrose Drugs 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000003460 sulfonic acids Chemical class 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000001117 sulphuric acid Substances 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- 238000009210 therapy by ultrasound Methods 0.000 description 1
- 125000004627 thianthrenyl group Chemical group C1(=CC=CC=2SC3=CC=CC=C3SC12)* 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 125000001544 thienyl group Chemical group 0.000 description 1
- 125000004568 thiomorpholinyl group Chemical group 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 229910052723 transition metal Inorganic materials 0.000 description 1
- 150000003624 transition metals Chemical class 0.000 description 1
- 125000001425 triazolyl group Chemical group 0.000 description 1
- POSZUTFLHGNLHX-KSBRXOFISA-N tris maleate Chemical compound OCC(N)(CO)CO.OCC(N)(CO)CO.OC(=O)\C=C/C(O)=O POSZUTFLHGNLHX-KSBRXOFISA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- DCSCXTJOXBUFGB-UHFFFAOYSA-N verbenone Natural products CC1=CC(=O)C2C(C)(C)C1C2 DCSCXTJOXBUFGB-UHFFFAOYSA-N 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- MECHNRXZTMCUDQ-RKHKHRCZSA-N vitamin D2 Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)/C=C/[C@H](C)C(C)C)=C\C=C1\C[C@@H](O)CCC1=C MECHNRXZTMCUDQ-RKHKHRCZSA-N 0.000 description 1
- 239000011653 vitamin D2 Substances 0.000 description 1
- QYSXJUFSXHHAJI-YRZJJWOYSA-N vitamin D3 Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C\C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-YRZJJWOYSA-N 0.000 description 1
- 239000011647 vitamin D3 Substances 0.000 description 1
- 239000011800 void material Substances 0.000 description 1
- 235000021241 α-lactalbumin Nutrition 0.000 description 1
- 125000004933 β-carbolinyl group Chemical group C1(=NC=CC=2C3=CC=CC=C3NC12)* 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0006—Oxidoreductases (1.) acting on CH-OH groups as donors (1.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P41/00—Processes using enzymes or microorganisms to separate optical isomers from a racemic mixture
- C12P41/002—Processes using enzymes or microorganisms to separate optical isomers from a racemic mixture by oxidation/reduction reactions
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/02—Preparation of oxygen-containing organic compounds containing a hydroxy group
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/24—Preparation of oxygen-containing organic compounds containing a carbonyl group
- C12P7/26—Ketones
Definitions
- the invention relates to biocatalysts showing alcohol dehydrogenase activity, their preparation, their use in the oxidation of secondary alcohols and/or the reduction of ketones, as well as nucleic acids coding for these alcohol dehydogenases and microorganisms transformed with nucleic acids coding for these biocatalysts and their use for producing the biocatalyst and for the oxidation of secondary alcohols and/or the reduction of ketones.
- a disadvantage is that the strongly basic reaction conditions lead to undesired aldol-type side reactions (see K. G. Akamanchi, B. A. Chaudhari, Tetrahedron Lett. 38, 6925-8 (1997)). Substrates sensitive to basic conditions cannot be reacted without decomposition (see T. Ooi, Y. Itagaki, T. Miura, K. Maruoka, Tetrahedron. Lett. 40, 2137-8 (1999)). Asymmetric variants of the MPV-Red that employ chiral transition metal catalysts for enantioselective hydrid transfer have been tested only on few model substrates and resulted in preparatively inacceptably low stereoselectivities (see F. Touchard, M. Bernard, F.
- biocatalytic methods have the advantage that they can be led under mild conditions, e.g. at room temperature and approximately neutral pH in aqueous media (see K. Faber, Biotransformations in Organic Chemistry 4 th Ed., Springer Verlag, , Heidelberg 2000; ISBN 3-540-61688-8).
- An additional valuable property of biocatalysts is their normally high intrinsic stereoselectivity.
- the desired reaction usually takes place without side reactions.
- Biocatalytic redox processes on the basis of isolated alcohol dehydrogenases require the presence of expensive cofactors, such as NAD + /NADH or NADP + /NADPH. The recycling of these substrates is difficulty and expensive (see W. Hummel, Adv. Biochem. Eng.
- the substrate concentrations are below 0.15 mol/l and the co-substrate concentrations below 3 % (v/v) (see K. Nakamura, Y. Inoue, T. Matsuda, I. Misawa, J. Chem. Soc. Perkin Trans. 1 1999, 2397-2402; and A. Goswami, R. L. Bezbaruah, J. Goswami, N. Borthakur, D. Dey, A. K. Hzarika, Tetrahedron: Asymmetry 2000., 11, 3701-9).
- the invention relates to a biocatalyst, especially an enzyme, preferably in (at least partially) purified form, which biocatalyst has alcohol dehydrogenase activity and which can be obtained from Rhodococcus ruber.
- this enzyme has unexpected and unique properties in comparison to other, known enzymes having the same type of activity.
- the novel enzyme has high temperature stability and in addition is capable of maintaining its activity in the presence of high concentrations of organic solvents (such as aromatic or aliphatic hydrocarbons, e.g. toluene, hexane) other than the co-substrates in up to 95, preferably up to 98 % concentration (v/v).
- organic solvents such as aromatic or aliphatic hydrocarbons, e.g. toluene, hexane
- This especially allows for leading the oxidation or reduction reactions under conditions of high temperature and especially in the presence of high co-substrate concentrations (in the case of oxidation of alcohols, the presence of high ketone concentrations; in the case of reduction of ketones, the presence of high alcohol concentrations).
- Fig. 1 Native gel analysis at different steps of the purification protocol of sec-alcohol dehydrogenase A. Lanes: Lane 1 - crude cell extract; lane 2: batch DEAE cellulose; lane 3: Phenyl Sepharose; lane 4: UNO Q6; lane 5: Blue Sepharose; lane 6: Superdex 200.
- Fig. 2 SDS-PAGE analysis at different steps of the purification protocol of sec-alcohol dehydrogenase A.
- Lanes Lane 1 - crude cell extract; lane 2: batch DEAE cellulose; lane 3: Phenyl Sepharose; lane 4: UNO Q6; lane 5: Blue Sepharose; lane 6: Superdex 200; lane 7: low molecular weight standard.
- the invention especially relates to an biocatalyst with alcohol dehydrogenase activity, especially an enzyme, preferably in (at least partially) purified form, which has alcohol dehydrogenase activity, especially stereospecific alcohol dehydrogenase activity in the oxidation of secondary alcohols or the reduction of ketones; and which can be obtained from a naturally occuring microorganism, especially Rhodococcus, especially Rhodococcus ruber DSM 44541 -called Rhodococcus ruber DSM 14855 hereafter, in accordance with the number of the Budapest Treaty deposit (see below), see WO 03/078615 which is enclosed here by reference especially regarding the deposit of said microorganism.
- biocatalyst (or "enzyme") according to the invention is preferably present or used in purified form.
- the invention also relates to a corresponding biocatalyst with alcohol dehydrogenase activity, obtained by recombinant technology (recombinant biocatalyst).
- a further embodiment of the invention relates to the use of a biocatalyst with alcohol dehydrogenase activity according to the invention in the oxidation of secondary alcohols and/or the reduction of ketones (process of or according to the invention, hereinafter).
- the process of the invention can be used especially for separating mixtures of stereo- isomers with respect to a center of chirality by kinetic resolution, if one stereo-isomer of an alcohol is specifically oxidized, or for the stereo-specific production of secondary alcohols having a specific chiral form from ketones.
- Still a further embodiment relates to nucleic acids coding for such a biocatalyst with alcohol dehydrogenase activity, especially recombinant nucleic acids.
- Another embodiment relates to microorganisms transformed with a nucleic acid coding for such a biocatalyst with alcohol dehydrogenase activity.
- the invention relates to the use of the mentioned microorganisms, especially host cells, in the production of said biocatalyst with alcohol dehydrogenase activity, as well as their use in the catalysis of the oxidation of secondary alcohols or the reduction of ketones, especially as shown in reaction scheme (A) below.
- a further aspect of the invention relates to a (preferably isolated) polynucleotide, namely a DNA , or a (preferably isolated) recombinant polynucleotide comprising a DNA, each coding for a biocatalyst according to the invention, namely an enzyme, showing alcohol dehydrogenase activity, preferably as described above and below and in the examples as preferred, according to the invention which is characterized by the following sequence (SEQ ID NO: 47)
- versions of the polynucleotide or recombinant polynucleotide are comprised where conservative nucleic acid replacements that lead to no change in the resulting amino acid sequence are present and/or such changes in the base sequence that lead to amino acid replacements in the amino acid sequence resulting from translation thereof for 5 % or less, preferably 3 % or less of the total number of amino acids coded by and resulting from translation of the sequence of SEQ ID NO: 47, for example the replacement of up to 3 amino acids, provided that the resulting polypeptides still display an alcohol dehydrogenase activity as the biocatalyst according to the invention (especially the substrate specificities, ph-optimum, temperature optimum, temperature stability, activity in the presence of EDTA or solvent stability properties mentioned below, or any combination of two or more of these properties, preferably all these properties), especially with at least the high solvent and temperature stability mentioned below.
- exactly the DNA of SEQ ID NO: 47 is comprised, in a broader embodiment also variants thereof with up to 30, e.g. up to 15 nucleic acid replacements.
- corresponding polynucleotides or recombinant polynucleotides comprising the mentioned DNA sequence with insertions and/or deletions (either in addition to or alternatively to nucleic acid replacements), e.g. with a total of up to 300, preferably up to 90, for example up to 30 nucleic acids, preferably the insertions and deletions not affecting the reading frame, that is, resulting from addition or removal of one or more triplets, preferably in accordance with the mentioned boundaries, in each case provided that the resulting polypeptides after translation still display an alcohol dehydrogenase activity as the biocatalyst according to the invention.
- the invention also relates to microorganisms transformed with a polynucleotide, especially a recombinant polynucleotide, each as mentioned above coding for such a biocatalyst with alcohol dehydrogenase activity - preferably to microorganisms appropriate for expressing the gene, but also those that comprise the nucleic acid for pure conservation or replication purposes.
- the invention also relates to the use of and a method of using these microorganisms (either living or killed, in complete or in at least partially digested form) especially in the oxidation or reduction reactions described above and below.
- the invention also relates to the complementary nucleic acid for such a nucleic acid sequence as well as to double strands with both the complementary and the coding sequence.
- a corresponding RNA (with U instead of T) is also comprised.
- the invention also relates to the primers given in the examples under the SEQ ID Nos starting from SEQ ID NO 7 up to SEQ ID NO 46 and to the Rhodococcus rubber DSM 14855 DNA library mentioned in the examples.
- the invention also relates to a polypeptide showing alhohol dehydrogenase activity according to the invention (especially the substrate specificities, ph-optimum, temperature optimum, temperature stability and solvent stability properties mentioned below, or any combination of two or more of these properties, preferably all these properties), especially with at least the high solvent and temperature stability mentioned below, of the sequence with SEQ ID NO: 48
- the invention also relates to the use of or a method of using such a polypeptide (in purified or at least partially purified form especially in the oxidation or reduction reactions described above and below.
- the invention especially relates to a biocatalyst with alcohol dehydrogenase activity, especially an enzyme, preferably in purified form, which has alcohol dehydrogenase activity and which can be obtained from Rhodococcus ruber, especially Rhodococcus ruber DSM 14855. That the biocatalyst has alcohol dehydrogenase activity, is not intended to mean that other activities (be it of enzymatic, regulatory or any other kind) are excluded within the present disclosure.
- biocatalyst of the invention or “enzyme of the invention” or “enzyme (or polypeptide) showing alhohol dehydrogenase activity”
- biocatalyst having alcohol dehydrogenase activity especially an enzyme with said activity, most especially alcohol dehydrogenase "ADH-A”, as described below.
- alcohol dehydrogenase ADH-A
- all these terms include not only the naturally occurring, “authentic” sequence of a polypeptide of the invention, which are the preferred embodiments of the invention, but also all mutants, variants and fragments thereof which exhibit the alcohol dehydrogenase activity, preferably with the same stereoselective activity as the natural enzyme.
- An enzyme of the invention preferably has one, more preferably two, most preferably three or more of the following properties:
- Stability meaning alcohol dehydrogenase activity also in the presence of up to 50, preferably up to 80 percent by volume of isopropanol.
- Stability meaning alcohol dehydrogenase activity also in the presence of up to 20, preferably up to 50 percent by volume of acetone.
- [L/l] is leucine or isoleucine and X stands for an unidentified amino acid.
- TD in the beginning at the amino terminus or with DT in the beginning) within the total sequence of at least one polypeptide forming the whole or part of the enzyme where the sequence in brackets is selected from the two alternatives mentioned therein and [L l] is isoleucine or leucine.
- the term "within the total sequence of at least one polypeptide forming the whole or part of the enzyme” refers to the possibility that the biocatalyst/enzyme according to the invention may consist of one subunit (then it is formed from one polypeptide) or more than one (identical or different) subunits (then it is formed from the corresponding number of polypeptides).
- an enzyme of the invention wherein one of the partial sequences mentioned under (xii) to (xvii) is present or wherein one of the amino acids mentioned in any of these sequences is exchanged against a different amino acid, preferably by a conservative replacement, e.g. of lipophilic against lipophilic, basic against basic, acidic against acidic, polar against polar amino acids, or the like.
- an enzyme the peptide sequence or, if more than one different subunits are present, sequences of which comprise a partial sequence selected from two, more preferably 3, even more preferably 4, still most preferably 5, most preferably 6 of the sequences mentioned above under (xii) to (xvii).
- the enzyme of the invention is isolated (purified) from the microorganism by methods that are, perse, well known in the art, in particular by the methods described in the examples or methods analogous thereto, the whole purification method also forming an embodiment of the invention.
- the Alcohol dehydrogenase activity is preferably determined by oxidation of 1 -phenylethanol (6.6 ⁇ M) and addition of 10 mM NAD + (testing conditions: 30 °C, 10 ⁇ M Tris-buffer, pH 7.5, 10 min, conversion by GC-analysis), or as described in the Examples.
- a biocatalyst of the invention is obtainable from a naturally occurring microorganism fermentable by a process comprising inoculating a selection medium with natural samples such as soil, water, or plant silage, preferably a hydrocarbon, e.g. hexane.
- a selection medium also contains all essential ingredients necessary for allowing growth of microorganisms, such as mineral salts, N-sources, and trace elements.
- a naturally occurring microorganism having alcohol dehydrogenase activity can be obtained by a process known in the art, for example by isolation from a natural source, such as Rhine water.
- the microorganism having alcohol dehydrogenase activity is cultivated in an aqueous nutrient medium, e.g. comprising yeast extract, peptone, glucose and mineral salts (e.g. 10 g/1 yeast extract 10 g/l peptone,2 g/1 NaCl, 0.15 g/l MgSO 4 • 7H 2 O, 1.3 g/l NaH 2 P0 4 , 4.4 g/l K 2 HP0 4 ) for some, e.g. three, days.
- Cell growth is followed by determination of the optical density via absorption, e.g. at 546 nm.
- the cells are disrupted, the biomass is removed and the cell-free extract is obtained.
- the fermentation time is so selected that optimum titers with respect to alcohol dehydrogenase activity are achieved.
- the cultivation is discontinued.
- the culture broth is separated off in known manner, e.g. by centrifugation, and the sedimented cells are broken down in customary manner, e.g. by shaking with fine glass beads, by ultrasound treatment, or using a French press.
- Insoluble cell components and, if used, glass beads are removed, e.g., by centrifugation, and the residue is used as the enzyme source (crude extract).
- the residue as an alcohol dehydrogenase activity-containing crude extract, can be used directly in the process according to the invention.
- in order to remove nucleic acids (viscous solutions) and other impurities or interfering components e.g.
- the crude extract is subjected to further purification in order to obtain the enzyme of the invention in purified form.
- the crude cell extract is subjected to one or more purification steps that, as such, are known in the art in order to remove interfering components from the extract.
- a preferred method makes use of batch pretreatment with a cation exchanger, e.g. DEAE cellulose, and subsequent chromatographic (especially FPLC) separation first by Hydro- phobic Interaction Chromatography, e.g. over Phenyl Sepharose, advantageously after removing precipitations formed in the presence of (NH ) 2 S0 4 .
- a cation exchanger e.g. DEAE cellulose
- FPLC e.g. over Phenyl Sepharose
- enzyme activity is eluted.
- the active fractions are further separated by anion exchange chromatography, preferably on an UNO Q column (BioRad). Elution by eluents with increasing sodium chloride content yields again active fractions with alcohol dehydrogenase activity.
- the interesting fractions are then further purified on a separation matrix comprising binding places for adenylyl-comprising cofactors, e.g. carrying the dye Cibacron Blue F3G-A or other moieties allowing for such affinity chromatography, especially using Blue Sepharose CI-6B, this innovative material allowing a surprisingly good further purification, although surprisingly no binding takes place.
- the next step is size exclusion chromatography, e.g. using a Superdex 200 column.
- the enzyme of the invention elutes in fractions corresponding to a molecular weight between 55 to 69 kDa, with an average of about 62 kDa.
- purified means preferably “in at least partially purified form” or “in enriched form” or, more preferably, purified in the stricter sense, that is, in practically isolated form (especially with more than 50, most especially more than 95 % purity by weight compared to other peptides present).
- a corresponding biocatalyst with alcohol dehydrogenase activity obtained by recombinant technology, then called a recombinant biocatalyst of the invention, (or also a biocatalyst from natural sources other than Rhodococcus ruber DSM 14855), preferably is defined as follows.
- the sequence of said biocatalyst may comprise deletions, insertions, terminal additions or exchanges (especially conservative exchanges, e.g.
- amino acids preferably of up to 20, in case of terminal additions up to 1000; more preferably of up to 5, in case of terminal additions of up to 200 amino acids, respectively, or any combination of such changes, when compared to the sequence of the enzyme as purified in the examples or possible different subunits thereof, as long as the basic activity (alcohol dehydrogenase activity, especially with the substrates (preferably 1 -phenylethanol or acetophenone) and co- substrates mentioned in the examples) is still present, especially in connection with one or more of the additional advantageous properties mentioned for a biocatalyst according to the invention.
- modified amino acids (with different structures than the 20 amino acids directly derivable from the genetic code) which may be modified during translation or post- translationally, may be present, e.g. 1 to 20, more preferably 1 to 5 such amino acids.
- a biocatalyst with alcohol dehydrogenase activity in the oxidation of secondary alcohols or the reduction of ketones is the use in catalyzing the following reactions (reaction scheme (A)):
- Ri and R 2 are two different moieties from the group consisting of unsubstituted or substituted alkyl, unsubstituted or substituted alkenyl, unsub- stituted or substituted alkinyl, unsubstituted or substituted cycloalkyl, unsubstituted or substituted aryl and unsubsituted or substituted heterocyclyl, or Ri and R 2 together form an unsubstituted or substituted bridge; and in formula III and formula IV, R 3 and R 4 are two different or preferably two identical lower alkyl or aryl moieties, or together form a bridge.
- lower defines a moiety with up to and including maximally 7, especially up to and including maximally 4, carbon atoms, said moiety being branched or straight-chained.
- Lower alkyl for example, is ethyl, n-propyl, sec-propyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pen- tyl, n-hexyl or n-heptyl or most preferably methyl.
- Substituted wherever used for a moiety, means that one or more hydrogen atoms in the respective molecule, especially up to 5, more especially up to three, of the hydrogen atoms are replaced by the corresponding number of substituents which preferably are independently selected from the group consisting of alkyl, especially lower alkyl, for example methyl, ethyl or propyl, fluoro-lower alkyl, for example trifluoromethyl, C 6 -C ⁇ 6 -aryl, especially phenyl or naphthyl (where C 6 -C ⁇ 6 -aryl, especially phenyl or naphthyl, is unsubstituted or substituted by one or more, especially up to three moieties selected from halogen, carboxy, lower alkoxy- carbonyl, hydroxy, lower alkoxy, phenyl-lower alkoxy, lower alkanoyloxy, lower alkanoyl, ami- no, N-lower alkylamino, N,N-d
- C 3 -C ⁇ 0 -cycloalkyl that is unsubstituted or substituted by one or more, especially up to three moieties selected from halogen, carboxy, lower alkoxycarbonyl, hydroxy, lower alkoxy, phenyl-lower alkoxy, lower alkanoyloxy, lower alkanoyl, amino, N-lower alkylamino, N,N-di- lower alkylamino, N-phenyl-lower alkylamino, N,N-bis(phenyl-lower alkyl)-amino, lower al- kanoylamino, fluoro-lower alkyl, e.g.
- heterocyclyl that is unsaturated, saturated or partially saturated, is mono-, bi- or tri-cyclic and has 4 to 16 ring atoms, where instead of one or more, especially one to four, carbon ring atoms the corresponding number of heteroatoms are present (within the chemically possible limits) selected from nitrogen, oxygen and sulfur (with said heterocyclyl unsubstituted or substituted by one or more, especially up to three moieties selected from halogen, carboxy, lower alko- xycarbonyl, hydroxy, lower alkoxy, phenyl-lower alkoxy, lower alkanoyloxy, lower alkanoyl, amino, N-lower alkylamino, N,N-di-lower alkylamino, N-phenyl-lower alkylamino, N,N-bis- (phenyl-lower alkyl)-amino, lower alkanoylamino, fluoro-lower
- hydroxy, lower alkoxy for example methoxy, phenyl-lower alkoxy, lower alkanoyloxy, amino, N-lower alkylamino, N,N-di-lower alkylamino, N-phenyl-lower alkylamino, N,N-bis- (phenyl-lower alkyl)-amino, lower alkanoylamino, carbarnoyl-lower alkoxy, N-lower alkyl- carbamoyl-lower alkoxy or N,N-di-lower alkylcarbamoyl-lower alkoxy, amino, mono- or di- lower alkylamino, lower alkanoylamino, carboxy, lower alkoxycarbonyl, phenyl-, naphthyl- or fluorenyl-lower alkoxycarbonyl, such as benzyloxycarbonyl, lower alkanoyl
- substitutents are only at positions where they are chemically possible, the person skilled in the art being able to decide (either experimentally or theoretically) without inappropriate effort which substitutions are possible and which are not. Where more than one substituent is present, the substituents, if not indicated otherwise, are selected independently from each other.
- Alkyl preferably has up to 24, more preferably up to 12 carbon atoms and, if possible in view of the number of carbon atoms, is linear or branched one or more times; preferred is lower alkyl, especially C ⁇ -C 4 -alkyl.
- Alkyl can be substituted or unsubstituted, especially by one or more, more especially up to 3, of the substituents mentioned above under "substituted”. Unsubstituted alkyl, especially lower alkyl, is one preferred embodiment.
- Alkenyl is preferably a moiety with one or more double bonds and preferably has 2 to 20, more preferably up to 12, carbon atoms; it is linear or branched one or more times (as far as possible in view of the number of carbon atoms). Preferred is C 2 -C 7 -alkenyl, especially C 3 -C 4 - alkenyl, such as allyl or crotyl. Alkenyl can be unsubstituted or substituted, especially by one or more, more especially up to three, of the substituents mentioned above under lightningsubstituted".
- Substituents such as amino or hydroxy (with free dissociable hydrogen) preferably are not bound to carbon atoms that participate at a double bond, and also other subtituents that are not sufficiently stable are preferably excluded.
- Alkinyl is preferably a moiety with one or more triple bonds and preferably has 2 to 20, more preferably up to 12, carbon atoms; it is linear of branched one or more times (as far as possible in view of the number of carbon atoms). Preferred is C 2 -C 7 -alkinyl, especially C 3 -C - alkinyl, such as ethinyl or propin-2-yl. Alkinyl can be unsubstituted or substituted, especially by one or more, more especially up to three, of the substituents mentioned above under ..substituted".
- Substituents such as amino or hydroxy (with free dissociable hydrogen) preferably are not bound to carbon atoms that participate at a triple bond, and also other subtituents that are not sufficiently stable are preferably excluded. Unsubstituted alkinyl, in particular C 2 -C 7 -aIkinyl, is especially preferred.
- Aryl preferably has a ring system with not more than 20 carbon atoms, especially not more than 14 carbon atoms; is preferably mono-, bi- or tricyclic; and is unsubstituted or substituted by one or more, especially up to three, substitu tents, preferably as defined above under "substituted".
- aryl is selected from the group consisting of phenyl, naphthyl, indenyl, azulenyl and anthryl, each of which is unsubstituted or substituted; preferably from phenyl or 1- or 2-naphthyl, each unsubstituted or substituted by one or more, preferably up to 5, substituents as defined above under "substituted”.
- Heterocyclyl is preferably a heterocyclic radical that is unsaturated, saturated or partially saturated, and is preferably a monocyclic or, in a broader aspect of the invention, bi- or tricyclic moiety; it has preferably 3 to 24, especially 4 to 16 carbon atoms, where instead of one or more, especially one to four, carbon ring atoms the corresponding number of heteroatoms are present, especially (within the chemically possible limits) selected from nitrogen, oxygen and sulfur; and where heterocyclyl is unsubstituted or substituted by one or more, especially up to three, substituents as defined above under "substituents".
- heterocyclyl is selected from the group consisting of oxiranyl, azirinyl, 1,2-oxathiolanyl, imidazolyl, thienyl, furyl, tetrahydrofuryl, pyranyl, thiopyranyl, thianthrenyl, isobenzofuranyl, benzofuranyl, chromenyl, 2r -pyrrolyl, pyrrolyl, pyrrolinyl, pyrrolidinyl, imidazolyl, imidazolidinyl, benzimidazolyl, pyrazolyl, pyrazinyl, pyrazolidinyl, pyranyol, thiazolyl, isothiazolyl, dithiazolyl, oxazolyl, isoxazolyl, pyridyl, pyrazinyl, pyrimidinyl, piperidyl, piperazinyl, pyridazinyl, morph
- Cycloalkyl preferably has 3 to 12, more preferably 3 to 8 carbon atoms and is, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl or cycloheptyl; it is unsubstituted or substituted with one or more, especially up to 3, substituents, preferably as defined above under "substituted".
- An unsubstituted or substituted bridge formed from Ri and R 2 in formula I, la, lb or II is preferably a bridge formed by 2 to 12 carbon atoms that, together with the binding atom in formula I, la, lb or II forms a ring; where the bridge may contain one or more double and/or triple bonds at places other than the binding carbon atom (then the bridge has at least three carbon atoms) or is preferably saturated.
- the substituents are preferably chosen from 1 or more, especially up to three, substituents as defined under "substituents".
- C 2 -C 7 -alkylen chain such as ethylene, propylene, n-butylene, n-hexylene or n-heptylene, each of which is substituted by one or more, especially 1 or 2, of the moieties defined above under "substituted", or preferably is unsubstituted.
- saltforming groups are especially basic groups, such as amino groups, or acidic groups, such as carboxy groups.
- acidic groups such as alkaline metal salts, e.g.
- sodium or potassium salts, or alkaline-earth metal salts, such as calcium salts, or salts with nitrogen bases, such as ammonium-, tri-lower alkylammonium, pyridinium salts or the like, can be present; in the case of basic groups, the corresponding acid addition salts may be present, e.g. with inorganic acids, such as sulphuric acid or hydrogen halides, such as HCI or HBr, or with organic acids, e.g. carboxylic acids, such as acetic acid, or sulfonic acids, e.g. methane sulfonic acid.
- inorganic acids such as sulphuric acid or hydrogen halides, such as HCI or HBr
- organic acids e.g. carboxylic acids, such as acetic acid, or sulfonic acids, e.g. methane sulfonic acid.
- Examples for preferred secondary alcohols are hydroxy group carrying isoprenoids, such as mono-, di- or tri-terpenes, e.g. geraniol, isoborneol, ipsenol, menthol (especially ( ⁇ )-menthol), nerolidol, hemandulcin, taxol or lanosterol, or steroids, such as cholestan-3-ol, cholesterol, ergosterin, stigmasterin, cholic acids, vitamin D 2 , vitamin D 3 , androsterone, testosterone, estrone, 17 ⁇ -estradiol, estriol, cortisol, corticosterone, aldosterone, triamincolone, digitoxigenin, strophanthidine, ouabagenine, scillaridine or bufotalin; di-lower alkyl- or lower alkyl-lower alkenyl methanols, such as isopropanol, butane-2-ol, n-hexane-2
- Preferred cosubstrates for the reduction are secondary alcohols, such as isopropanol, 4-me- thyl-2-pentanol or further other C,C-di-(lower alkyl)-methanols. These are preferably present in the reaction mixture in an excess, for example compared to the ketone to be reduced, for example making up 50 % (related to the volume of the reaction mixture, v/v).
- the concentration of the ketone to be reduced preferably lies below an upper limit of 3 mol/l, preferably up to 2,6 mol/l or lower.
- Ketones to be reduced are especially free ketones or ketals thereof (such as especially di- (loweralkyl ketals or (cydic) (unsubstituted or substituted, for example by lower alkyl, such as methyl) lower alkylene ketals, such as ethylene ketals (dioxolan derivatives).
- ketones or ketals thereof such as especially di- (loweralkyl ketals or (cydic) (unsubstituted or substituted, for example by lower alkyl, such as methyl) lower alkylene ketals, such as ethylene ketals (dioxolan derivatives).
- oxo-carrying isoprene derivatives such as mono-, di- or triterpenes, e.g.
- menthone pulegone, carvone, carone, verbenone, camphor, dihydrocarvone, dihydrocarvone hydrobromide, carvenone, hernandulcine or taxol or lanosterol, or steroids, such as androsterone, testosterone, estrone, cortisol, corticosterone, aldosterone or prednisone; di-(lower alkyl)- or lower alkyl-lower alkenyl-ketones, such as acetone, butane- one, n-hexan-2-one, n-heptan-2-one, n-octan-2-one, n-nonan-2-one, 3-octanone, 5-methyl-2- heptanone, 3-octen-2-one, 3-penten-2-one, 6-methyl-hex-5-en-2-one or 6-methyl-hept-5-en- 2-one; hydroxyacetone; or n-decan-2-one; acetophen
- the preferred pH range for the oxidation of alcohols in the presence of ketones as co- substrates is kept in the area from pH 6 to pH 12, more preferably from pH 8 to pH 11.
- the preferred pH range lies between pH 5 and pH 9, more preferably between pH 6 and pH 8.
- the pH value is controlled by standard buffers, for example phosphate buffers with alkaline metal, especially potassium or sodium phosphate buffer, boronic acid/HCI/sodium hydroxide buffers, or other buffers, such as Tris/HCI, HEPES buffers or the like; and/or by automated titration with an acid, such as HCI, to keep the pH from rising, or a base, such as NaOH, to keep the pH from sinking.
- the enzyme of the invention can also be used in the presence of surface active substances (surfactants, detergents).
- surfactants for example, sodium dodecyl alcohol, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium tartrate, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite, sodium metabisulfite
- anionic tensides that usually include long chain fatty acids as anionic, hydrophobic component, e.g. sulfates of long chain (especially C 8 -C ⁇ 8 ) alcohols, such as alkaline metal C 8 -C ⁇ 8 alkanoylsulfates, especially sodium dodecylsulfate or sodium decylsulfate;
- hydrophilic groups with a positive charge e.g. quaternary ammonium
- - amphoteric detergents such as mono- or dicarboxylated imidazolines of fatty acids, such as sodium lauryldicarboxyimidazoline or sodium; or
- - non-ionic tensides such as ethoxylated sugar esters of higher fatty acids, such as polyoxyethylene-sorbitan-monolaurate, -palmitate, -stearate or -tristearate.
- the temperatures for the use of the enzyme of the invention in the oxidation or reduction reactions preferably lies in the range customary for biocatalytic reactions or above, preferably in the range from 10 to 65, more preferably from 40 to 65 °C.
- the oxidation of or reduction to the S-enantiomer is especially preferred in this reaction.
- Yet another preferred embodiment of the invention relates to the use of/process using the enzyme of the invention for the (mild) chemoselective (especially stereoselective) oxidation of secondary alcohols, where only the hydroxy group with the appropriate steric form is oxidised to the corresponding oxo group (while other oxidable hydroxy groups in the same or other molecules remain intact).
- This can especially be used for the separation of isomers where from mixtures of alcohols only the reactive ones are oxidised, so that either the desired alcohols remain as such or the resulting oxo compounds are, in a subsequent step, again transformed into the desired alcohols by reversal of the reaction (reduction).
- An especially preferred variant of this use relates to the use of an enzyme according to the invention for the (mild) enantioselective oxidation of only one isomer of mixtures of enantiomers (or diastereomers), especially racemates, of secondary alcohols, especially of alcohols of the formula I wherein R 1 and R 2 are two different moieties, especially as defined above, or form an asymmetric (especially asymmetrically substituted) bridge.
- the remaining alcohol can be obtained in isomerically pure, especially enantiomerically pure, form, e.g. with 75 % or more, especially 95 % or more, more especially with 98 % or more enantiomeric excess regarding the carbon atom carrying Ri and R 2 .
- the process of the invention can thus be used especially for separating mixtures of stereoisomers with respect to a center of chirality by kinetic resolution, if one stereoisomer of an alcohol is specifically oxidized, or for the stereospecific production of secondary alcohols representing a specific chiral form from ketones.
- This can also be used for separation processes in that from complex mixtures of ketones only the reactive ones are taking part in the reaction while either the desired oxo compounds remain in the reaction mixtures or the resulting alcohols are, in a subsequent inverse step (oxidation), converted back into the desired keto compounds.
- reaction prochiral oxo-substituted carbon atoms are transformed into the corresponding asymmetrically substituted hydroxy-carrying carbon atoms
- this is also appropriate for obtaining the isomerically, especially enantiomerically, pure alcohols (especially with a purity as defined above).
- the process of the invention can be performed with free or immobilized biocatalyst according to the invention, which can be used in enriched or preferably in purified form.
- a recombinant microorganism especially a host cell which is present in suspension or immobilized and is expressing an enzyme of the invention is used for performing the reaction, i.e. the enzyme is in cell-bound form.
- an enzyme of the invention for use in a process of the invention may be immobilized.
- the immobilization of said enzyme can be carried out analogously to processes known perse, e.g. coupling to a solid support or enclosing in an enzyme membrane reactor.
- the process of the invention may also be lead in the presence of a (free or immobilized) microorganism transformed by genetic engineering techniques with a gene coding for an enzyme of the invention to be able to produce the desired enzyme of the invention, especially in higher amounts than it would be present in the original microorganism, e.g. Rhodococcus ruber, especially Rhodococcus ruber DSM 14855.
- a (free or immobilized) microorganism transformed by genetic engineering techniques with a gene coding for an enzyme of the invention to be able to produce the desired enzyme of the invention, especially in higher amounts than it would be present in the original microorganism, e.g. Rhodococcus ruber, especially Rhodococcus ruber DSM 14855.
- the reaction of an alcohol or ketone substrate with an enzyme of the invention or a microbial cell extract is preferably carried out in homogeneous aqueous solution at pH 5 to 10.5, more preferably at pH 6 to 9.5.
- the reaction is carried out in a manner known perse in buffered solution or using a pH-stat.
- the reaction temperature is approximately from 10 to 65 °C, more preferably from 20 to 50 °C, even more preferably from 20 to 30 °C.
- the substrate is used preferably in a concentration of 1 mM to 2 M, more preferably 50mM to 500 mM. However, if the substrate is less soluble, it is also possible to use a substrate suspension.
- the process according to the invention can be carried out either as a batch process or continuously in an enzyme membrane reactor (EMR).
- EMR enzyme membrane reactor
- the enzyme membrane reactor is preferably fitted with an ultrafiltration membrane having a separation limit of less than approximately 30000 Da, so that the enzymes contained in the reaction mixture are held back whilst the low-molecular-weight products and unreacted rearfants pass through the membrane and the product can be isolated from the outflow.
- the reactor is preferably sterilized before use so that the addition of antibacterial substances can be dispensed with.
- the reactions are carried out in a manner analogous to that described above.
- the process according to the invention can also be carried out by percolating the solution containing the alcohol or ketone substrate, which has been adjusted to a suitable pH value, through a solid carrier on which the enzyme of the invention has been immobilized (the matrix-bound enzyme preparation is obtainable, for example, by percolation of the crude microbial extract through CNBr-activated Sepharose, Eupergit or the like).
- reaction mixture can be clarified by filtration or, preferably, centrifugation, and then the enzyme can be separated by ultrafiltration (membrane with separation limit of ⁇ 30 kDa) and the remaining product can be washed out of the retentate by diafiltration.
- ultrafiltration membrane with separation limit of ⁇ 30 kDa
- Salts of educts or products can be converted into the free compounds, free compounds into the salts using standard methods, respectively.
- Nucleic acids are preferably DNA or RNA (in general, oligo- or polynucleotides).
- Isolated nucleic acids coding for a biocatalyst according to the invention with alcohol dehydrogenase activity are preferably obtained and defined as follows:
- a nucleic acid, especially a gene, coding for a biocatalyst of the invention can, for example, be obtained by identifying at least a part of the sequence of an isolated enzyme of the invention, deducing DNA sequences coding for the partial protein sequence, preparing an oligonucleotide or a mixture of oligonucleotides (taking into consideration the degeneracy of the genetic code) as probe(s), probing a DNA library derived from the microbial strain naturally expressing the activity of the biocatalyst (the term DNA library also including a "cDNA-library”), isolating the gene, and cloning it into a suitable vector for transformation of the microorganism to be genetically modified.
- the partial sequencing of an enzyme of the invention is, for example, made using selective endoproteases for selective digestion, e.g. endo-protease Lys-C, endoprotease Glu-C, chymotrypsin, thermolysin or preferably trypsin (cleaving C-terminally from the basic amino acids arginine or lysine) and, after separation, e.g. electrophoretically on a gel or by chromatography (e.g .HPLC), determining the terminal sequences of the resulting peptides, e.g. by exopeptidases, e.g. carboxypeptidases, such as carboxypeptidase A , B or P).
- Preferred is tryptic digestion, then MS/MS analysis (TOF).
- DNA libraries can also be obtained by PCR methods.
- a cDNA library (obtainable e.g. after extraction of the mRNA from the cells, transformation into DNA using reverse transcriptase, introduction of sticky ends, introduction into a cloning vector, and introduction of that vedor into an appropriate host cell, e.g. a plasmid vector into a bacterium, such as a bacteriophage ⁇ vector or a cosmid into E. coli, a yeast artificial into a yeast, such as Saccaromyces cerevisiae, a Pichia-pastoris vector into Pichia pastoris, or the like) or a DNA library (e.g. obtainable from selective digests of isolated DNA with restriction endonucleases, especially of type II, e.g.
- Hybridization is done using standard procedures, if necessary removing possible disturbing non-coding sequences, e.g. by PCR amplifying only the desired sequence parts or by endonuclease digestion, e.g. using dot blots of colonies of microorganisms from the DNA library. The positive clones can then be isolated.
- the sequencing is done using standard procedures, e.g. the Maxam-Gilbert or the Sanger method.
- the complete sequence coding for an enzyme of the invention (or one subunit thereof, if more than one polypeptide form the complete enzyme) can be determined.
- the corresponding amino acid sequence of the enzyme is (or, if more than one polypeptide forms it, the subunits thereof, the amino acid sequences are) easily determined, using the genetic code.
- the full amino acid sequence of the isolated biocatalyst according to the invention can be determined (e.g. by different endopeptidase digests and matching of overlapping sequenced partial peptides) and a DNA coding the protein can be produced synthetically. It is also very easily possible to screen a suitable DNA library in a host, e.g. E. coli, for expression of temperature resistant alcohol dehydrogenase activity to obtain a transformed clone expressing the biocatalyst.
- Still another method makes use of antibodies against an enzyme of the invention that can be obtained using standard procedures (up to and including the production of monoclonal antibodies obtained from myelomas obtained according to standard procedures) in order to isolate the ribosomes carrying the mRNA coding for the enzyme, transforming it into the corresponding DNA (e.g. with reverse transcriptase) and sequencing or genetically engineering the resulting enzyme.
- the nucleic acid according to the invention is preferably present in isolated form or in recombinant form (then also in a microorganism, see below).
- nucleic acids according to the invention also comprise modified (especially recombinant, but also naturally occurring) nucleic acids where, when compared with the form sequenced as described above, one or more nucleic acids are deleted, inserted, exchanged or added terminally, as long as the polypeptide or polypeptides for which they code still display alcohol dehydrogenase activity, especially according to the test method with 1-phenylethanol or acetophenone as described in the Examples.
- Terminal additions may comprise the addition of sequences for vectors or host nucleic acids into which the coding sequence may be combined.
- the modified nucleic acids are modified such as to code for a biocatalyst with alcohol dehydrogenase activity, obtained by recombinant technology (resulting in a recombinant nucleic acid) or alternatively from natural sources, where the amino acid sequence of the biocatalyst comprises deletions, insertions, terminal additions or exchanges (especially conservative exchanges, e.g.
- the modified nucleic acids contain 1 to 50, more preferably 1 to 12, additional nucleotides by insertion (especially additions yielding no frame shift), 1 to 50, more preferably 1 to 12 changes in nucleic acids, preferably resulting in conservative amino acid changes, and/or 1 to 50, more preferably 1 to 12, deletions of nucleotides, especially without frame shift.
- the invention also relates to probes, especially in radiolabelled or fluorescence labelled form, that are hybridizable under stringent conditions to genomic or cDNA or other nucleic acids coding and that code for the sequences of the six partial amino acid sequences given as SEQ ID NO: 1 to SEQ ID NO: 6, or for parts thereof, said probes preferably having a length of 6 to 24, more preferably of 12 to 21 nucleotides.
- the embodiment of the invention relating to microorganisms transformed with a nucleic acid coding for such a biocatalyst with alcohol dehydrogenase activity preferably relates to microorganisms appropriate for expressing the gene, but also those that comprise the nucleic acid for pure conservation or replication purposes.
- Appropriate microorganisms are especially viruses, bacteriophages or especially host cells, for example, bacteria, e.g. E. coli, single cell fungi, such as yeasts, e.g. Pichia pastoris, Schizosaccharomyces pombe or Saccharomyces cerevisiae, or plant cells.
- bacteria e.g. E. coli
- single cell fungi such as yeasts, e.g. Pichia pastoris, Schizosaccharomyces pombe or Saccharomyces cerevisiae, or plant cells.
- microorganisms can be transformed with nucleic acids as such that code for an enzyme of the invention; however, usually they are transformed with suitable vectors, e.g. plasmids, cosmids, yeast artificial chromosome or the like, which may comprise partial sequences (e.g. useful in sequence determination) or total sequences for the enzyme (e.g. useful in the expression of the enzyme).
- suitable vectors e.g. plasmids, cosmids, yeast artificial chromosome or the like, which may comprise partial sequences (e.g. useful in sequence determination) or total sequences for the enzyme (e.g. useful in the expression of the enzyme).
- Transformation of host cells is made according to standard procedures known in the art and appropriate for the respective host cells, e.g. according to the calcium chloride method, by electroporation, transformation after spheroblast formation into fungi, transformation with polyethylene glycol, transformation with lithium chloride, or the like.
- Virus or the like are modified by introduction of the sequences comprising the coding sequences for the enzyme of the invention.
- the invention relates to the use of the microorganisms, especially host cells, in the production of said biocatalyst with alcohol dehydrogenase activity.
- Expression systems suitable for production of an enzyme of the invention are especially phage-based expression systems in bacteria, e.g. bacteriophage ⁇ or cosmids for E. coli as host, yeast artificial chromosomes for expression in Saccharromyces cerevisiae, the Pichia pastoris expression system used for expression in Pichia pastoris, expression systems in Schizosaccaromyces pombe, the baculovirus expression system or the like.
- the nucleotide sequences coding for an enzyme of the invention can be expressed, either as such or with additional N- or C-terminal sequences, e.g. such that allow for direct export of the resulting polypeptide outside the expressing cells. These extra sequences, if disturbing the activity or otherwise not desired, can then be cleaved off using appropriate endoproteases known in the art.
- the invention relates in particular to the use of/process using the enzyme of the invention, and especially to the enzyme described in the Examples.
- Rhodococcus ruber DSM 14855 is grown under aerobic conditions in baffled Erlenmeyer flasks at 30 °C and 130 rpm using a complex medium containing yeast extract, peptone, glucose and mineral salts (1O g/l yeast extract (OXOID CM129, OXOID Ltd., Hampshire, England), 10 g/l peptone, 2 g/l NaCl, 0.15 g/l MgSO 4 • 7H 0, 1.3 g/l NaH 2 P0 4 , 4.4 g/1 K 2 HPO 4 ) for three days. Cell growth is followed by determination of the optical density via absorption at 546 nm, see Table 1. After a centrifugation (2000 g, 20 min), the pellet is taken up in Tris-HCI buffer pH 7.5 (50 mM), shock-frozen in liquid nitrogen and lyophilised.
- Tris-HCI buffer pH 7.5 50 mM
- the cells produce several NAD + /NADH-dependent sec-alcohol dehydrogenases without any induction.
- the highest sec-alcohol dehydrogenase activity is displayed during the late exponential and early stationary phase of the growth curve (see table 1).
- the activity is measured as the ability of the cells to oxidise 1-phenylethanol or the ability to reduce acetophenone.
- Rhodococcus ruber DSM 14855 (20 mg) are rehydrated in phosphate buffer (0.5 ml, 50 mM, pH 7.5) for 30 min. Activity is measured by adding acetophenone (0.27 mmol) and 2-propanol (0.4 ml). The mixture is shaken at 24 °C, 130 rpm in Eppendorf vials for 2.5 h. The reaction is quenched by addition of ethyl acetate (1 ml) and centrifugation. The conversion is determined by GC (Varian 3800, FID) on an achiral column (HP-1301 , 30 m x 0.25 mm x 0.25 ⁇ m; N 2 ).
- Temperature program for rac-1- phenylethanol/acetophenone start temperature 80 °C - hold 2 min - 10 "C/rni ⁇ - until 130 °C - hold 2 min. The conversion is calculated from calibration curves.
- 1- phenylethanol is oxidised in the presence of acetone as co-substrate.
- Example 2 Purification of a sec-Alcohol dehydrogenase 'ADH-A' from Rhodococcus ruber DSM 14855 a) Cell Disruption
- the sec-alcohol dehydrogenase might be a mem rane-associated or even membrane-bound protein
- cell disruption using a Vibrogen cell mill glass beads, diameter 0.25 mm, Vibrogen Zellmuhle , E. Buhler, Typ VI-4; Braun Biotech Int., Melsoder, Germany
- optimised in order to obtain the majority of the activity in the cell-free lysate and not in the cell debris fraction This results in an exceptionally long and rough procedure of 7 shaking cycles of 2 min agitation/ 5 min cooling each.
- the enzyme shows high stability against this strong mechanical treatment.
- the buffer used for cell disruption is 10 mM Tris-HCI buffer, pH 7.5.
- FPLC Fast Protein Liquid Chromatography
- the first protein purification step is a Hydrophobic Interaction Chromatography using Phenyl Sepharose High Performance material ((Amersham Pharmacia Biotech AB, Uppsala, Sweden).
- sample preparation precipitation occurs by adding (NH 4 ) 2 SO 4 ), and solids are removed since they do not contain any sec-alcohol dehydrogenase activity.
- (NH 4 ) 2 S0 4 as salting-out medium to the equilibration buffer and a stepwise gradient, the different hydrophobicities of proteins enable a first separation of enzymes.
- Activity of Bi is found between 70 and 118 ml.
- Activity of seo'ADH-A' is found between 220 and 236 ml elution volume. The latter (3 x 16 ml after 3 runs, a total of 48 ml) is used for further purification.
- step (ii) Details of step (ii) .Column length 53 mm, diameter 12 mm.
- Elution buffer A 10 mM Tris-HCI-buffer pH 7.5; B: A + 1.5 M NaCl ("100 % NaCl).
- Activity of B 3 is found between 68 and 82 ml.
- Activity of sec-'ADH-A' is found between 131 and 137 ml elution volume. The latter (6 ml) is used for further purification.
- step (iii) Affinity Chromatography
- the third step in protein purification of the resulting 6 ml from step (iii) is carried out on an innovative material, Blue Sepharose CI-6B [see Shaw et al., Biochem. J. 187, 181 (1996)], containing a dye, Cibacron Blue F3G-A, specific for enzymes requiring adenylyl-containing cofactors (such as NAD + /NADP + ) (Amersham Pharmacia Biotech AB, Uppsala, Sweden).
- step (iii) Column length 60 mm, diameter 16 mm.
- Buffer A 10 mM Bis-tris-HCI buffer pH 6.0
- Buffer B A + 1 M NaCl.
- Activity of alcohol dehydrogenase B 3 is found between 44 and 68 ml.
- Activity of sec-'ADH-A' is found between 7 and 23 ml elution volume. The latter is concentrated up on Centriplus YM-10, cut-off 10 kDa (regenerated cellulose with 10 kDa exclusion size) from Millipore lipore GmbH, Vienna, AT)/Amicon to a final volume of 2 ml.
- the molecular weight of the native enzyme is determined as approximately 62 kDa.
- step (iv) Column length 310 mm, diameter 10 mm.
- the sec-alcohol dehydrogenase 'ADH-A' is purified reproducibly.
- the small overall recovery is explained by a major loss of activity during desalting procedures and buffer exchange via dialysis and during concentration to a small volume before applying it to the size-exclusion column. For this reason, the majority of biochemical characterizations are carried out with sem/-pure enzyme after the dye chromatography, where no other sec- alcohol dehydrogenase activity is left.
- the "low" yield is attributable to the fact that in the cell extract at the beginning other alcohol dehydrogenases that are removed during the later procedure (e.g. Bi, B 2 and B 3 ) contribute to the dehydrogenase activity.
- the activity is determined by oxidation of 1-phenylethanol (6.6 ⁇ M) and addition of 1O mM NAD + (testing conditions: 30 °C, 10 ⁇ M Tris-buffer, pH 7.5, 10 min, conversion by GC- analysis). Protein amounts are measured by the method of Bradford (Coomassie Blue Protein Assay) at 595 nm using a BioRad Protein Assay:
- Example 3 Purification control and molecular weight determination by gel electrophoresis: The progress of the protein purification is controlled by native as well as by SDS- polyacrylamide gel electrophoresis (PAGE). For both methods, the protein fractions are subjected to a Laemmli SDS-PAGE system using a MINI-PROTEAN II dual slab cell (BioRad).
- Active fractions are treated with non-denaturing sample buffer and loaded on a polyacrylamide gel (12%) without SDS.
- the gel is run at 4 °C at 150 V with running buffer containing 15 g/l Tris and 72 g/l Glycine.
- the method for visualization of sec-alcohol dehydrogenases in polyacrylamide gels was first reported by Grell et al. [see Science 149, 80 (1965)] and is based on a staining solution [see Dodgson et al., Biochem. J.
- sec-alcohol dehydrogenases present in the microorganism, of which sec-alcohol dehydrogenase 'ADH-A' can be separated properly during the purification protocol.
- sample buffer SDS reducing buffer, BioRad
- SDS-polyacrylamide gel (12%) subsequently run at 200V at room temperature in the same running buffer with addition of 3 g/1 SDS. After the run, staining is carried out with Coomassie Brilliant Blue.
- the molecular weight is determined in comparison to a low molecular weight range SigmaMarker as protein standard containing albumin (66 kDa), ovalbumin (45 kDa), glyceraldehyde-3- phosphate dehydrogenase (36 kDa), carbonic anhydrase (29 kDa), trypsinogen (24 kDa), trypsin inhibitor (20 kDa), ⁇ -lactalbumin (14.2 kDa) and aprotinin (6.5 kDa).
- SigmaMarker as protein standard containing albumin (66 kDa), ovalbumin (45 kDa), glyceraldehyde-3- phosphate dehydrogenase (36 kDa), carbonic anhydrase (29 kDa), trypsinogen (24 kDa), trypsin inhibitor (20 kDa), ⁇ -lactalbumin (14.2 kDa) and aprotinin (6.5
- Example 1 Example 4: Characterisation of sec-alcohol dehydrogenase "ADH-A" from Rhodococcus ruber DSM 14855 a) Determination of Molecular Weight: The molecular weight is determined by running SDS-polyacrylamide gel electrophoresis and in parallel by a size exclusion column calibrated with standard proteins. The elution of the purified protein on Superdex 200 indicates a molecular mass for the native enzyme of about 62 kDa. In contrast, the SDS-PAGE procedure results in a single band at 38 kDa.
- the present enzyme displays activity over a broad range of pH values (see Table 4).
- Presence of Zinc ICP-MS analysis shows the presence of Zn 2+ in the purified enzyme preparation (see Hemmers, B., et al., J. Biol. Chem.275, 35786-35791 (2000), for the method). Whether this is required for catalytic activity and forms a true component of the enzyme is not determined at present. As the enzyme is both active in the presence of complex forming agents such as EDTA and in their absence, either the zinc is bound very firmly or it might not form part of the enzyme or its active site.
- ADH-A is ideally suited for this simple protocol, which is fully commensurate with the requirements of industrial applications.
- the purified enzyme is exceptionally stable towards acetone or 2- propanol in up to 10% v/v concentration for cofactor-recy ing in oxidation and reduction, respectively.
- excellent storage stability no loss of activity after 14 days at +4 °C, or after several months at -80 °C, or in lyophilised form
- more lipophilic substrates are rapidly transformed due to their enhanced solubility in aqueous/organic systems (as compared to pure aqueous systems).
- Table 7 Reduction Of 2-methyl-2-hepten-6-one by partially purified enzyme (after Hydrophobic Interaction Chromatography), using 2-propanol as co-substrate (10 ⁇ M substrate, 10 mM NADH, 30 °C; 100 % relative activity. 044 ⁇ mol conversion/mg protein):
- E is the Enantiomeric ratio (see Chen., C.-S., et al., J. Am. Chem. Soc. 104, 7294-99 (1982) (quotient of the reaction velocities of the isomers) Analogously, the following reactions can take place:
- Oxidation of: rac-(CH 3 ) 2 C €H-(CH 2 ) 2 -CHOH-CH 3 , rac-n-C 6 H 13 -CHOH-CH 3 , rac-4-phenyl-2- butanol, rac-(E)3-octen-2-on, cyclopentanol, rac-(1-(2-naphthyl)ethanol, rac-1-phenyl-1- ethanol.
- tryptic peptides are sequenced completely (SEQ ID NO: 1-4), one of them also being found as part of a somewhat larger peptide (SEQ ID NO: 5) with possibly modified N-terminus, and a tryptic peptide with an ambiguity in the N-terminal sequence is found (SEQ ID NO: 6), where [L/l] is leucine or isoleucine and X is an unidentified amino acid:
- Example 7 Obtaining of nucleotide sequences corresponding to the enzyme "ADH-A" Taking one of the peptide sequences given above in Example 6 or two or more thereof, especially SEQ ID NO: 1, the corresponding (fully degenerate, then preferably only the nucleotides corresponding to 3 to 6 of the amino acids given are used; partially degenerate, then also longer nucleotides can be synthesized, with non-specific nucleotides at positions of ambiguity; or "guessmers” that have only one specific sequence) nucleotide sequence corresponding to (sense sequence) or complementary (antisense) to the nucleotide sequence of the corresponding mRNA, based on the standard genetic code, is synthesized (e.g.
- oligonucleotide synthesizers for determination of useful oligonucleotides, their purification and use and the preparation of radio-labelled probes, the methods described by Sambrook et al., Molecular Cloning - a Laboratory Manual, Cold Spring Harbor Laboratory Press, pages 11.1 to 11.44 are be used. The labelled oligonucleotide or oligonucleotides are then hybridised (for conditions see Sambrook et al., loc.
- polymerase chain reaction is used for the preparation of the cDNA (see Lee, C.C., et al., Science 239(4845), 1288-91 (1988)).
- sequences between a start and a termination codon include the sequence(s) coding for the peptide backbone(s) of a part or the whole enzyme "ADH-A" or homologues displaying similar activity.
- Example 8 Isolation and characterization of the polynucleotide coding for ADH-A and determination of the corresponding amino acid sequence.
- a Rhodococcus ruber DSM 44541 DSM 14855 preculture is cultivated in 500 ml standard complex medium (10 g Yeast Extract, Oxoid L21; 10 g Bacteriological Peptone, Oxoid L 37; 10g glucose, Fluka 49150; 2g NaCl, Roth 9265.1; 0,15g MgS0 4 2O, Fluka 63140; 18g Agar, Oxoid L11; 1,3g NaH 2 P0 4 , Fluka 71496; 4,4g K 2 HP0 4 , Merck 5101; all amounts per I itre) overnight at 30 °C and 130 rpm.
- 500 ml standard complex medium (10 g Yeast Extract, Oxoid L21; 10 g Bacteriological Peptone, Oxoid L 37; 10g glucose, Fluka 49150; 2g NaCl, Roth 9265.1; 0,15g MgS0 4 2O, Fluka 63140; 18g Agar, Oxoid L11; 1,
- the cell suspension is then centrifuged at 3900xg, washed with 50ml 20% glycerol and pelleted at further time. 1g of the cell pellet is resuspended with 3ml TE25S-Puffer (25mM Tris pH8; 25mM EDTA;0,3M saccharose) and incubated with addition of lysozyme (Sigma L7651 , final concentration 2mg/ml) for 3 h at 37°C.
- 3ml TE25S-Puffer 25mM Tris pH8; 25mM EDTA;0,3M saccharose
- lysozyme Sigma L7651 , final concentration 2mg/ml
- the DNA is incubated with addition of 40 ⁇ g/ml RNase A (Applichem, A3832) 1 h at 37°C and, after that, further incubated with addition of 500 ⁇ g/ml proteinase K (Merck KGaA, #1.24568) 1 h at 3 ⁇ C. After another addition of phenol (see above) and precipitation with propan-2-ol, the purified DNA is dissolved in an appropriate volume of H 2 0.
- RNase A Applichem, A3832
- 500 ⁇ g/ml proteinase K Merck KGaA, #1.24568
- VXAVDXDDDR SEQ ID NO: 49
- EVGADAAVKSGAGAAGAXR SEQ ID NO: 50
- XFEWAXAR SEQ ID NO: 51
- XMEWAXAR SEQ ID NO: 6
- X in each case stands for leucine or isoleucine and which are identical to the peptides mentioned above and/or deduced from them and published sequences using a data bank, alcohol dehydrogenase sequences are identified that provide partial similarity to these peptides.
- the sequences taken into consideration for this purpose have the accession numbers NP_631415, ZP_00058234, BAA35108 and CAD36475.1 in or accessible via the NCBI databank (www.ncbi.nlm.nih.gov/).
- degenerate oligonucleotide primers are deduced from highly conserved regions identified in these sequences.
- the oligonucleotide primers are then used for a PCR screening using the isolated chromosomal DNA from R. ruber DSM 14855 (obtained as described under A) above).
- degenerate primers are used for a PCR screening based on the peptide partial sequences described in B1).
- PepB1-F2 GARGTNGGNGCNGAYGCNGC SEQ ID NO: 36 pepB1-R1 GCSGCGTCSGCGCCNACRTC SEQ ID NO: 37 pepB1-R2 GCNGCRTCNGCNCCNACYTC SEQ ID NO: 38 pepB2-R1 GATSGCGTCSGCSGCNCCSGCNGG SEQ ID NO: 39 pepC-R1 CGSGCSAGGTCSACSACGTCCAT SEQ ID NO: 40 pepC1-F GGNGCNGGNGCNGCNGAYGC " SEQ ID NO: 41 pepC1-R1 GCRTCNGCNGCNCCNGCNCC SEQ ID NO: 42 pepC1-R2 GCCGCCCCGGCGCC SEQ ID NO: 43 pepD-R "CKNGCNARIGCIACIAC SEQ ID NO: 44
- HotStar-Taq Master-Mix (Qiagen, Hilden, Germany) is used in accordance with the instructions provided by the manufacturer.
- the Expand l-cosmid vector with an insert capacity of 9-16 kb (Roche Diagnostics GmbH, Mannheim, Germany) is used.
- the chromosomal DNA from R. ruber DSM 14855 described under A) is restriction digested with Alul (NEB Inc., Beverly, USA) as follows:
- composition of the incubation mixture is a composition of the incubation mixture:
- the in vitro packaging and transformation of Escherichia coli DH5 is performed in accordance with the manufadurer's instrudions (Expand-Cloning Kit; Roche Diagnostics GmbH, Mannheim).
- a total of about 2500 clones is generated and archived in a 384 hole microtiter plate (MTP) format in a total of 6 MTPs in LB-liquid medium.
- MTP microtiter plate
- a grid PCR screening employing the nested primer mentioned using the "nested primers'' mentioned under B2), RS1_F1 und Asb_030730_R is performed.
- the clones of the 6 MTPs obtained under C) are replicated on LB solid medium and the cosmid DNA of the cells of each single MTP is isolated (Cosmid-Midiprap Kit, Qiagen, Langen, Germany).
- the PCR- analysis with the "nested primers” results in a DNA of MTP2with the expected size.
- the dones of the horizontal 24 rows are each pooled and analysed by means of colony PCR.
- a small amount of cell material is applied to the PCR incubation.
- PCR is performed using the nested primers RS1_F1 (SEQ ID NO:45) and Asb_030730_R (SEQ ID NO:46) under the conditions described below.
- the clones of the positive rows 15 and 16 are screened one by one by means of colony PCR (see above). By this procedure, the clones of the coordinates H15 and H16 are identified as positive. The cosmid DNA of these clones is isolated subsequently and used for sequencing.
- sequences responsible for the ADH-A activity can be obtained both on the polynucleotide as well as peptide level.
- Example 9 Whole cell catalysts with recombinant ADH-A activity
- nucleotide sequence of ADH-A is cloned in an expression vector in bacterial cells.
- clones derived from DSM 44541 Rhodococcus ruber are selected that show high ADH-A activity.
- the activity of clones as whole cell catalysts shows up to 100 fold increase in activity compared to the wildtype.
- the activity can be improved by a further factor of approximately two if the oxidation reaction takes place in the presence of 1 mM NAD + or the reduction reaction takes place in the presence of 1 mM NADH under otherwise the same reaction conditions as described in the preceding examples for the enzyme assay.
- Rhodococcus ruber DSM 44541 now Rhodococcus ruber DSM 14855.
- the strain has the following properties:
- Morphology elementary ramification rod/coccus growth cycle.
- Biochemical properties fatty acids: 5-30 % 16:0; 5-15 % 16:1; 5-15 % 18:0; 15-30 % 18:1;
- Rhodococcus ruber DSM 14855 is isolated from the lower Rhine on hexane as sole carbon source.
- the strains can be kept on a complex culture medium as described above at 30 °C and 130 rpm in L-shaking flasks with flow spoiler. After centrifugation, the pellet can be taken up in Tris-HCI buffer (pH 7.5, 50 mM), shock-frozen in liquid nitrogen and lyophilised, where desired and appropriate.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Analytical Chemistry (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention relates to biocatalysts showing alcohol dehydrogenase activity obtainable from Rhodococcus ruber, their preparation, their use in the oxidation of secondary alcohols and/or the reduction of ketones, as well as nucleic acids coding for these alcohol dehydrogenases and microorganisms transformed with nucleic acids coding for these biocatalysts and their use for producing the biocatalyst or oxidizing secondary alcohols and/or reducing ketones.
Description
Alcohol dehydrogenases with increased solvent and temperature stability
Summary of the invention
The invention relates to biocatalysts showing alcohol dehydrogenase activity, their preparation, their use in the oxidation of secondary alcohols and/or the reduction of ketones, as well as nucleic acids coding for these alcohol dehydogenases and microorganisms transformed with nucleic acids coding for these biocatalysts and their use for producing the biocatalyst and for the oxidation of secondary alcohols and/or the reduction of ketones.
Background of the invention
The Oppenauer oxidation (Op-Ox) and the inverse reduction, the Meerwein-Pondorf-Verley reduction (MPV-Red), are well-established oxidation or reduction processes for alcohols or ketones, respectively. The reactions are possible without requiring toxic heavy metals as catalysts (see, for example, J. March, Advanced Organic Chemistry, 3rd Ed., John Wiley 1985, pp 1058, 813; ISBN 04718547-7; C. F. deGraauw, J. A. Peters, H. van Bekkum, J. Huskens, Synthesis, 1994, 1007-17; and S. D. Burke, D. L. Danheiser, Handbook of Reagents for Organic Synthesis, Oxidizing And Reducing Reagents, Wiley 1994; ISBN 0471979260.
A disadvantage is that the strongly basic reaction conditions lead to undesired aldol-type side reactions (see K. G. Akamanchi, B. A. Chaudhari, Tetrahedron Lett. 38, 6925-8 (1997)). Substrates sensitive to basic conditions cannot be reacted without decomposition (see T. Ooi, Y. Itagaki, T. Miura, K. Maruoka, Tetrahedron. Lett. 40, 2137-8 (1999)). Asymmetric variants of the MPV-Red that employ chiral transition metal catalysts for enantioselective hydrid transfer have been tested only on few model substrates and resulted in preparatively inacceptably low stereoselectivities (see F. Touchard, M. Bernard, F. Fache, F. Debbecq, V. Guiral, P. Sautet, M. Lemaire, J. Org. Met. Chem. 567, 133-6 (1998); und E. Breysse, C. Pinel, M. Lemaire, Tetrahedron: Asymmetry 9, 897-900 (1998)).
In contrast, biocatalytic methods have the advantage that they can be led under mild conditions, e.g. at room temperature and approximately neutral pH in aqueous media (see K. Faber, Biotransformations in Organic Chemistry 4th Ed., Springer Verlag, , Heidelberg 2000; ISBN 3-540-61688-8). An additional valuable property of biocatalysts is their normally high
intrinsic stereoselectivity. In addition, the desired reaction usually takes place without side reactions. Biocatalytic redox processes on the basis of isolated alcohol dehydrogenases, however, require the presence of expensive cofactors, such as NAD+/NADH or NADP+/NADPH. The recycling of these substrates is difficulty and expensive (see W. Hummel, Adv. Biochem. Eng. /Biotech nol. 1997. 58, 145-184). One improvement of such processes is based on the presence of a second enzyme which, in the presence of a reducible or oxidizable component or cofactor, respectively, allows to recover the co-factor ("enzyme-coupled system", see W. Hummel, B. Riebel, Ann. N. Y. Acad. Sci. 1996. 799, 713-6). This variant, however, renders the process relatively complex and difficult to handle, as it is limited to such additives which are accepted as auxiliary component by the second enzyme. In addition, the concentrations of the substrates and the enzymes must be harmonized precisely for resulting in preparatively acceptable reaction rates. Furthermore, isolated enzymes usually have relatively short half lives under operating conditions. In order to achieve complete reaction into one direction, in the case of oxidation a carbonyl compound is added as reducible co-substrate in large molar excess, in the case of reduction a secondary alcohol as oxidizable co-substrate is added in large molar excess. This often results in difficulties especially with enzyme stability, as well as enzyme inhibition by the co- substrate.
If whole cells are used as biocatalysts in the stadium of fermentation, a lower addition of co- factors is required. In addition the cells are capable of recycling the co-factors themselves. However, the cells react very sensitively on high concentrations of organic substrates (substrate inhibition, solvent deactivation). For this reason, the biochemical MPV-Red and Op-Ox are limited to fermentative cells systems and low (co-)substrate concentrations (see G. Fantin, M. Fogagnolo, A. Medici, P. Pedrini, S. Fontana, Tetrahedron: Asvmmetrv 2000. 11,, 2367-73). In general, the substrate concentrations are below 0.15 mol/l and the co-substrate concentrations below 3 % (v/v) (see K. Nakamura, Y. Inoue, T. Matsuda, I. Misawa, J. Chem. Soc. Perkin Trans. 1 1999, 2397-2402; and A. Goswami, R. L. Bezbaruah, J. Goswami, N. Borthakur, D. Dey, A. K. Hzarika, Tetrahedron: Asymmetry 2000., 11, 3701-9).
Reductions of ketones to the respective alcohols have also been conducted with acetone- pulverized Gβotrichum candidum cells (see K. Nakamura, T. Matsuda, J. Org. Chem. 1998, 63, 8957-64). However, in this case, the cellular redox systens was partially inactivated during the freeze-drying of the cells. This required the addition of expensive redox-cofactors,
such as NAD+/NADH or NADP+/NADPH, for subsequent use as biocatalyst. The addition of (reducing) isopropyl alcohol as co-substrate was limited to about 3 % (v/v) in that case. Due to the relatively low concentration of this organic co-solvent, the concentration of lipophilic ketone substrates could only be adjusted to a maximum of 0.4 mol/l.
In view of all these unsatisfying results which constitute an unmet need, there remains the problem to find novel, more efficient catalytic systems offering more ease of use, which diminish or remove the mentioned and other unfavorable disadvantages and allow to conduct redox reactions of alcohols to oxo (especially keto) compounds or the inverse reaction in an especially advantageous way.
It is thus an object of the present invention to provide novel catalytic systems that allow for avoiding the mentioned disadvantages and that have advantageous properties that allow for improved biocatalytic reduction of ketones and/or oxidation of secondary alcohols, respectively.
General Description of the invention
The invention relates to a biocatalyst, especially an enzyme, preferably in (at least partially) purified form, which biocatalyst has alcohol dehydrogenase activity and which can be obtained from Rhodococcus ruber.
It has been found that this enzyme has unexpected and unique properties in comparison to other, known enzymes having the same type of activity. Especially, the novel enzyme has high temperature stability and in addition is capable of maintaining its activity in the presence of high concentrations of organic solvents (such as aromatic or aliphatic hydrocarbons, e.g. toluene, hexane) other than the co-substrates in up to 95, preferably up to 98 % concentration (v/v). This especially allows for leading the oxidation or reduction reactions under conditions of high temperature and especially in the presence of high co-substrate concentrations (in the case of oxidation of alcohols, the presence of high ketone concentrations; in the case of reduction of ketones, the presence of high alcohol concentrations). It therefore allows for production on an industrially useful scale, especially avoiding many of the disadvantages mentioned for the reactions formerly described. Among the further advantages, a prolonged storage stability can be mentioned, as well as a high operational stability of catalytic activity. The enzyme is also capable of working also in the
presence of complex-forming agents that usually would cause removal of bound catalytic metals like Zn2+.
Description of the Figures
Fig. 1 : Native gel analysis at different steps of the purification protocol of sec-alcohol dehydrogenase A. Lanes: Lane 1 - crude cell extract; lane 2: batch DEAE cellulose; lane 3: Phenyl Sepharose; lane 4: UNO Q6; lane 5: Blue Sepharose; lane 6: Superdex 200.
Fig. 2: SDS-PAGE analysis at different steps of the purification protocol of sec-alcohol dehydrogenase A. Lanes: Lane 1 - crude cell extract; lane 2: batch DEAE cellulose; lane 3: Phenyl Sepharose; lane 4: UNO Q6; lane 5: Blue Sepharose; lane 6: Superdex 200; lane 7: low molecular weight standard.
Detailed description of the invention
The following are preferred embodiments of the invention:
The invention especially relates to an biocatalyst with alcohol dehydrogenase activity, especially an enzyme, preferably in (at least partially) purified form, which has alcohol dehydrogenase activity, especially stereospecific alcohol dehydrogenase activity in the oxidation of secondary alcohols or the reduction of ketones; and which can be obtained from a naturally occuring microorganism, especially Rhodococcus, especially Rhodococcus ruber DSM 44541 -called Rhodococcus ruber DSM 14855 hereafter, in accordance with the number of the Budapest Treaty deposit (see below), see WO 03/078615 which is enclosed here by reference especially regarding the deposit of said microorganism.
The biocatalyst (or "enzyme") according to the invention is preferably present or used in purified form.
The invention also relates to a corresponding biocatalyst with alcohol dehydrogenase activity, obtained by recombinant technology (recombinant biocatalyst).
A further embodiment of the invention relates to the use of a biocatalyst with alcohol dehydrogenase activity according to the invention in the oxidation of secondary alcohols and/or the reduction of ketones (process of or according to the invention, hereinafter).
The process of the invention can be used especially for separating mixtures of stereo- isomers with respect to a center of chirality by kinetic resolution, if one stereo-isomer of an alcohol is specifically oxidized, or for the stereo-specific production of secondary alcohols having a specific chiral form from ketones.
Still a further embodiment relates to nucleic acids coding for such a biocatalyst with alcohol dehydrogenase activity, especially recombinant nucleic acids.
Another embodiment relates to microorganisms transformed with a nucleic acid coding for such a biocatalyst with alcohol dehydrogenase activity.
Further, the invention relates to the use of the mentioned microorganisms, especially host cells, in the production of said biocatalyst with alcohol dehydrogenase activity, as well as their use in the catalysis of the oxidation of secondary alcohols or the reduction of ketones, especially as shown in reaction scheme (A) below.
A further aspect of the invention relates to a (preferably isolated) polynucleotide, namely a DNA , or a (preferably isolated) recombinant polynucleotide comprising a DNA, each coding for a biocatalyst according to the invention, namely an enzyme, showing alcohol dehydrogenase activity, preferably as described above and below and in the examples as preferred, according to the invention which is characterized by the following sequence (SEQ ID NO: 47)
ATGAAAGCCG TCCAGTACAC CGAGATCGGC TCCGJAGCCGG TCGTTGTCGA CATCCCCACC 60 CCGACGCCCG GGCCGGGTGA GATCCTGCTG AAGGTCACCG CGGCCGGGCT GTGCCACTCG 120 GACATCTTCG TGATGGACAT GCCGGCGGCG CAGTΑCGCCT ACGGCCTGCC GCTCACCCTC 180 GGCCACGAGG GTGTCGGCAC CGTCGCCGAA CTCGGCGAGG GCGTCACGGG ATTCGGGGTG 240 GGGGACGCCG TCGCCGTGTA CGGGCCGTGG GGCTGCGGTG CGTGCCACGC CTGCGCGCGC 300 GGCCGGGAGA ACTACTGCAC CCGCGCCGCC GACCTGGGCA TCACGCCACC CGGTCTCGGC 360 TCGCCCGGAT CGATGGCCGA GTACATGATC GTCGATTCGG CGCGCCACCT CGTCCCGATC 420 GGAGACCTCG ACCCGGTCGC CGCGGCGCCG CTCACCGACG CCGGTCTGAC GCCGTACCAC 480 GCGATCTCCC GGGTCCTGCC GCTGCTGGGG CCGGGCTCGA CGGCCGTCGT CATCGGTGTC 540 GGCGGGCTCG GCCACGTCGG CATCCAGATC CTGCGCGCCG TCAGCGCGGC CCGTGTGATC 600 GCCGTCGACC TCGACGACGA CCGTCTCGCC CTCGCCCGCG AGGTCGGCGC CGACGCGGCG 660 GTGAAGTCGG GCGCCGGTGC GGCGGACGCG ATCCGGGAAC TGACCGGCGG CCAGGGCGCG 720 ACGGCGGTGT TCGACTTCGT CGGCGCCCAG TCGACGATCG ACACGGCGCA GCAGGTGGTC 780
GCGGTCGACG GGCACATCTC GGTCGTGGGC ATCCACGCCG GCGCACACGC CAAGGTCGGG 840
TTCTTCATGA TCCCGTTCGG CGCCTCCGTC GTGACCCCGT ACTGGGGCAC CCGGTCGGAA 900
CTGATGGAGG TCGTCGCGCT GGCCCGCGCC GGCCGGCTGG ACATCCACAC CGAGACGTTC 960
ACCCTCGACG AGGGGCCGGC GGCGTACCGG CGGCTGCGCG AGGGCAGCAT CCGCGGCCGC 1020 GGCGTGGTGG TTCCCTGA 1038
(especially preferred) where in a broader embodiment of the invention also such versions of the polynucleotide or recombinant polynucleotide are comprised where conservative nucleic acid replacements that lead to no change in the resulting amino acid sequence are present and/or such changes in the base sequence that lead to amino acid replacements in the amino acid sequence resulting from translation thereof for 5 % or less, preferably 3 % or less of the total number of amino acids coded by and resulting from translation of the sequence of SEQ ID NO: 47, for example the replacement of up to 3 amino acids, provided that the resulting polypeptides still display an alcohol dehydrogenase activity as the biocatalyst according to the invention (especially the substrate specificities, ph-optimum, temperature optimum, temperature stability, activity in the presence of EDTA or solvent stability properties mentioned below, or any combination of two or more of these properties, preferably all these properties), especially with at least the high solvent and temperature stability mentioned below.
Preferably, exactly the DNA of SEQ ID NO: 47 is comprised, in a broader embodiment also variants thereof with up to 30, e.g. up to 15 nucleic acid replacements.
Any equivalents unobvious and novel over prior art (especially alcohol dehydrogenase) sequences (also, for example, those including modified nucleic acids but still having coding activity) are also comprised, even if this is not mentioned in the claims.
Also comprised are corresponding polynucleotides or recombinant polynucleotides comprising the mentioned DNA sequence with insertions and/or deletions (either in addition to or alternatively to nucleic acid replacements), e.g. with a total of up to 300, preferably up to 90, for example up to 30 nucleic acids, preferably the insertions and deletions not affecting the reading frame, that is, resulting from addition or removal of one or more triplets, preferably in accordance with the mentioned boundaries, in each case provided that the resulting polypeptides after translation still display an alcohol dehydrogenase activity as the biocatalyst according to the invention.
In the case where a recombinant DNA comprising a DMA sequence coding for an enzyme showing alhohol dehydrogenase is mentioned, this is intended to include all vectors, such as plasmids, cosmids and the like, see also elsewhere in this specification.
The invention also relates to microorganisms transformed with a polynucleotide, especially a recombinant polynucleotide, each as mentioned above coding for such a biocatalyst with alcohol dehydrogenase activity - preferably to microorganisms appropriate for expressing the gene, but also those that comprise the nucleic acid for pure conservation or replication purposes. The invention also relates to the use of and a method of using these microorganisms (either living or killed, in complete or in at least partially digested form) especially in the oxidation or reduction reactions described above and below.
The invention also relates to the complementary nucleic acid for such a nucleic acid sequence as well as to double strands with both the complementary and the coding sequence.
A corresponding RNA (with U instead of T) is also comprised.
The invention also relates to the primers given in the examples under the SEQ ID Nos starting from SEQ ID NO 7 up to SEQ ID NO 46 and to the Rhodococcus rubber DSM 14855 DNA library mentioned in the examples.
Further, the invention also relates to a polypeptide showing alhohol dehydrogenase activity according to the invention (especially the substrate specificities, ph-optimum, temperature optimum, temperature stability and solvent stability properties mentioned below, or any combination of two or more of these properties, preferably all these properties), especially with at least the high solvent and temperature stability mentioned below, of the sequence with SEQ ID NO: 48
MKAVQYTEIG SEPVWDIPT PTPGPGEI L KVTAAGLCHS DI VMDMPAA QYAYG PLT 60 GHΞGVGTVAΞ LGEGVTGFGV GDAVAVYGPW GCGACHACAR GRENYCTRAA DLGITPPGLG 120 SPGS AEYMI VDSARHLVPI GD DPVAAAP TDAGLTPYH AIS VLPLLG PGSTAWIGV 180 GGLGHVGIQ1 LRAVSAARVI AVDLDDDRLA LAREVGADAA VKSGAGAADA IRELTGGQGA 240 TAVFDFVGAQ STIDTAQQW AVDGHISWG IHAGAHAKVG FF IPFGASV VTPY GTRSE 300
LMEWALARA GRLDIHTETF TLDEGPAAYR RLREGSIRGR GWVP 345
as well as truncated or elongated versions thereof and/or those with amino acid replacements, especially of up to 5 %, preferably up to 3 % of the number of amino acids forming part of the sequence given under SEQ ID NO: 48, e.g. up to three amino acid replacements, especially but not necessarily of a conservative nature, and/or insertions, sequence extensions or deletions or combinations of two or more thereof, in each case preferably not exceeding a total of 100, preferably 30, for example up to 10 additional or deleted amino acids, provided that the resulting polypeptides still display an alcohol dehydrogenase activity as the biocatalyst according to the invention.
Any equivalents unobvious and novel over prior art (especially alcohol dehydrogenase) polypeptide sequences (also, for example, those including modified amino acids but still having alcohol dehydrogenase activity as defined for a biocatalyst according to the invention) are also comprised, even if this is not mentioned in the claims.
The invention also relates to the use of or a method of using such a polypeptide (in purified or at least partially purified form especially in the oxidation or reduction reactions described above and below.
The determination of the complete sequence for the polynucleotide requires an unusual combination of a very specific DNA extraction and the primer strategy described in the examples. Simple standard procedures are not successful.
Unless indicated otherwise, the general terms, symbols and names used in the description of the present invention preferably have the following meanings (where more specific definitions, in each case separately, or in combination, may be used to replace more general terms in order to define more preferred embodiments of the invention):
The invention especially relates to a biocatalyst with alcohol dehydrogenase activity, especially an enzyme, preferably in purified form, which has alcohol dehydrogenase activity and which can be obtained from Rhodococcus ruber, especially Rhodococcus ruber DSM 14855. That the biocatalyst has alcohol dehydrogenase activity, is not intended to mean that other activities (be it of enzymatic, regulatory or any other kind) are excluded within the present disclosure.
The terms "biocatalyst of the invention" or "enzyme of the invention" or "enzyme (or polypeptide) showing alhohol dehydrogenase activity", where used herein, relate to a biocatalyst having alcohol dehydrogenase activity, especially an enzyme with said activity, most especially alcohol dehydrogenase "ADH-A", as described below. If not stated otherwise, all these terms include not only the naturally occurring, "authentic" sequence of a polypeptide of the invention, which are the preferred embodiments of the invention, but also all mutants, variants and fragments thereof which exhibit the alcohol dehydrogenase activity, preferably with the same stereoselective activity as the natural enzyme.
An enzyme of the invention preferably has one, more preferably two, most preferably three or more of the following properties:
(i) Molecular weight on denaturing SDS polyacrylamide gel after electrophoresis: 30 to 45 kDa, especially about 38 kDa.
(ii) Molecular weight according to size exclusion chromatography (especially under the conditions mentioned in the examples) on Superdex 200: 55 to 69 kDa, especially about 62 kDa.
(iii) pH optimum in the reduction of ketones, especially of acetophenone, in the presence of
NADH: pH 6 to pH 7.
(iv) pH optimum in the oxidation of secondary alcohols, especially of 1-phenylethanol, in the presence of NAD+: pH 8.5 to pH 9.5.
(v) Temperature optimum in the reduction of ketones, especially acetophenone, in the presence of NADH: between 43 and 65 °C.
(vi) Temperature optimum in the oxidation of secondary alcohols, especially 1-phenylethanol, in the presence of NAD+: between 43 and 65 °C.
(vii) Temperature stability in the reduction of ketones, especially acetophenone, in the presence of NADH or in the oxidation of secondary alcohols, especially 1-phenylethanol, in the presence of NAD+: at 50 °C less than 35 % activity loss during 24 hours.
(viii) No activity change in the presence of EDTA (especially up to 5 mM concentration of
EDTA) in an activity test at pH 7.5, 20 min incubation.
(ix) Presence of Zn 1" bound to the molecule.
(x) Stability meaning alcohol dehydrogenase activity also in the presence of up to 50, preferably up to 80 percent by volume of isopropanol.
(xi) Stability meaning alcohol dehydrogenase activity also in the presence of up to 20, preferably up to 50 percent by volume of acetone.
(xii) Presence of the partial sequence EVGADAAAR (SEQ ID No: 1) within the total sequence of at least one polypeptide forming the whole or part of the enzyme.
(xiii) Presence of the partial sequence TD[lJI]FEvVA[L l]AR (SEQ ID NO: 2) within the total sequence of at least one polypeptide forming the whole or part of the enzyme, where [L l] is leucine or isoleucine.
(xiv) Presence of the partial sequence SGAGAADA[L/I]R (SEQ ID NO: 3) within the total sequence of at least one polypeptide forming the whole or part of the enzyme, where [L/ϊ] is leucine or isoleucine.
(xv) Presence of the partial sequence V[L/I]AVD[L I]DDDE (SEQ ID NO: 4) within the total sequence of at least one polypeptide forming the whole or part of the enzyme, where [L/l] is leucine or isoleucine.
(xvi) Presence of the partial sequence V[L/i]AVD[L l]DDDXRX (SEQ ID NO: 5) within the total sequence of at least one polypeptide forming the whole or part of the enzyme, where
[L/l] is leucine or isoleucine and X stands for an unidentified amino acid.
(xvii) Presence of the partial sequence |TD/DT][L/l]lvlEWA[L/l]AR (SEQ ID NO: 6 (either with
TD in the beginning = at the amino terminus or with DT in the beginning) within the total sequence of at least one polypeptide forming the whole or part of the enzyme where the sequence in brackets is selected from the two alternatives mentioned therein and [L l] is isoleucine or leucine.
Especially preferred among these properties are those mentioned under (x) and/or (xi).
The term "within the total sequence of at least one polypeptide forming the whole or part of the enzyme" refers to the possibility that the biocatalyst/enzyme according to the invention may consist of one subunit (then it is formed from one polypeptide) or more than one (identical or different) subunits (then it is formed from the corresponding number of polypeptides).
More preferred is an enzyme of the invention wherein one of the partial sequences mentioned under (xii) to (xvii) is present or wherein one of the amino acids mentioned in any of these sequences is exchanged against a different amino acid, preferably by a
conservative replacement, e.g. of lipophilic against lipophilic, basic against basic, acidic against acidic, polar against polar amino acids, or the like.
Still more preferred is an enzyme the peptide sequence or, if more than one different subunits are present, sequences of which comprise a partial sequence selected from two, more preferably 3, even more preferably 4, still most preferably 5, most preferably 6 of the sequences mentioned above under (xii) to (xvii).
The enzyme of the invention is isolated (purified) from the microorganism by methods that are, perse, well known in the art, in particular by the methods described in the examples or methods analogous thereto, the whole purification method also forming an embodiment of the invention.
The Alcohol dehydrogenase activity is preferably determined by oxidation of 1 -phenylethanol (6.6 μM) and addition of 10 mM NAD+ (testing conditions: 30 °C, 10 μM Tris-buffer, pH 7.5, 10 min, conversion by GC-analysis), or as described in the Examples.
A biocatalyst of the invention is obtainable from a naturally occurring microorganism fermentable by a process comprising inoculating a selection medium with natural samples such as soil, water, or plant silage, preferably a hydrocarbon, e.g. hexane. Apart from the carbon source, the selection medium also contains all essential ingredients necessary for allowing growth of microorganisms, such as mineral salts, N-sources, and trace elements.
A naturally occurring microorganism having alcohol dehydrogenase activity can be obtained by a process known in the art, for example by isolation from a natural source, such as Rhine water.
In order to obtain the purified enzyme of the invention, the microorganism having alcohol dehydrogenase activity, especially Rhodococcus ruber DSM 14855, is cultivated in an aqueous nutrient medium, e.g. comprising yeast extract, peptone, glucose and mineral salts (e.g. 10 g/1 yeast extract 10 g/l peptone,2 g/1 NaCl, 0.15 g/l MgSO4 • 7H2O, 1.3 g/l NaH2P04, 4.4 g/l K2HP04) for some, e.g. three, days. Cell growth is followed by determination of the optical density via absorption, e.g. at 546 nm.
The cells are disrupted, the biomass is removed and the cell-free extract is obtained. The fermentation time is so selected that optimum titers with respect to alcohol dehydrogenase activity are achieved.
When the cell density has reached an adequate value, the cultivation is discontinued. The culture broth is separated off in known manner, e.g. by centrifugation, and the sedimented cells are broken down in customary manner, e.g. by shaking with fine glass beads, by ultrasound treatment, or using a French press. Insoluble cell components and, if used, glass beads, are removed, e.g., by centrifugation, and the residue is used as the enzyme source (crude extract). The residue, as an alcohol dehydrogenase activity-containing crude extract, can be used directly in the process according to the invention. Advantageously, however, in order to remove nucleic acids (viscous solutions) and other impurities or interfering components (e.g. other dehydrogenases with lower steric selectivity) the crude extract is subjected to further purification in order to obtain the enzyme of the invention in purified form. Preferably, the crude cell extract is subjected to one or more purification steps that, as such, are known in the art in order to remove interfering components from the extract.
A preferred method makes use of batch pretreatment with a cation exchanger, e.g. DEAE cellulose, and subsequent chromatographic (especially FPLC) separation first by Hydro- phobic Interaction Chromatography, e.g. over Phenyl Sepharose, advantageously after removing precipitations formed in the presence of (NH )2S04. With increasing (NH4)2SO4 content of the eluent, enzyme activity is eluted. The active fractions are further separated by anion exchange chromatography, preferably on an UNO Q column (BioRad). Elution by eluents with increasing sodium chloride content yields again active fractions with alcohol dehydrogenase activity. The interesting fractions are then further purified on a separation matrix comprising binding places for adenylyl-comprising cofactors, e.g. carrying the dye Cibacron Blue F3G-A or other moieties allowing for such affinity chromatography, especially using Blue Sepharose CI-6B, this innovative material allowing a surprisingly good further purification, although surprisingly no binding takes place. This adds to the information showing surprising properties of the enzyme according to the invention. The next step is size exclusion chromatography, e.g. using a Superdex 200 column. Here the enzyme of the invention elutes in fractions corresponding to a molecular weight between 55 to 69 kDa, with an average of about 62 kDa.
The term "purified" means preferably "in at least partially purified form" or "in enriched form" or, more preferably, purified in the stricter sense, that is, in practically isolated form (especially with more than 50, most especially more than 95 % purity by weight compared to other peptides present).
A corresponding biocatalyst with alcohol dehydrogenase activity, obtained by recombinant technology, then called a recombinant biocatalyst of the invention, (or also a biocatalyst from natural sources other than Rhodococcus ruber DSM 14855), preferably is defined as follows. The sequence of said biocatalyst may comprise deletions, insertions, terminal additions or exchanges (especially conservative exchanges, e.g. of lipophilic against lipophilic, basic against basic, acidic against acidic, polar against polar amino acids, or the like) of amino acids (preferably of up to 20, in case of terminal additions up to 1000; more preferably of up to 5, in case of terminal additions of up to 200 amino acids, respectively), or any combination of such changes, when compared to the sequence of the enzyme as purified in the examples or possible different subunits thereof, as long as the basic activity (alcohol dehydrogenase activity, especially with the substrates (preferably 1 -phenylethanol or acetophenone) and co- substrates mentioned in the examples) is still present, especially in connection with one or more of the additional advantageous properties mentioned for a biocatalyst according to the invention. Also, modified amino acids (with different structures than the 20 amino acids directly derivable from the genetic code) which may be modified during translation or post- translationally, may be present, e.g. 1 to 20, more preferably 1 to 5 such amino acids.
In a preferred embodiment of the use a biocatalyst with alcohol dehydrogenase activity in the oxidation of secondary alcohols or the reduction of ketones is the use in catalyzing the following reactions (reaction scheme (A)):
(IH) (IV) wherein, in formula I, la and lb, Ri and R2 are two different moieties from the group consisting of unsubstituted or substituted alkyl, unsubstituted or substituted alkenyl, unsub- stituted or substituted alkinyl, unsubstituted or substituted cycloalkyl, unsubstituted or substituted aryl and unsubsituted or substituted heterocyclyl, or Ri and R2 together form an unsubstituted or substituted bridge; and in formula III and formula IV, R3 and R4 are two different or preferably two identical lower alkyl or aryl moieties, or together form a bridge.
The term "lower" defines a moiety with up to and including maximally 7, especially up to and including maximally 4, carbon atoms, said moiety being branched or straight-chained. Lower alkyl, for example, is ethyl, n-propyl, sec-propyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pen- tyl, n-hexyl or n-heptyl or most preferably methyl.
"Substituted", wherever used for a moiety, means that one or more hydrogen atoms in the respective molecule, especially up to 5, more especially up to three, of the hydrogen atoms are replaced by the corresponding number of substituents which preferably are independently selected from the group consisting of alkyl, especially lower alkyl, for example methyl, ethyl or propyl, fluoro-lower alkyl, for example trifluoromethyl, C6-Cι6-aryl, especially phenyl or naphthyl (where C6-Cι6-aryl, especially phenyl or naphthyl, is unsubstituted or substituted by one or more, especially up to three moieties selected from halogen, carboxy, lower alkoxy- carbonyl, hydroxy, lower alkoxy, phenyl-lower alkoxy, lower alkanoyloxy, lower alkanoyl, ami- no, N-lower alkylamino, N,N-di-lower alkylamino, N-phenyl-lower alkylamiπo, N,N-bis(phenyl- lower alkyl )-amino, lower alkanoylamino, fluoro-lower alkyl, e.g. trifluoromethyl, and sulfo), C3-Cι0-cycloalkyl (that is unsubstituted or substituted by one or more, especially up to three moieties selected from halogen, carboxy, lower alkoxycarbonyl, hydroxy, lower alkoxy,
phenyl-lower alkoxy, lower alkanoyloxy, lower alkanoyl, amino, N-lower alkylamino, N,N-di- lower alkylamino, N-phenyl-lower alkylamino, N,N-bis(phenyl-lower alkyl)-amino, lower al- kanoylamino, fluoro-lower alkyl, e.g. trifluoromethyl, and sulfo), heterocyclyl that is unsaturated, saturated or partially saturated, is mono-, bi- or tri-cyclic and has 4 to 16 ring atoms, where instead of one or more, especially one to four, carbon ring atoms the corresponding number of heteroatoms are present (within the chemically possible limits) selected from nitrogen, oxygen and sulfur (with said heterocyclyl unsubstituted or substituted by one or more, especially up to three moieties selected from halogen, carboxy, lower alko- xycarbonyl, hydroxy, lower alkoxy, phenyl-lower alkoxy, lower alkanoyloxy, lower alkanoyl, amino, N-lower alkylamino, N,N-di-lower alkylamino, N-phenyl-lower alkylamino, N,N-bis- (phenyl-lower alkyl)-amino, lower alkanoylamino, fluoro-lower alkyl, e.g. trifluoromethyl, and sulfo), hydroxy, lower alkoxy, for example methoxy, phenyl-lower alkoxy, lower alkanoyloxy, amino, N-lower alkylamino, N,N-di-lower alkylamino, N-phenyl-lower alkylamino, N,N-bis- (phenyl-lower alkyl)-amino, lower alkanoylamino, carbarnoyl-lower alkoxy, N-lower alkyl- carbamoyl-lower alkoxy or N,N-di-lower alkylcarbamoyl-lower alkoxy, amino, mono- or di- lower alkylamino, lower alkanoylamino, carboxy, lower alkoxycarbonyl, phenyl-, naphthyl- or fluorenyl-lower alkoxycarbonyl, such as benzyloxycarbonyl, lower alkanoyl, sulfo, lower alkanesulfonyl, for example methanesulfonyl (CH3-S(0> -), phosphono (-P(=O)(OH)2), hydroxy-lower alkoxy phosphoryl or di-lower alkoxyphosphoryl, carbamoyl, mono- or di-lower alkylcarbamoyl, sulfamoyl and mono- or di-lower alkylarninosulfonyl. It goes without saying that substitutents are only at positions where they are chemically possible, the person skilled in the art being able to decide (either experimentally or theoretically) without inappropriate effort which substitutions are possible and which are not. Where more than one substituent is present, the substituents, if not indicated otherwise, are selected independently from each other.
Alkyl preferably has up to 24, more preferably up to 12 carbon atoms and, if possible in view of the number of carbon atoms, is linear or branched one or more times; preferred is lower alkyl, especially Cι-C4-alkyl. Alkyl can be substituted or unsubstituted, especially by one or more, more especially up to 3, of the substituents mentioned above under "substituted". Unsubstituted alkyl, especially lower alkyl, is one preferred embodiment.
Alkenyl is preferably a moiety with one or more double bonds and preferably has 2 to 20, more preferably up to 12, carbon atoms; it is linear or branched one or more times (as far as
possible in view of the number of carbon atoms). Preferred is C2-C7-alkenyl, especially C3-C4- alkenyl, such as allyl or crotyl. Alkenyl can be unsubstituted or substituted, especially by one or more, more especially up to three, of the substituents mentioned above under „substituted". Substituents such as amino or hydroxy (with free dissociable hydrogen) preferably are not bound to carbon atoms that participate at a double bond, and also other subtituents that are not sufficiently stable are preferably excluded. Unsubstituted alkenyl, in particular C2-C7-alkenyl, is especially preferred.
Alkinyl is preferably a moiety with one or more triple bonds and preferably has 2 to 20, more preferably up to 12, carbon atoms; it is linear of branched one or more times (as far as possible in view of the number of carbon atoms). Preferred is C2-C7-alkinyl, especially C3-C - alkinyl, such as ethinyl or propin-2-yl. Alkinyl can be unsubstituted or substituted, especially by one or more, more especially up to three, of the substituents mentioned above under ..substituted". Substituents such as amino or hydroxy (with free dissociable hydrogen) preferably are not bound to carbon atoms that participate at a triple bond, and also other subtituents that are not sufficiently stable are preferably excluded. Unsubstituted alkinyl, in particular C2-C7-aIkinyl, is especially preferred.
Aryl preferably has a ring system with not more than 20 carbon atoms, especially not more than 14 carbon atoms; is preferably mono-, bi- or tricyclic; and is unsubstituted or substituted by one or more, especially up to three, substitu tents, preferably as defined above under "substituted". For example, aryl is selected from the group consisting of phenyl, naphthyl, indenyl, azulenyl and anthryl, each of which is unsubstituted or substituted; preferably from phenyl or 1- or 2-naphthyl, each unsubstituted or substituted by one or more, preferably up to 5, substituents as defined above under "substituted".
Heterocyclyl is preferably a heterocyclic radical that is unsaturated, saturated or partially saturated, and is preferably a monocyclic or, in a broader aspect of the invention, bi- or tricyclic moiety; it has preferably 3 to 24, especially 4 to 16 carbon atoms, where instead of one or more, especially one to four, carbon ring atoms the corresponding number of heteroatoms are present, especially (within the chemically possible limits) selected from nitrogen, oxygen and sulfur; and where heterocyclyl is unsubstituted or substituted by one or more, especially up to three, substituents as defined above under "substituents". Preferably heterocyclyl is selected from the group consisting of oxiranyl, azirinyl, 1,2-oxathiolanyl, imidazolyl, thienyl,
furyl, tetrahydrofuryl, pyranyl, thiopyranyl, thianthrenyl, isobenzofuranyl, benzofuranyl, chromenyl, 2r -pyrrolyl, pyrrolyl, pyrrolinyl, pyrrolidinyl, imidazolyl, imidazolidinyl, benzimidazolyl, pyrazolyl, pyrazinyl, pyrazolidinyl, pyranyol, thiazolyl, isothiazolyl, dithiazolyl, oxazolyl, isoxazolyl, pyridyl, pyrazinyl, pyrimidinyl, piperidyl, piperazinyl, pyridazinyl, morpho- linyl, thiomorpholinyl, indolizinyl, isoindolyl, 3H-indolyl, indolyl, benzimidazolyl, cumaryl, indazolyl, triazolyl, tetrazolyl, purinyl, 4H-chinolizinyl, isochinolyl, chinolyl, tetrahydrochinolyl, tetrahydroisochinolyl, decahydrochinolyl, octahydroisochinolyl, benzofuranyl, dibenzofuranyl, benzothiophenyl, dibenzothiophenyl, phthalazinyl, naphthyridinyl, quinoxalyl, quinazolinyl, quinazolinyl, cinnolinyl, pteridinyl, carbazolyl, β-carbolinyl, phenanthridinyl, acridinyl, perimi- dinyl, phenanthrolinyl, furazanyl, phenazinyl, phenothiazinyl, phenoxazinyl, chromenyl, isochromanyl and chromanyl, where each of these moieties is unsubsituted or substituted as described above, especially by one or more moieties selected from lower alkyl, especially methyl, lower alkoxy, especially methoxy, halogen, especially fluoro, chloro, bromo or iodo, and halogen-lower alkyl, especially trifluoromethyl.
Cycloalkyl preferably has 3 to 12, more preferably 3 to 8 carbon atoms and is, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl or cycloheptyl; it is unsubstituted or substituted with one or more, especially up to 3, substituents, preferably as defined above under "substituted".
An unsubstituted or substituted bridge formed from Ri and R2 in formula I, la, lb or II is preferably a bridge formed by 2 to 12 carbon atoms that, together with the binding atom in formula I, la, lb or II forms a ring; where the bridge may contain one or more double and/or triple bonds at places other than the binding carbon atom (then the bridge has at least three carbon atoms) or is preferably saturated. The substituents are preferably chosen from 1 or more, especially up to three, substituents as defined under "substituents". Most preferred is a C2-C7-alkylen chain, such as ethylene, propylene, n-butylene, n-hexylene or n-heptylene, each of which is substituted by one or more, especially 1 or 2, of the moieties defined above under "substituted", or preferably is unsubstituted.
As far as compounds (including alcohols, ketones, substrates, co-substrates and the like) are mentioned herein, this includes also the corresponding salts or solvate salts thereof, if salt- forming compounds are present, as well as the corresponding solvates. Saltforming groups are especially basic groups, such as amino groups, or acidic groups, such as carboxy
groups. In the case of acidic groups, the corresponding metal salts, such as alkaline metal salts, e.g. sodium or potassium salts, or alkaline-earth metal salts, such as calcium salts, or salts with nitrogen bases, such as ammonium-, tri-lower alkylammonium, pyridinium salts or the like, can be present; in the case of basic groups, the corresponding acid addition salts may be present, e.g. with inorganic acids, such as sulphuric acid or hydrogen halides, such as HCI or HBr, or with organic acids, e.g. carboxylic acids, such as acetic acid, or sulfonic acids, e.g. methane sulfonic acid.
Examples for preferred secondary alcohols are hydroxy group carrying isoprenoids, such as mono-, di- or tri-terpenes, e.g. geraniol, isoborneol, ipsenol, menthol (especially (±)-menthol), nerolidol, hemandulcin, taxol or lanosterol, or steroids, such as cholestan-3-ol, cholesterol, ergosterin, stigmasterin, cholic acids, vitamin D2, vitamin D3, androsterone, testosterone, estrone, 17β-estradiol, estriol, cortisol, corticosterone, aldosterone, triamincolone, digitoxigenin, strophanthidine, ouabagenine, scillaridine or bufotalin; di-lower alkyl- or lower alkyl-lower alkenyl methanols, such as isopropanol, butane-2-ol, n-hexane-2-ol, n-heptane-2- ol, n-octane-2-oI, n-nonane-2-ol, 3-octanol, 5-methyl-2-heptanol, 3-octen-2-ol or 6-methyl- hex-5-en-2-ol; or n-decane-2-ol; R-, S- or R,S-1-phenyl-1 -ethanol, benzhydrol, R-, S- or R,S- 1-(1- or 2-naphthyl)-1 -ethanol, R-, S- or R,S-1-phenyl-2-butanol, wherein the naphthyl or phenyl moieties are unsubstituted or substituted by one or more, preferably up to 5, substituents independently selected from lower alkoxy, such as methoxy, lower alkyl, such as methyl, nitro, cyano, halogen, such as fluorine, chlorine, bromine or iodine, or halo-lower alkyl, such as trifluoromethyl; cyclopentanol, R-, S- or R,S-1-hydroxyethylcyclohexane or the like.
Preferred cosubstrates for the reduction are secondary alcohols, such as isopropanol, 4-me- thyl-2-pentanol or further other C,C-di-(lower alkyl)-methanols. These are preferably present in the reaction mixture in an excess, for example compared to the ketone to be reduced, for example making up 50 % (related to the volume of the reaction mixture, v/v). The concentration of the ketone to be reduced preferably lies below an upper limit of 3 mol/l, preferably up to 2,6 mol/l or lower.
Ketones to be reduced are especially free ketones or ketals thereof (such as especially di- (loweralkyl ketals or (cydic) (unsubstituted or substituted, for example by lower alkyl, such as methyl) lower alkylene ketals, such as ethylene ketals (dioxolan derivatives).
Examples are oxo-carrying isoprene derivatives, such as mono-, di- or triterpenes, e.g. menthone, pulegone, carvone, carone, verbenone, camphor, dihydrocarvone, dihydrocarvone hydrobromide, carvenone, hernandulcine or taxol or lanosterol, or steroids, such as androsterone, testosterone, estrone, cortisol, corticosterone, aldosterone or prednisone; di-(lower alkyl)- or lower alkyl-lower alkenyl-ketones, such as acetone, butane- one, n-hexan-2-one, n-heptan-2-one, n-octan-2-one, n-nonan-2-one, 3-octanone, 5-methyl-2- heptanone, 3-octen-2-one, 3-penten-2-one, 6-methyl-hex-5-en-2-one or 6-methyl-hept-5-en- 2-one; hydroxyacetone; or n-decan-2-one; acetophenone, methyl-1-(1- or 2-naphthyl)- ketone, methyl-1-phenylmethyl-ketone, 1-phenyl-2-propanone, benzophenone or phenacyl halogenides, wherein the naphthyl- or phenyl moieties in the moieties mentioned are in each case unsubstituted or substituted by one or more, preferably one to five substituents selected independendently of each from the group consisting of lower alkoxy, such as methoxy, lower alkyl, such as methyl, nitro, cyano, halogen, such as fluorine, chlorine, bromine or iodine, or halo-lower alkyl, such as trifluoromethyl; 2-furylethanone; cyclopentanone, cyclohexanone, 2- methylcyclohexanone, cycloheptanone, methyl-cyclohexylketone; keto esters, such as me- thylpyruvate, ethyl pyruvate, ethyl-bromopyruvate, ethyl-3-methyl-2-oxobutyrate, ethyl-3-oxo- butyrate, methyl-3-oxobutyrate, phenylglyoxylic acid methylester, phenylglyoxalic acid ethylester, 2-oxo-4-phenyl butyric acid methylester or the corresponding tert-butyl- or neopentyl ester.
For the use according to the invention in the oxidation or reduction in the presence of the biocatalyst according to the invention, customary conditions for chemical reactions of that type are chosen.
The preferred pH range for the oxidation of alcohols in the presence of ketones as co- substrates is kept in the area from pH 6 to pH 12, more preferably from pH 8 to pH 11. For the reduction, the preferred pH range lies between pH 5 and pH 9, more preferably between pH 6 and pH 8. The pH value is controlled by standard buffers, for example phosphate buffers with alkaline metal, especially potassium or sodium phosphate buffer, boronic acid/HCI/sodium hydroxide buffers, or other buffers, such as Tris/HCI, HEPES buffers or the like; and/or by automated titration with an acid, such as HCI, to keep the pH from rising, or a base, such as NaOH, to keep the pH from sinking.
The amount of the enzyme used is adapted to the amount of the substrate to be converted and can be calculated conveniently from the activity of the biocatalyst according to the invention (see e.g. purification table = Table 3 in Example 2).
The enzyme of the invention can also be used in the presence of surface active substances (surfactants, detergents). As detergents, for example,
- anionic tensides, that usually include long chain fatty acids as anionic, hydrophobic component, e.g. sulfates of long chain (especially C8-Cι8) alcohols, such as alkaline metal C8-Cι8alkanoylsulfates, especially sodium dodecylsulfate or sodium decylsulfate;
- cationic tensides, which besides hydrophobic, aliphatic or aromatic (especially alkyl) moieties include hydrophilic groups with a positive charge (e.g. quaternary ammonium), such as benzyl-dimethylstearylammonium chloride or cetylpyridinium chloride;
- amphoteric detergents, such as mono- or dicarboxylated imidazolines of fatty acids, such as sodium lauryldicarboxyimidazoline or sodium; or
- non-ionic tensides, such as ethoxylated sugar esters of higher fatty acids, such as polyoxyethylene-sorbitan-monolaurate, -palmitate, -stearate or -tristearate.
The temperatures for the use of the enzyme of the invention in the oxidation or reduction reactions preferably lies in the range customary for biocatalytic reactions or above, preferably in the range from 10 to 65, more preferably from 40 to 65 °C.
A preferred embodiment of the use according to the invention is in the steroselective (enantioselective or, in the presence of more than one center or axis of asymmetry, diastereoselective) production of chiral (or diastereomeric) alcohols from the corresponding ketones (especially of the formula II wherein Ri and R2 have different meanings) or form an asymmetric (e.g. asymmetrically substituted) bridge with prochiral oxo-carrying carbon by reduction of the prochiral C=0 group. The oxidation of or reduction to the S-enantiomer is especially preferred in this reaction. Enantiomeric purities in excess of 90 %, especially of 96 % (in terms of the enantiomeric excess = ee = 100 (2x - 1) where x is the molar fraction of the prevailing enantiomer) or more, most preferably of 99 % or more, are obtained with the enzyme of the invention.
Yet another preferred embodiment of the invention relates to the use of/process using the enzyme of the invention for the (mild) chemoselective (especially stereoselective) oxidation
of secondary alcohols, where only the hydroxy group with the appropriate steric form is oxidised to the corresponding oxo group (while other oxidable hydroxy groups in the same or other molecules remain intact). This can especially be used for the separation of isomers where from mixtures of alcohols only the reactive ones are oxidised, so that either the desired alcohols remain as such or the resulting oxo compounds are, in a subsequent step, again transformed into the desired alcohols by reversal of the reaction (reduction).
An especially preferred variant of this use (process) relates to the use of an enzyme according to the invention for the (mild) enantioselective oxidation of only one isomer of mixtures of enantiomers (or diastereomers), especially racemates, of secondary alcohols, especially of alcohols of the formula I wherein R1 and R2 are two different moieties, especially as defined above, or form an asymmetric (especially asymmetrically substituted) bridge. By this method, the remaining alcohol can be obtained in isomerically pure, especially enantiomerically pure, form, e.g. with 75 % or more, especially 95 % or more, more especially with 98 % or more enantiomeric excess regarding the carbon atom carrying Ri and R2.
The process of the invention can thus be used especially for separating mixtures of stereoisomers with respect to a center of chirality by kinetic resolution, if one stereoisomer of an alcohol is specifically oxidized, or for the stereospecific production of secondary alcohols representing a specific chiral form from ketones.
Still another preferred embodiment of the invention relates to the use of/ a process using an enzyme of the invention for the mild chemoselective reduction of ketones where only specific oxo groups are converted into the corresponding secondary hydroxy group(s), while other reducible groups (less amenable keto groups, C=C double bonds, nitro groups or the like) remain intact. This can also be used for separation processes in that from complex mixtures of ketones only the reactive ones are taking part in the reaction while either the desired oxo compounds remain in the reaction mixtures or the resulting alcohols are, in a subsequent inverse step (oxidation), converted back into the desired keto compounds. As in that reaction prochiral oxo-substituted carbon atoms are transformed into the corresponding asymmetrically substituted hydroxy-carrying carbon atoms, this is also appropriate for obtaining the isomerically, especially enantiomerically, pure alcohols (especially with a purity as defined above).
The process of the invention can be performed with free or immobilized biocatalyst according to the invention, which can be used in enriched or preferably in purified form. In another embodiment of the invention a recombinant microorganism (especially a host cell) which is present in suspension or immobilized and is expressing an enzyme of the invention is used for performing the reaction, i.e. the enzyme is in cell-bound form.
For example, an enzyme of the invention for use in a process of the invention may be immobilized. The immobilization of said enzyme can be carried out analogously to processes known perse, e.g. coupling to a solid support or enclosing in an enzyme membrane reactor.
The process of the invention may also be lead in the presence of a (free or immobilized) microorganism transformed by genetic engineering techniques with a gene coding for an enzyme of the invention to be able to produce the desired enzyme of the invention, especially in higher amounts than it would be present in the original microorganism, e.g. Rhodococcus ruber, especially Rhodococcus ruber DSM 14855.
The reaction of an alcohol or ketone substrate with an enzyme of the invention or a microbial cell extract is preferably carried out in homogeneous aqueous solution at pH 5 to 10.5, more preferably at pH 6 to 9.5. For the stabilization of the pH value, the reaction is carried out in a manner known perse in buffered solution or using a pH-stat. The reaction temperature is approximately from 10 to 65 °C, more preferably from 20 to 50 °C, even more preferably from 20 to 30 °C. The substrate is used preferably in a concentration of 1 mM to 2 M, more preferably 50mM to 500 mM. However, if the substrate is less soluble, it is also possible to use a substrate suspension.
The process according to the invention can be carried out either as a batch process or continuously in an enzyme membrane reactor (EMR). In the latter case, the enzyme membrane reactor is preferably fitted with an ultrafiltration membrane having a separation limit of less than approximately 30000 Da, so that the enzymes contained in the reaction mixture are held back whilst the low-molecular-weight products and unreacted rearfants pass through the membrane and the product can be isolated from the outflow. The reactor is preferably sterilized before use so that the addition of antibacterial substances can be
dispensed with. The reactions are carried out in a manner analogous to that described above.
The process according to the invention can also be carried out by percolating the solution containing the alcohol or ketone substrate, which has been adjusted to a suitable pH value, through a solid carrier on which the enzyme of the invention has been immobilized (the matrix-bound enzyme preparation is obtainable, for example, by percolation of the crude microbial extract through CNBr-activated Sepharose, Eupergit or the like).
Working up the reaction mixture and purification of the products in accordance with the invention are carried out by customary processes known from the State of the Art. For example, the reaction mixture can be clarified by filtration or, preferably, centrifugation, and then the enzyme can be separated by ultrafiltration (membrane with separation limit of < 30 kDa) and the remaining product can be washed out of the retentate by diafiltration.
The isolation of the desired products obtained according to any of the variants of the use of or process using the enzyme of the invention (secondary alcohol or ketone) is achieved using standard methods, such as distillation or rectification (fractionated distillation), steam distillation or azeotropic distillation, or using chromatographic methods, just to recite some examples to which the skilled person may add other methods as convenient or necessary.
Salts of educts or products can be converted into the free compounds, free compounds into the salts using standard methods, respectively.
Nucleic acids are preferably DNA or RNA (in general, oligo- or polynucleotides).
Isolated nucleic acids coding for a biocatalyst according to the invention with alcohol dehydrogenase activity, especially recombinant nucleic acids, are preferably obtained and defined as follows:
A nucleic acid, especially a gene, coding for a biocatalyst of the invention can, for example, be obtained by identifying at least a part of the sequence of an isolated enzyme of the invention, deducing DNA sequences coding for the partial protein sequence, preparing an oligonucleotide or a mixture of oligonucleotides (taking into consideration the degeneracy of
the genetic code) as probe(s), probing a DNA library derived from the microbial strain naturally expressing the activity of the biocatalyst (the term DNA library also including a "cDNA-library"), isolating the gene, and cloning it into a suitable vector for transformation of the microorganism to be genetically modified. All these methods (especially those depicted below for identification of, transformation with and expression of nucleic acids coding for an enzyme of the invention) are standard practice, e.g. as described in Sambrook et al., Molecular Cloning - A Laboratory Manual, 2nd edition, Cold Spring Harbor Press, 1989, or in in Gassen et al., "Gentechnische Methoden - Eine Sammlung von Arbeitsanleitungen fur das molekularbiologische Labor", Spektrum Akademischer Verlag, Heidelberg 1999, in F.M. Asubel (Hg.) "Short Protocols in Molecular Biology", 3rd ed., New York, Wiley 1997; or in Asubel et al., "Current Protocols in Molecular Biology", Vol. 1-3, Greene Publishing Associates and Wiley-lnterscience, New York, 1987. However, it should be noted that surprisingly only the very specific conditions mentioned in the examples finally lead to the desired nucleotide and amino acid sequence information (see Example 8 B3).
The partial sequencing of an enzyme of the invention is, for example, made using selective endoproteases for selective digestion, e.g. endo-protease Lys-C, endoprotease Glu-C, chymotrypsin, thermolysin or preferably trypsin (cleaving C-terminally from the basic amino acids arginine or lysine) and, after separation, e.g. electrophoretically on a gel or by chromatography (e.g .HPLC), determining the terminal sequences of the resulting peptides, e.g. by exopeptidases, e.g. carboxypeptidases, such as carboxypeptidase A , B or P). Preferred is tryptic digestion, then MS/MS analysis (TOF).
DNA libraries can also be obtained by PCR methods.
A cDNA library (obtainable e.g. after extraction of the mRNA from the cells, transformation into DNA using reverse transcriptase, introduction of sticky ends, introduction into a cloning vector, and introduction of that vedor into an appropriate host cell, e.g. a plasmid vector into a bacterium, such as a bacteriophage λ vector or a cosmid into E. coli, a yeast artificial into a yeast, such as Saccaromyces cerevisiae, a Pichia-pastoris vector into Pichia pastoris, or the like) or a DNA library (e.g. obtainable from selective digests of isolated DNA with restriction endonucleases, especially of type II, e.g. Alu I, Bam HI, Bgl I, Bst I, Eco Rl, Eco Rll, Fok I, Fnu Dl, Hae II, Hae III, Hind II, Hind III, Hpa I, Msp I, Not I, Pst I, Sac I, Sal I, Sau 3A, Sma I, Taq I, Xho I, Xma I or as mentioned in the examples; if necessary, filling up recessed termini
with Klenow fragment of E. coli DNA polymerase I, then ligating, e.g. with bacteriophage T4 DNA ligase, into a bacteriophage λ or cosmid vector for expression in E. coli or into a yeast artificial chromosome vector for expression in yeast) of the genomic DNA of the microorganism from which the enzyme of the invention can be isolated is then screened by stringent hybridization for matching polynucleotides (for appropriate conditions for stringent hybridisation see, for example, Sambrook et al., loc. cit., chapter 9) using (radioactive or fluorescence labeled) probes deduced from the known peptide fragments based on the genetic code which are produced according to standard procedures (fully degenerate, partially degenerate or using "guessmers"), which polynucleotides can then be isolated (e.g. from agar gels or the like) and sequenced. Longer nucleotides can be separated e.g. using pulsed field electrophoresis.
Hybridization is done using standard procedures, if necessary removing possible disturbing non-coding sequences, e.g. by PCR amplifying only the desired sequence parts or by endonuclease digestion, e.g. using dot blots of colonies of microorganisms from the DNA library. The positive clones can then be isolated.
The sequencing is done using standard procedures, e.g. the Maxam-Gilbert or the Sanger method.
If necessary, by combination of overlapping partial sequences the complete sequence coding for an enzyme of the invention (or one subunit thereof, if more than one polypeptide form the complete enzyme) can be determined.
From this sequence, the corresponding amino acid sequence of the enzyme is (or, if more than one polypeptide forms it, the subunits thereof, the amino acid sequences are) easily determined, using the genetic code.
In another approach, the full amino acid sequence of the isolated biocatalyst according to the invention can be determined (e.g. by different endopeptidase digests and matching of overlapping sequenced partial peptides) and a DNA coding the protein can be produced synthetically. It is also very easily possible to screen a suitable DNA library in a host, e.g. E. coli, for expression of temperature resistant alcohol dehydrogenase activity to obtain a transformed clone expressing the biocatalyst. Still another method makes use of antibodies
against an enzyme of the invention that can be obtained using standard procedures (up to and including the production of monoclonal antibodies obtained from myelomas obtained according to standard procedures) in order to isolate the ribosomes carrying the mRNA coding for the enzyme, transforming it into the corresponding DNA (e.g. with reverse transcriptase) and sequencing or genetically engineering the resulting enzyme.
The nucleic acid according to the invention is preferably present in isolated form or in recombinant form (then also in a microorganism, see below).
The nucleic acids according to the invention also comprise modified (especially recombinant, but also naturally occurring) nucleic acids where, when compared with the form sequenced as described above, one or more nucleic acids are deleted, inserted, exchanged or added terminally, as long as the polypeptide or polypeptides for which they code still display alcohol dehydrogenase activity, especially according to the test method with 1-phenylethanol or acetophenone as described in the Examples.
Terminal additions may comprise the addition of sequences for vectors or host nucleic acids into which the coding sequence may be combined.
More preferably, the modified nucleic acids are modified such as to code for a biocatalyst with alcohol dehydrogenase activity, obtained by recombinant technology (resulting in a recombinant nucleic acid) or alternatively from natural sources, where the amino acid sequence of the biocatalyst comprises deletions, insertions, terminal additions or exchanges (especially conservative exchanges, e.g. of lipophilic against lipophilic, basic against basic, acidic against acidic, polar against polar amino acids, or the li e) of amino acids (preferably of up to 20, in case of terminal additions up to 1000; more preferably of up to 5, in case of terminal additions of up to 200 amino acids, respectively), or any combination of such changes, when compared to the sequence of the enzyme as purified in the examples or possible different subunits thereof, as long as the basic activity (alcohol dehydrogenase activity, especially with the substrates (preferably 1 -phenylethanol or acetophenone) and co- substrates mentioned in the examples) is still present, especially in connection with one or more of the additional advantageous properties mentioned for a biocatalyst according to the invention.
Most preferably, the modified nucleic acids contain 1 to 50, more preferably 1 to 12, additional nucleotides by insertion (especially additions yielding no frame shift), 1 to 50, more preferably 1 to 12 changes in nucleic acids, preferably resulting in conservative amino acid changes, and/or 1 to 50, more preferably 1 to 12, deletions of nucleotides, especially without frame shift.
The invention also relates to probes, especially in radiolabelled or fluorescence labelled form, that are hybridizable under stringent conditions to genomic or cDNA or other nucleic acids coding and that code for the sequences of the six partial amino acid sequences given as SEQ ID NO: 1 to SEQ ID NO: 6, or for parts thereof, said probes preferably having a length of 6 to 24, more preferably of 12 to 21 nucleotides.
The embodiment of the invention relating to microorganisms transformed with a nucleic acid coding for such a biocatalyst with alcohol dehydrogenase activity preferably relates to microorganisms appropriate for expressing the gene, but also those that comprise the nucleic acid for pure conservation or replication purposes.
Appropriate microorganisms are especially viruses, bacteriophages or especially host cells, for example, bacteria, e.g. E. coli, single cell fungi, such as yeasts, e.g. Pichia pastoris, Schizosaccharomyces pombe or Saccharomyces cerevisiae, or plant cells.
The microorganisms, especially host cells, can be transformed with nucleic acids as such that code for an enzyme of the invention; however, usually they are transformed with suitable vectors, e.g. plasmids, cosmids, yeast artificial chromosome or the like, which may comprise partial sequences (e.g. useful in sequence determination) or total sequences for the enzyme (e.g. useful in the expression of the enzyme).
Transformation of host cells is made according to standard procedures known in the art and appropriate for the respective host cells, e.g. according to the calcium chloride method, by electroporation, transformation after spheroblast formation into fungi, transformation with polyethylene glycol, transformation with lithium chloride, or the like. Virus or the like are modified by introduction of the sequences comprising the coding sequences for the enzyme of the invention.
Especially, the invention relates to the use of the microorganisms, especially host cells, in the production of said biocatalyst with alcohol dehydrogenase activity.
Expression systems suitable for production of an enzyme of the invention are especially phage-based expression systems in bacteria, e.g. bacteriophage λ or cosmids for E. coli as host, yeast artificial chromosomes for expression in Saccharromyces cerevisiae, the Pichia pastoris expression system used for expression in Pichia pastoris, expression systems in Schizosaccaromyces pombe, the baculovirus expression system or the like. In each of these systems, the nucleotide sequences coding for an enzyme of the invention can be expressed, either as such or with additional N- or C-terminal sequences, e.g. such that allow for direct export of the resulting polypeptide outside the expressing cells. These extra sequences, if disturbing the activity or otherwise not desired, can then be cleaved off using appropriate endoproteases known in the art.
Preferred embodiments of the invention
Preferred embodiments of the invention are represented in the dependent claims, where in each case more general terms can be replaced with more specific terms provided in the definitions above, independently of other terms, in order to define still more preferred embodiments.
The invention relates in particular to the use of/process using the enzyme of the invention, and especially to the enzyme described in the Examples.
The following examples are illustrative, however, do not limit the scope of the present invention.
Examples:
Example 1: Cultivation of Rhodococcus ruber DSM 14855
The Gram-positive bacterium Rhodococcus ruber DSM 14855 is grown under aerobic conditions in baffled Erlenmeyer flasks at 30 °C and 130 rpm using a complex medium containing yeast extract, peptone, glucose and mineral salts (1O g/l yeast extract (OXOID CM129, OXOID Ltd., Hampshire, England), 10 g/l peptone, 2 g/l NaCl, 0.15 g/l MgSO4 • 7H 0, 1.3 g/l NaH2P04, 4.4 g/1 K2HPO4) for three days. Cell growth is followed by determination of the optical density via absorption at 546 nm, see Table 1. After a
centrifugation (2000 g, 20 min), the pellet is taken up in Tris-HCI buffer pH 7.5 (50 mM), shock-frozen in liquid nitrogen and lyophilised.
The cells produce several NAD+/NADH-dependent sec-alcohol dehydrogenases without any induction. The highest sec-alcohol dehydrogenase activity is displayed during the late exponential and early stationary phase of the growth curve (see table 1). The activity is measured as the ability of the cells to oxidise 1-phenylethanol or the ability to reduce acetophenone.
For this test, whole lyophilised cells of Rhodococcus ruber DSM 14855 (20 mg) are rehydrated in phosphate buffer (0.5 ml, 50 mM, pH 7.5) for 30 min. Activity is measured by adding acetophenone (0.27 mmol) and 2-propanol (0.4 ml). The mixture is shaken at 24 °C, 130 rpm in Eppendorf vials for 2.5 h. The reaction is quenched by addition of ethyl acetate (1 ml) and centrifugation. The conversion is determined by GC (Varian 3800, FID) on an achiral column (HP-1301 , 30 m x 0.25 mm x 0.25 μm; N2). Temperature program for rac-1- phenylethanol/acetophenone: start temperature 80 °C - hold 2 min - 10 "C/rniπ - until 130 °C - hold 2 min. The conversion is calculated from calibration curves. For the inverse test, 1- phenylethanol is oxidised in the presence of acetone as co-substrate.
Table 1: sec-Alcohol dehydrogenase activity versus growth curve for Rhodococcus ruber DSM 14855
Example 2: Purification of a sec-Alcohol dehydrogenase 'ADH-A' from Rhodococcus ruber DSM 14855 a) Cell Disruption Bearing in mind that the sec-alcohol dehydrogenase might be a mem rane-associated or even membrane-bound protein, cell disruption using a Vibrogen cell mill (glass beads, diameter 0.25 mm, Vibrogen Zellmuhle , E. Buhler, Typ VI-4; Braun Biotech Int., Melsungen, Germany) is used and optimised in order to obtain the majority of the activity in the cell-free lysate and not in the cell debris fraction. This results in an exceptionally long and rough procedure of 7 shaking cycles of 2 min agitation/ 5 min cooling each. The enzyme shows high stability against this strong mechanical treatment. The buffer used for cell disruption is 10 mM Tris-HCI buffer, pH 7.5.
Table 2: Optimization of the cell disruption by increasing number of shaking cycles
b) Pre-Treatment with DEAE-Cellulose:
Due to the harsh breaking of the cells, several undesired materials such as carotenoids, lipids and surface-active components are released from the cells beyond the sec-alcohol dehydrogenase activity. Those components lead to immense filtration problems and are thus removed by treatment with DEAE (Diethylaminoethan)-Cellulose (Sigma) in a batch procedure. All sec-alcohol dehydrogenase activity is bound onto the matrix in 10 mM Tris- HCI buffer pH 7.5 and can be eluted by addition of 0.5 M NaCl to the buffer. c) Purification Steps
The purification of the sec-alcohol dehydrogenase by FPLC (Fast Protein Liquid Chromatography)-methods starts with the cell-free lysate after pre-treatment with DEAE- Cellulose.
(i) Hydrophobic Interaction Chromatography The first protein purification step is a Hydrophobic Interaction Chromatography using Phenyl Sepharose High Performance material ((Amersham Pharmacia Biotech AB, Uppsala, Sweden). During sample preparation precipitation occurs by adding (NH4)2SO4), and solids are removed since they do not contain any sec-alcohol dehydrogenase activity. With addition of (NH4)2S04as salting-out medium to the equilibration buffer and a stepwise gradient, the different hydrophobicities of proteins enable a first separation of enzymes. Two NADVNADH dependent sec-alcohol dehydrogenase activities are found, but just one fraction, arbitrarily called sec-'ADH-A' (standing for sec-alcohol dehydrogenase + 'acetone') shows stability against the co-substrates acetone/2-propanol. The second activity, called B^ is significantly less stable and is thus not further investigated.
Details of step (i): Column length 75 mm, diameter 16 mm. Eluent: A: B + 1 M (NH4)2S04; B = 10 mM Tris-HCI buffer pH 7.5.
Application volume: 3 times 46 ml are administered (3 separate runs).
Elution: first 70 ml A, then 47,5 ml 50 % A + 50 % B, then 47,5 ml 25 % A + 75 % B, then linear gradient during 47,5 ml from 25 % A + 75 % B to 100 % B and further elution with this eluent. Flow rate 4 ml/min.
Activity of Bi is found between 70 and 118 ml. Activity of seo'ADH-A' is found between 220 and 236 ml elution volume. The latter (3 x 16 ml after 3 runs, a total of 48 ml) is used for further purification.
(ii) Ion Exchange Chromatography The complete fraction (46 ml) containing sec-'ADH-A' is further purified by Ion Exchange Chromatography using the anion exchanging column UNO Q6 (BioRad). By running an optimised stepwise gradient using chloride as counter ion in the elution buffer, the sec- alcohol dehydrogenase activity is separated again into two NAD+/NADH dependent fractions, whereof again one is identified as sec-ADH A. The second sec-ADH B2 is significantly less stable and thus is not further investigated.
Details of step (ii) .Column length 53 mm, diameter 12 mm.
Elution buffer: A 10 mM Tris-HCI-buffer pH 7.5; B: A + 1.5 M NaCl ("100 % NaCl).
Gradient: First elution with 62 ml of A, then with 67 ml of 82,75 % A + 17,5 % B, then with 28 ml of 50 % A + 50 % B, finally with pure B. Flow rate 4 ml/min.
Activity of B3 is found between 68 and 82 ml. Activity of sec-'ADH-A' is found between 131 and 137 ml elution volume. The latter (6 ml) is used for further purification.
(iii) Affinity Chromatography The third step in protein purification of the resulting 6 ml from step (iii) is carried out on an innovative material, Blue Sepharose CI-6B [see Shaw et al., Biochem. J. 187, 181 (1996)], containing a dye, Cibacron Blue F3G-A, specific for enzymes requiring adenylyl-containing cofactors (such as NAD+/NADP+) (Amersham Pharmacia Biotech AB, Uppsala, Sweden).
In contrast to theory, sec- 'ADH-A' does not bind on the matrix but elutes right after the void volume, regardless of the conditions used. But at linear increased salt concentration, another sec-ADH is found and is identified again as NAD+/NADH dependent sec-alcohol dehydrogenase B3, which is significantly less stable and thus not further investigated.
Details of step (iii): Column length 60 mm, diameter 16 mm.
Eluent: Buffer A: 10 mM Bis-tris-HCI buffer pH 6.0; Buffer B: A + 1 M NaCl.
Gradient: First 31 ml of buffer A, then linear gradient from 100 % buffer A to 100 % buffer B.
Flow Rate 4 ml/min.
Activity of alcohol dehydrogenase B3 is found between 44 and 68 ml. Activity of sec-'ADH-A' is found between 7 and 23 ml elution volume. The latter is concentrated up on Centriplus YM-10, cut-off 10 kDa (regenerated cellulose with 10 kDa exclusion size) from Millipore lipore GmbH, Vienna, AT)/Amicon to a final volume of 2 ml.
(iv) 2.3.4 Size Exclusion
Size exclusion using this Superdex 200 column (Amersham Pharmacia Biotech AB, Uppsala, Sweden) leads to final purification, the only sec-alcohol dehydrogenase activity detected is sec-ADH A. 10 runs with 0.2 ml each of the resulting 2 ml in step (ii) are used.
As the column is calibrated with several standard proteins, namely yeast alcohol dehydrogenase (150 kDa), Bovine Serum Albumin (67 kDa), ovalbumin (43 kDa), chymotrypsinogen (25 kDa) and blue dextran (2 kDa), the molecular weight of the native enzyme is determined as approximately 62 kDa.
Details for step (iv): Column length 310 mm, diameter 10 mm.
Eluent: 50 mM NaH2PO4, 0.15 M NaCl, pH 7.0
Flow Rate 4 ml/min.
10 times 1 ml of fractions containing the activity of sec-'ADH-A' are obtained (after about 13 ml of elution). The molecular weight is determined based on the peak concentration of the
ADH-A activity.
Summary of the purification protocol:
Following this protocol, the sec-alcohol dehydrogenase 'ADH-A' is purified reproducibly. The small overall recovery is explained by a major loss of activity during desalting procedures and buffer exchange via dialysis and during concentration to a small volume before applying it to the size-exclusion column. For this reason, the majority of biochemical characterizations
are carried out with sem/-pure enzyme after the dye chromatography, where no other sec- alcohol dehydrogenase activity is left.
In addition, the "low" yield is attributable to the fact that in the cell extract at the beginning other alcohol dehydrogenases that are removed during the later procedure (e.g. Bi, B2 and B3) contribute to the dehydrogenase activity.
In the following table, 1 U = 1 μMol/min.
The activity is determined by oxidation of 1-phenylethanol (6.6 μM) and addition of 1O mM NAD+ (testing conditions: 30 °C, 10 μM Tris-buffer, pH 7.5, 10 min, conversion by GC- analysis). Protein amounts are measured by the method of Bradford (Coomassie Blue Protein Assay) at 595 nm using a BioRad Protein Assay:
Table 3: Purification Table
Example 3: Purification control and molecular weight determination by gel electrophoresis: The progress of the protein purification is controlled by native as well as by SDS- polyacrylamide gel electrophoresis (PAGE). For both methods, the protein fractions are
subjected to a Laemmli SDS-PAGE system using a MINI-PROTEAN II dual slab cell (BioRad).
a) Native Gel Electrophoresis
Active fractions are treated with non-denaturing sample buffer and loaded on a polyacrylamide gel (12%) without SDS. The gel is run at 4 °C at 150 V with running buffer containing 15 g/l Tris and 72 g/l Glycine. The method for visualization of sec-alcohol dehydrogenases in polyacrylamide gels was first reported by Grell et al. [see Science 149, 80 (1965)] and is based on a staining solution [see Dodgson et al., Biochem. J. 187, 703 (1996)] mixed from aqueous 4 mM 2-octanol (or any aliphatic, long-chained sec-alcohol accepted as substrate) and 100 M Tris-HCI buffer pH 8.5 containing 3 g/l NAD+, 0.1 g/l phenazinemethosulphate (N-methyldibenzopyrazine ethylsulfate salt) and 1 g/l nitro blue tetrazolium. Purple spots of the reduced formazane are usually visible within 30 min of incubation and display the presence of a sec-alcohol dehydrogenase. For result see Fig. 1.
There are at least seven different sec-alcohol dehydrogenases present in the microorganism, of which sec-alcohol dehydrogenase 'ADH-A' can be separated properly during the purification protocol.
b) SDS polyacrylamide gel electrophoresis
In this case, the same protein samples used for native electrophoresis are denaturated with sample buffer (SDS reducing buffer, BioRad) and administered to a SDS-polyacrylamide gel (12%) subsequently run at 200V at room temperature in the same running buffer with addition of 3 g/1 SDS. After the run, staining is carried out with Coomassie Brilliant Blue. The molecular weight is determined in comparison to a low molecular weight range SigmaMarker as protein standard containing albumin (66 kDa), ovalbumin (45 kDa), glyceraldehyde-3- phosphate dehydrogenase (36 kDa), carbonic anhydrase (29 kDa), trypsinogen (24 kDa), trypsin inhibitor (20 kDa), α-lactalbumin (14.2 kDa) and aprotinin (6.5 kDa). The result is a single band after the size exdusion corresponding to 38 kDa.
Example 1 : Example 4: Characterisation of sec-alcohol dehydrogenase "ADH-A" from Rhodococcus ruber DSM 14855 a) Determination of Molecular Weight:
The molecular weight is determined by running SDS-polyacrylamide gel electrophoresis and in parallel by a size exclusion column calibrated with standard proteins. The elution of the purified protein on Superdex 200 indicates a molecular mass for the native enzyme of about 62 kDa. In contrast, the SDS-PAGE procedure results in a single band at 38 kDa. This discrepancy may be explained by the structure of the protein, as either (i) long thin proteins elute generally earlier than globular proteins or (ii) a dimer may be present. Due to the unsymmetric peak form of the protein in relation to the standards, the determination of the peak maximum limits the accuracy of molecular weight calculations. b) pH-Optimum The measurements are carried out in 25 mM Tris-maleate pH 6.0 - 9.0 and 50 mM NaH2PO4 pH 10.0 - 11.0, and the activity is determined via conversion of 1-phenylethanol or acetophenone (6.6 mM) by addition of 10 mM NAD* or NADH, respectively. The reaction time is 10 min at 50 °C. The present enzyme displays activity over a broad range of pH values (see Table 4). The pH-optimum is different for the two possible reactions. While the enantioselective (ee >99%) reduction of ketones prefers a pH of 6.5 - 7.5, the oxidation of sec-alcohols is enhanced in more basic conditions and is very efficient over an extremely broad pH-range. The selectivity of the oxidation does not change when the pH is raised, i.e. ee = >98% at pH 9.0. Routinely, all reactions are conducted at pH 7.5 for both ox dation and reduction to minimize buffer exchange procedures.
c) Temperature Optimum The effect of temperature on the sec-alcohol dehydrogenase 'ADH-A' is measured in 10 mM Tris-HCI buffer pH 7.5, 1 -phenylethanol or acetophenone (6.6mM) are used as substrates in presence of 10 mM NAD+/NADH, respectively. Substrate and enzyme are incubated for 5 min using a thermostated shaker at a set temperature. Then the reaction is started at this temperature by addition of NAD7NADH and the reaction is carried out for 10 min .
Surprisingly, the sec-alcohol dehydrogenase 'ADH-A' shows maximum of activity within the range of 45 to 65 °C, an exceptionally high value (See Table 5). Inactivation occurs quite suddenly at 70 °C.
d) Temperature Stability For the determination of enzyme stability at different temperatures, oxidation as well as redudion are performed as described before in 10 mM Tris-HCI buffer pH 7.5 and within a temperature range from 25 to 50 °C. After incubation of the enzyme solution at 50 °C, the reaction is started by addition of the corresponding cofactor and is run for 10 min. Again (see Table 6), the sec-alcohol dehydrogenase 'ADH-A' displays an exceptional thermo-stability for a protein from Rhodococcus ruber DSM 14855, which is not known as a thermophile. The loss of activity after 24 hours is rather small for both the oxidation and reduction system, which indicates an enormous stability of the protein. Due to this property, a wide scope of industrial applications can be anticipated.
3. Table 6: Temperature stability
e) Presence of Zinc
ICP-MS analysis shows the presence of Zn2+ in the purified enzyme preparation (see Hemmers, B., et al., J. Biol. Chem.275, 35786-35791 (2000), for the method). Whether this is required for catalytic activity and forms a true component of the enzyme is not determined at present. As the enzyme is both active in the presence of complex forming agents such as EDTA and in their absence, either the zinc is bound very firmly or it might not form part of the enzyme or its active site.
Example 5: Coupled Enzymatic Reduction/Oxidation System
Despite impressive progress in the regeneration of nicotinamide cofactors on the lab-scale using the 'coupled-enzyme method' [see, e.g., Hummel, Trends Biotechnol. 17, 487 (1999) or Chenault et al., Appl. Biochem. Biotechnol. 14, 147 (1987)], purified redox enzymes are not ideally suited for industrial applications due to their limited operational lifetime. In contrast, the so-called 'coupled-substrate-approach' is restricted due to the limited tolerance of most ADH's towards elevated (co)substrate concentrations [see Faber, Biotransformations in Organic Chemistry, 4th edition, Springer, Heidelberg 2000, pp. 177-183]. In contrast, ADH-A is ideally suited for this simple protocol, which is fully commensurate with the requirements of industrial applications. The purified enzyme is exceptionally stable towards acetone or 2- propanol in up to 10% v/v concentration for cofactor-recy ing in oxidation and reduction, respectively. In addition, excellent storage stability (no loss of activity after 14 days at +4 °C, or after several months at -80 °C, or in lyophilised form) makes this enzyme a prime candidate for large-scale applications. In particular, more lipophilic substrates are rapidly transformed due to their enhanced solubility in aqueous/organic systems (as compared to pure aqueous systems).
The following Tables show the reduction of various ketone substrates (Table 7) and the oxidation of various sec-alcohol substrates (Table 8).
The steric preference of the reduction follows the Prelog rules. In the case of oxidation, that enantiomer is oxidised that would be formed during reduction of the respective ketone.
Table 7: Reduction Of 2-methyl-2-hepten-6-one by partially purified enzyme (after Hydrophobic Interaction Chromatography), using 2-propanol as co-substrate (10 μM substrate, 10 mM NADH, 30 °C; 100 % relative activity. 044 μmol conversion/mg protein):
Table 8: Oxidation of 2-octanol by partially purified enzyme (after Hydrophobic Interaction Chromatography) using acetone as co-substrate (10 μM substrate, 10 mM NAD+, 30 °C, 12h; 100% rel. act. = 13 μmol conversion/mg protein):
*) E is the Enantiomeric ratio (see Chen., C.-S., et al., J. Am. Chem. Soc. 104, 7294-99 (1982) (quotient of the reaction velocities of the isomers)
Analogously, the following reactions can take place:
Reduction of: 2-heptanone, 2-octanone, 2-nonanone, 2-decanone, 1-cyclohexylethanone, 1- (naphtha-2-yl)ethanone, oct-3-en-2-one (leading to the S-enantiomers in more than 97 % ee).
Oxidation of: rac-(CH3)2C=€H-(CH2)2-CHOH-CH3, rac-n-C6H13-CHOH-CH3, rac-4-phenyl-2- butanol, rac-(E)3-octen-2-on, cyclopentanol, rac-(1-(2-naphthyl)ethanol, rac-1-phenyl-1- ethanol.
Example 6: Determination of Parts of the Protein Sequence of "ADH-A" Using a MS/MS de novo-sequencing protocol after tryptic digestion (see Lehmann, W.D., Massenspektroskopie in der Biochemie (= Mass Spectroscopy in Biochemistry). Spektrum Akad. Verlag, pp. 274-293, 1996 (ISBN 3-86025-094-9)) for the purified "ADH-A" enzyme obtained according to example 2, the following results are obtained.
4 tryptic peptides are sequenced completely (SEQ ID NO: 1-4), one of them also being found as part of a somewhat larger peptide (SEQ ID NO: 5) with possibly modified N-terminus, and a tryptic peptide with an ambiguity in the N-terminal sequence is found (SEQ ID NO: 6), where [L/l] is leucine or isoleucine and X is an unidentified amino acid:
Sequence SEQ ID NO: EVGADAAAR 1 TD[L/I]FEWA[L/I]AR 2 SGAGAADA[I_/I]R 3 V[L/I]AVD[L/I]DDDR 4 V[L/I]AVDXDDDXRX 5 [TD/DT] [UI]MEWA[IJI]AR 6 (either with TD in the beginning or with DT in the beginning)
Example 7: Obtaining of nucleotide sequences corresponding to the enzyme "ADH-A" Taking one of the peptide sequences given above in Example 6 or two or more thereof, especially SEQ ID NO: 1, the corresponding (fully degenerate, then preferably only the
nucleotides corresponding to 3 to 6 of the amino acids given are used; partially degenerate, then also longer nucleotides can be synthesized, with non-specific nucleotides at positions of ambiguity; or "guessmers" that have only one specific sequence) nucleotide sequence corresponding to (sense sequence) or complementary (antisense) to the nucleotide sequence of the corresponding mRNA, based on the standard genetic code, is synthesized (e.g. according to Narang, Tetrahedron 39, 3 (1986) or Itakura et al, Annu. Rev. Biochem. 53, 323 (1984); or using standard oligonucleotide synthesizers). For determination of useful oligonucleotides, their purification and use and the preparation of radio-labelled probes, the methods described by Sambrook et al., Molecular Cloning - a Laboratory Manual, Cold Spring Harbor Laboratory Press, pages 11.1 to 11.44 are be used. The labelled oligonucleotide or oligonucleotides are then hybridised (for conditions see Sambrook et al., loc. cit, pages 11.45 to 11.61) to cDNA libraries (obtained according to Sambrook et al., loc. cit. pages 8.1 to 8.86). After identification of colonies with positive signals, these are grown and the vectors containing the hybridisable cDNA are isolated. The DNA is then sequenced according to standard methods (e.g. as shown in Sambrook et al., loc. cit, pages 13.1 to 13.103).
In one example, polymerase chain reaction is used for the preparation of the cDNA (see Lee, C.C., et al., Science 239(4845), 1288-91 (1988)).
The sequences between a start and a termination codon include the sequence(s) coding for the peptide backbone(s) of a part or the whole enzyme "ADH-A" or homologues displaying similar activity.
Example 8: Isolation and characterization of the polynucleotide coding for ADH-A and determination of the corresponding amino acid sequence.
A) Isolation of chromosomal DNA from Rhodococcus ruber DSM 14855
A Rhodococcus ruber DSM 44541 = DSM 14855 preculture is cultivated in 500 ml standard complex medium (10 g Yeast Extract, Oxoid L21; 10 g Bacteriological Peptone, Oxoid L 37; 10g glucose, Fluka 49150; 2g NaCl, Roth 9265.1; 0,15g MgS042O, Fluka 63140; 18g Agar, Oxoid L11; 1,3g NaH2P04, Fluka 71496; 4,4g K2HP04, Merck 5101; all amounts per I itre) overnight at 30 °C and 130 rpm. The cell suspension is then centrifuged at 3900xg, washed with 50ml 20% glycerol and pelleted at further time. 1g of the cell pellet is resuspended with 3ml TE25S-Puffer (25mM Tris pH8; 25mM EDTA;0,3M saccharose) and incubated with
addition of lysozyme (Sigma L7651 , final concentration 2mg/ml) for 3 h at 37°C. After addition of 4ml disintegration solution (10ml 10% SDS; 6g sodium-4-aminosalicylate>, Sigma #A3505; 2,5ml 2M Tris pH8; 3ml phenol; ad 50ml distilled water, store under protection from light) inversion for 10min at room temperature (RT) follows, and after the addition of 8 ml phenol/chloroform/isoamyl alcohol a further inversion is performed. After centrifugation at 3900xg the aqueous phase is decanted and is again complemented with phenol, precipitated by addition of 0.6 vol. propan-2-ol and 0.1 vol. 3M sodium-acetate and subsequently washed in 70% ethanol, dried and dissolved overnight at 4°C in H20. After this, the DNA is incubated with addition of 40μg/ml RNase A (Applichem, A3832) 1 h at 37°C and, after that, further incubated with addition of 500μg/ml proteinase K (Merck KGaA, #1.24568) 1 h at 3 βC. After another addition of phenol (see above) and precipitation with propan-2-ol, the purified DNA is dissolved in an appropriate volume of H20.
B) Sequence Analysis and deduction of degenerate primers
Various attempts to make use of classical cloning attempts failed to provide a success in obtaining the complete or at least partial sequence of the gene coding for an alcohol dehydrogenase according to the invention. Thus, both the sequence analysis of related alcohol dehydrogenases and the synthesis of degenerate primers on the basis of conserved regions as well as the deduction of degenerate primers (see below) on the basis of known internal peptide sequences of the alcohol dehydrogenase according to the invention (ADH- A), in both cases with subsequent PCR screening of the chromosomal DNA failed. Apparently the high GC content of the gene that can be deduced from the sequence as finally recovered using a novel approach was responsible for the formation of stable or disturbing secondary strudures that led to this problem.
After various fruitless attempt, surprisingly only a combination of primers that results from both approaches leads with the primers identified below to the identification of a partial sequence of the gene.
B1) Dedudion of degenerate oligonucleotide primers on the basis of known internal peptide sequences of ADH-A
Based on the peptide sequences
VXAVDXDDDR (SEQ ID NO: 49) EVGADAAVKSGAGAAGAXR (SEQ ID NO: 50 XFEWAXAR (SEQ ID NO: 51) XMEWAXAR (SEQ ID NO: 6)
where X in each case stands for leucine or isoleucine and which are identical to the peptides mentioned above and/or deduced from them and published sequences using a data bank, alcohol dehydrogenase sequences are identified that provide partial similarity to these peptides. The sequences taken into consideration for this purpose have the accession numbers NP_631415, ZP_00058234, BAA35108 and CAD36475.1 in or accessible via the NCBI databank (www.ncbi.nlm.nih.gov/). On the basis of these sequences, degenerate oligonucleotide primers are deduced from highly conserved regions identified in these sequences. blockA-F1 5'-CGGAGCCGGGCCCNGGNSARRT-3' SEQ ID NO: 7 blockB-F1 5'-CTACGAGCTGCCGCTGACNYTNGGNCA-3' SEQ ID NO: 8 blockC-F1 5'-GTCGTCGTCTACGGCCCNTGGGGNTG-3' SEQ ID NO:" 9 blockC-F2 5'- SEQ ID NO:" 10 GACAACGTCGTCGTCTACGGNCCNTGGGG-3' blockE-F1 *5'-GCACCGGCGGCCTNGGNCAYGTNG-3' SEQ ID NO 11 blockG-R1 5'-GCTGGTCGCCGACGAARTCNARNAC-3' SEQ ID NO 12 blockH-R1 5'-CATCAGCTCGGTGCGGSHNCCCCARTA-3' SEQ ID NO "13 blockH-R2 '5'-GCCAGGTCGACGACCTCNRTNARYTC-3' SEQ ID NO ~14 blockl-F1 5'-GGNCACGARGGNGTCGGNNNNGTCGC-3' SEQ ID NO "15 blockl-F2 n5'-GGNCACGARGGNGTCGG-3' SEQ ID NO "16 blockl-F3 'δ'-CCNYTIACIYTIGGICA-S' SEQ ID NO "17 blockK-F1 '5'-GTNTAYGGICCITGGGG-3' °SEQ ID NO 18 blockK-F2 5'-CCNYTNACIGAYGCIGG-3' SEQ ID NO 19 blockK-R 5'-CCNGCRTCIGTIARIGG-3' SEQ ID NO "20 blockL-R •5'-CGNGTNCCCCARTAIGG-3' *SEQ ID NO "21 blockM-F1 5'-ATGAAAGCCCTCCAGTACACCG-3' SEQ ID NO 22 blockM-F2 ■5'-ATGAARGCSCTSCARTACACS-3' SEQ ID NO 23 blockN-R1 δ'-TCAGCCCGGGACGACCACC-S' *SEQ ID NO "24 blockN-R2 '5'-ANCCNGGNACNACNACNCC-3' SEQ ID NO 25
where I in each case is inosine.
The oligonucleotide primers are then used for a PCR screening using the isolated chromosomal DNA from R. ruber DSM 14855 (obtained as described under A) above).
B2) Deduction of degenerate primers on the basis of peptide sequences from native alcohol dehydrogenase A (ADH-A):
The following degenerate primers are used for a PCR screening based on the peptide partial sequences described in B1).
pepA-F1 GTSATCGCNGTCGAYCTSGACGACGAC SEQ ID NO: 26 pepA-F2 GTCATHGCSGTCGACNTNGACGACGA SEQ ID NO: 27 pepA-F3 GCNGTNGAYYTIGAYGAYGA SEQ ID NO: 28 pepA-F4 GTCGATCTCGACGACGACCG SEQ ID NO: 29 pepA-R1 GTCGTCGTCSAGRTCGACNGCGATSAC SEQ ID NO: 30 pepA-R2 TCGTCGTCNANGTCGACSGCDATGAC SEQ ID NO: 31 pepA-R3 TCRTCRTCIAIRTCIACIGC SEQ ID NO: 32 pepA-R4 CGTCGTCGAGATCGACGGC SEQ ID NO: 33 pepB1-F1 GARGTNGGCGCSGACGCSGCS SEQ ID NO: 34 pepB2-F1 GGNGCSGGNGCSGCSGACGCSATC SEQ ID NO: 35
PepB1-F2 GARGTNGGNGCNGAYGCNGC SEQ ID NO: 36 pepB1-R1 GCSGCGTCSGCGCCNACRTC SEQ ID NO: 37 pepB1-R2 GCNGCRTCNGCNCCNACYTC SEQ ID NO: 38 pepB2-R1 GATSGCGTCSGCSGCNCCSGCNGG SEQ ID NO: 39 pepC-R1 CGSGCSAGGTCSACSACGTCCAT SEQ ID NO: 40 pepC1-F GGNGCNGGNGCNGCNGAYGC "SEQ ID NO: 41 pepC1-R1 GCRTCNGCNGCNCCNGCNCC SEQ ID NO: 42 pepC1-R2 GCCGCCCCGGCGCC SEQ ID NO: 43 pepD-R "CKNGCNARIGCIACIAC SEQ ID NO: 44
(I is inosine)
B3) PCR Screening with the help of degenerate primers:
The primers mentioned under B1) and B2) are used in all possible combinations in a PCR.
PCR conditions:
Cycles Time Temperature
1 15min 95βC 30sec 95°C
30 30sec 50°C 30sec 72°C
1 7min 72°C
For this purpose, the HotStar-Taq Master-Mix (Qiagen, Hilden, Germany) is used in accordance with the instructions provided by the manufacturer.
However, using the standard conditions, no amplificates are found. Only by elongation of the time allowed for annealing to a total of 2 min, an about 350 bp fragment can be generated with the primer pair blockC_F2 - pepA-R1 (SEQ ID NO: 10 and SEQ ID NO: 30).
Surprisingly only a combination of these primers leads to the desired result.
After sequencing of the partial fragment, on the basis of these data specific .nested primers" are manufactured for the PCR screening of a DNA bank from Rhodococcus ruber DSM 14855.
RSJ-F1 [CCTGCGCGCGCGGCCGGGAGAACTAC (SEQ ID NO: 45
Asb_030730_R [CAGGATCTGGATGCCGACGTGGCCGAG (SEQ ID NO: 46
C) Production of a DNA bank from Rhodococcus ruberPSM 14855
For establishing a DNA bank, the Expand l-cosmid vector with an insert capacity of 9-16 kb (Roche Diagnostics GmbH, Mannheim, Germany) is used. The chromosomal DNA from R. ruber DSM 14855 described under A) is restriction digested with Alul (NEB Inc., Beverly, USA) as follows:
3 μg chromosomal DNA from R. ruber DSM 14855 1,5 U Alul
2 μl restriction buffer ad 20 μl H20 Incubation 4 min, 37°C
The restriction is stopped by addition of phenol, the DNA is precipitated and dissolved in distilled H20. The subsequent ligation is achieved with the Smal-restricted and dephospho- rylated vector arms of the Expand l-vector
Composition of the incubation mixture:
100 ng Expand l-Vektor
450 ng Alul-restricted R. rubber DSM 14855 DNA
2 μl ligase buffer
0,5 μi ligase (NEB Inc., Beverly, USA) ad 20 μl H20
Incubation at 16°C, overnight
The in vitro packaging and transformation of Escherichia coli DH5 is performed in accordance with the manufadurer's instrudions (Expand-Cloning Kit; Roche Diagnostics GmbH, Mannheim). A total of about 2500 clones is generated and archived in a 384 hole microtiter plate (MTP) format in a total of 6 MTPs in LB-liquid medium. A restriction analysis displayed for 10 clones seleded at random the expected insert size from 9-16 kb.
D) Identification of a cosmid clone including the partial seguence by means of GRID-PCR Screening
For identification of the clone with the complete ADH-A sequence a grid PCR screening employing the nested primer mentioned using the "nested primers'' mentioned under B2), RS1_F1 und Asb_030730_R is performed. For this purpose, the clones of the 6 MTPs obtained under C) are replicated on LB solid medium and the cosmid DNA of the cells of each single MTP is isolated (Cosmid-Midiprap Kit, Qiagen, Langen, Germany). The PCR- analysis with the "nested primers" results in a DNA of MTP2with the expected size. For identification of the coordinates of the positive clone on MTP 2 in a second step the dones of the horizontal 24 rows are each pooled and analysed by means of colony PCR. By means of an inoculating wire loop a small amount of cell material is applied to the PCR incubation.
PCR is performed using the nested primers RS1_F1 (SEQ ID NO:45) and Asb_030730_R (SEQ ID NO:46) under the conditions described below.
PCR conditions:
Cycles Time Temperature
1 15min 95°C 30sec 95°C
30 30sec 50°C 30sec 72°C
1 7min 72°C
After that, the clones of the positive rows 15 and 16 are screened one by one by means of colony PCR (see above). By this procedure, the clones of the coordinates H15 and H16 are identified as positive. The cosmid DNA of these clones is isolated subsequently and used for sequencing.
E) Identification of a gene coding for a secADH out of R. ruber DSM 14855
Analysis is performed using cosmid DNA isolated from the positive cosmid-clone (Ex1_M2_H16) identified by the above described Grid-PCR-Screening. For sequencing of this cosmid clone an ABI 310 Genetic Analyzer and ABI Big Dye Terminator V 1.1 chemistry is used according to the instructions provided by the manufacturer. Hereby, an open-reading- frame (ORF) of 1038 bp is identified (SEQ ID NO: 47, see below) that, in spite of the difficult- ties in obtaining the final sequence, shows similarity but not identity to known alcohol dehydrogenases. Furthermore, the deduced 346 aminoacid-sequence (SEQ ID NO: 48, see below) matches perfectly with the partial aa-sequences of the native enzyme isolated out of R. ruber DSM 14855.
Nucleotide sequence of the DNA coding for ADH-A from Rhodococcus rubber DSM 14855:
ATGAAAGCCGTCCAGTACACCGAGATCGGCTCCGAGCCGGTCGTTGTCGACATCCCCACCCCGACGCC CGGGCCGGGTGAGATCCTGCTGAAGGTCACCGCGGCCGGGCTGTGCCACTCGGACATCTTCGTGATGG ACATGCCGGCGGCGCAGTACGCCTACGGCCTGCCGCTCACCCTCGGCCACGAGGGTGTCGGCACCGTC GCCGAACTCGGCGAGGGCGTCACGGGATTCGGGGTGGGGGACGCCGTCGCCGTGTACGGGCCGTGGGG CTGCGGTGCGTGCCACGCCTGCGCGCGCGGCCGGGAGAACTACTGCACCCGCGCCGCCGACCTGGGCA.
TCACGCCACCCGGTCTCGGCTCGCCCGGATCGATGGCCGAGTACATGATCGTCGATTCGGCGCGCCAC CTCGTCCCGATCGGAGACCTGGACCCGGTCGCCGCGGCGCCGGTCACCGACGCCGGTCTGACGCCGTA CCACGCGATCTCCCGGGTCCTGCCGCTGCTGGGGCCGGGCTCGACGGCCGTCGTCATCGGTGTCGGCG GGCTCGGCCACGTCGGCATCCAGATCCTGCGCGCCGTCAGCGCGGCCCGTGTGATCGCCGΓCGACCTC GACGACGACCGTCTCGCCCTCGCCCGCGAGGTCGGCGCCGACGCGGCGGTGAAGTCGGGCGCCGGTGC GGCGGACGCGATCCGGGAACTGACCGGCGGCCAGGGCGCGACGGCGGTGTTCGACTTCGTCGGCGCCC AGTCGACGATCGACACGGCGCAGCAGGTGGTCGCGGTCGACGGGCACATCTCGGTCGTGGGCATCCAC GCCGGCGCACACGCCAAGGTCGGGTTCTTCATGATCCCGTTCGGCGCCTCCGTCGTGACCCCGTACTG GGGCACCCGGTCGGAACTGATGGAGGTCGTCGCGCTGGCCCGCGCCGGCCGGCTGGACATCCACACCG AGACGTTCACCCTCGACGAGGGGCCGGCGGCGTACCGGCGGCTGCGCGAGGGCAGCATCCGCGGCCGC
GGCGTGGTGGTTCCCTGA (SEQ ID NO: 47)
Peptide Sequence of ADH-A from Rhodococcus rubber DSM 14855:
MKAVQYTEIGSEPWVDIPTPTPGPGEILLKVTAAGLCHSDIFVMDMPAAQYAYGLPLTLGHEGVGTV
AELGEGVTGFGVGDAVAVYGPWGCGACHACARGRENYCTRAADLGITPPGLGSPGSMΆEYMIVDSARH LVPIGDLDPVAAAP TDAGLTPYHAISRVLPLLGPGSTAWIGVGGLGHVGIQILRAVSAAJRVIAVDL DDDRLALAREVGADAAVKSGAGAADAIRELTGGQGATAVFDFVGAQSTIDTAQQWAVDGH I SWGIH AGAHAKVGFFMIPFGASWTPYWGΓRSELMEWALARAGRLDIHTETFTLDEGPAAYRRLRΈGSIRGR GVWP ( SEQ ID NO : 48 )
Thus in spite of the difficulties described, the sequences responsible for the ADH-A activity can be obtained both on the polynucleotide as well as peptide level.
Example 9: Whole cell catalysts with recombinant ADH-A activity
Using standard protocols, the nucleotide sequence of ADH-A is cloned in an expression vector in bacterial cells.
Alternatively, clones derived from DSM 44541 Rhodococcus ruber are selected that show high ADH-A activity.
In both cases, the activity of clones as whole cell catalysts shows up to 100 fold increase in activity compared to the wildtype. The activity can be improved by a further factor of approximately two if the oxidation reaction takes place in the presence of 1 mM NAD+ or the
reduction reaction takes place in the presence of 1 mM NADH under otherwise the same reaction conditions as described in the preceding examples for the enzyme assay.
Deposition and Characteristics of the Microorganism
The following microorganism has been deposited on March 4, 2002, according to the Budapest Treaty with the DSMZ - Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, D-38124 Braunschweig under the number DSM 14855:
Rhodococcus ruber DSM 44541 (now Rhodococcus ruber DSM 14855).
The same strain is also publicly available as DSM 44541 from DSMZ.
The strain has the following properties:
Colour RAL: 3012-3022 (salmon pink).
Morphology: elementary ramification rod/coccus growth cycle.
Biochemical properties: fatty acids: 5-30 % 16:0; 5-15 % 16:1; 5-15 % 18:0; 15-30 % 18:1;
15-30 % 18-Me. Mycolic acid C42-5o-
Possesses epoxide-hydrolase, nitrilase and ester-hydrolase activities.
Rhodococcus ruber DSM 14855 is isolated from the lower Rhine on hexane as sole carbon source.
The strains can be kept on a complex culture medium as described above at 30 °C and 130 rpm in L-shaking flasks with flow spoiler. After centrifugation, the pellet can be taken up in Tris-HCI buffer (pH 7.5, 50 mM), shock-frozen in liquid nitrogen and lyophilised, where desired and appropriate.
For details regarding the deposit see WO 03/078615 which is herewith enclosed in its entirety, especially regarding the deposit.
Claims
1. A polynucleotide, namely a DNA, or a recombinant polynucleotide each comprising a DNA, each coding for an enzyme showing secondary alcohol dehydrogenase activity, where the DNA is characterized by the following sequence (SEQ ID NO: 47)
ATGAAAGCCG TCCAGTACAC CGAGATCGGC TCCGAGCCGG TCGTTGTCGA CATCCCCACC 60 CCGACGCCCG GGCCGGGTGA GATCCTGCTG AAGGTCACCG CGGCCGGGCT GTGCCACTCG 3.20 GACATCTTCG TGATGGACAT GCCGGCGGCG CAGTACGCCT ACGGCCTGCC GCTCACCCTC 3.80 GGCCACGAGG GTGTCGGCAC CGTCGCCGAA CTCGGCGAGG GCGTCACGGG ATTCGGGGTG 240 GGGGACGCCG TCGCCGTGTA CGGGCCGTGG GGCTGCGGTG CGTGCCACGC CTGCGCGCGC 300 GGCCGGGAGA ACTACTGCAC CCGCGCCGCC GACCTGGGCA TCACGCCACC CGGTCTCGGC 360 TCGCCCGGAT CGATGGCCGA GTACATGATC GTCGATTCGG CGCGCCACCT CGTCCCGATC 420 GGAGACCTCG ACCCGGTCGC CGCGGCGCCG CTCACCGACG CCGGTCTGAC GCCGTACCAC 480 GCGATCTCCC GGGTCCTGCC GCTGCTGGGG CCGGGCTCGA CGGCCGTCGT CATCGGTGTC 540 GGCGGGCTCG GCCACGTCGG CATCCAGATC CTGCGCGCCG TCAGCGCGGC CCGTGTGATC 600 GCCGTCGACC TCGACGACGA CCGTCTCGCC CTCGCCCGCG AGGTCGGCGC CGACGCGGCG 660 GTGAAGTCGG GCGCCGGTGC GGCGGACGCG ATCCGGGAAC TGACCGGCGG CCAGGGCGCG 720 ACGGCGGTGT TCGACTTCGT CGGCGCCCAG TCGACGATCG ACACGGCGCA GCAGGTGGTC 780 GCGGTCGACG GGCACATCTC GGTCGTGGGC ATCCACGCCG GCGCACACGC CAAGGTCGGG 840 TTCTTCATGA TCCCGTTCGG CGCCTCCGTC GTGACCCCGT ACTGGGGCAC CCGGTCGGAA 900 CTGATGGAGG TCGTCGCGCT GGCCCGCGCC GGCCGGCTGG ACATCCACAC CGAGACGTTC 960 ACCCTCGACG AGGGGCCGGC GGCGTACCGG CGGCTGCGCG AGGGCAGCAT CCGCGGCCGC 1020 GGCGTGGTGG TTCCCTGA 1038 or variants thereof with conservative nucleic acid replacements that lead to no change in the resulting amino acid sequence or such changes in the base sequence that lead to amino acid replacements in the amino acid sequence resulting from translation thereof for 5 % or less of the total number of amino acids coded by and resulting from translation of the sequence of SEQ ID NO: 47, provided that the resulting polypeptides still display an alcohol dehydrogenase activity, and/or with insertions and/or deletions.
2. A polynucleotide or a recombinant polynucleotide according to claim 1 translation of which results in 3 % or less amino acid replacements compared with the translation product resulting from the nucleotide sequence mentioned in claim 1 as SEQ I D NO: 47
3. A polynucleotide or a recombinant polynucleotide according to any one of claims 1 or 2 comprising a DNA of SEQ ID NO: 47.
4. A polynucleotide or a recombinant polynucleotide according to any one of claims 1 to 3 that codes for a polypeptide with secondary alcohol dehydrogenase activity that has at least one of the following properties: - pH optimum in the reduction of ketones in the presence of NADH: pH 6 to pH 7; - pH optimum in the oxidation of secondary alcohols, especially of 1-phenylethanol, in the presence of NAD+: pH 8.5 to pH 9.5; - temperature optimum in the reduction of ketones in the presence of NADH: between 43 and 65 °C; - temperature optimum in the oxidation of secondary alcohols in the presence of NAD+: between 43 and 65 °C; - temperature stability for the reduction of ketones in the presence of NADH or the oxidation of secondary alcohols in the presence of NAD+ at 50 °C less than 35 % activity loss during 24 hours; - stability meaning secondary alcohol dehydrogenase activity also in the presence of up to 50 percent by volume of isopropanol; - stability meaning secondary alcohol dehadrogenase activity also in the presence of up to 20 percent by volume of acetone.
5. A. polynucleotide or a recombinant polynucleotide according to any one of claims 1 to 4 that codes for a polypeptide with secondary alcohol dehydrogenase activity that has all of the properties given in claim 4.
6. A DNA complementary to the polynucleotide or recombinant polynucleotide according to any one of claims 1 to 5.
7. A vector comprising a recombinant polynucleotide according to any one of claims 1 to 6.
8. A vector according to claim 7 wherein the polynucleotide comprises a DNA with SEQ ID NO: 47.
9. A microorganism transformed with a polynucleotide or a recombinant polynucleotide according to any one of claims 1 to 6.
10. A microorganism transformed with a vector according to any one of claims 7 or 8.
11. A polypeptide showing secondary alhohol dehydrogenase activity of the sequence with SEQ ID NO: 48: KAVQYTEIG SEPVWDIPT PTPGPGEI L KVTAAGLCHS DI VMDMPAA QYAYG PLT 60 GHEGVGTVAE LGEGVTGFGV GDAVAVYGPW GCGACHACAR GRENYCTRAA DLGITPPGLG 120 SPGS EY I, VDSARHLVPI GDLDPVAAAP LTDAGLTPYH AISRVLPLLG PGSTAWIGV 180 GGLGHVGIQI RAVSAARVI AVDLDDDR A LAREVGADAA V SGAGAADA IRELTGGQGA 240 TAVFDFVGAQ STIDTAQQW AVDGHISWG IHAGAHAKVG FFMIPFGASV VTPYWGTRSE 300 LMEWALARA GRLDIHTETF TLDΞGPAAYR RLREGSIRGR GVWP 345
as well as truncated or elongated versions thereof and/or, preferably or, those with amino acid replacements of up to 5 % of the number of amino acids forming part of the sequence given under SEQ ID NO: 48, provided that the resulting polypeptide still displays an alcohol dehydrogenase activity.
12. A polypeptide according to claim 11 with the sequence given as SEQ ID NO: 48 or a version thereof wherein up to three percent of the amino acids are replaced by other amino acids.
13. A polypeptide according to claim 11 with the sequence given as SEQ ID NO: 48 or a version thereof wherein up to 3 amino acids are replaced by other amino acids
14. A polypeptide according to any one of claims 11 to 13 that has at least one of the following properties: - pH optimum in the reduction of ketones in the presence of NADH: pH 6 to pH 7; - pH optimum in the oxidation of alcohols, especially of 1-phenylethanol in the presence of NAD+: pH 8.5 to pH 9.5; - temperature optimum in the reduction of ketones in the presence of NADH: between 43 and 65 °C; - temperature optimum in the oxidation of secondary alcohols in the presence of NAD+ between 43 and 65 °C; - temperature stability under the conditions just given for the temperature optimum at 50 °C less than 35 % activity loss during 24 hours; - stability also in the presence of up to 50 percent by volume of isopropanol; - stability also in the presence of up to 20 percent by volume of acetone.
15. A polypeptide according to any one of claims 11 to 13 with alcohol dehydrogenase activity that has all of the properties given in claim 14.
16. A polypeptide according to claim 11 with the sequence of SEQ ID NO: 48.
17. The use of a polypeptide according to any one of claims 11 to 16 for the oxidation of secondary alcohols and/or the reduction of ketones, comprising administering the reaction educts and substrates and the polypeptide in purified or partially purified form to a reaction medium and performing the oxidation and/or reduction.
18. The use of a microorganism according to claim 9 or 10 for the oxidation of secondary alcohols and/or the reduction of ketones, comprising administering the reaction educts and substrates and the microorganism in complete or digested form to a reaction medium and performing the oxidation and/or reduction.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP04766745A EP1664286A1 (en) | 2003-09-18 | 2004-09-08 | Alcohol dehydrogenases with increased solvent and temperature stability |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP03103445 | 2003-09-18 | ||
| EP04766745A EP1664286A1 (en) | 2003-09-18 | 2004-09-08 | Alcohol dehydrogenases with increased solvent and temperature stability |
| PCT/EP2004/052095 WO2005026338A1 (en) | 2003-09-18 | 2004-09-08 | Alcohol dehydrogenases with increased solvent and temperature stability |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1664286A1 true EP1664286A1 (en) | 2006-06-07 |
Family
ID=34306960
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP04766745A Withdrawn EP1664286A1 (en) | 2003-09-18 | 2004-09-08 | Alcohol dehydrogenases with increased solvent and temperature stability |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP1664286A1 (en) |
| CA (1) | CA2535710A1 (en) |
| WO (1) | WO2005026338A1 (en) |
Families Citing this family (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE102006009743A1 (en) * | 2006-03-02 | 2007-09-06 | Wacker Chemie Ag | Process for the oxidation of secondary alcohols by enzymes |
| BRPI0823327A2 (en) | 2007-03-16 | 2013-10-22 | Genomatica Inc | MICROBIAN BIOCATALIZERS NOT NATURALLY OCCURING AND METHODS FOR 4-HYDROXIBUTANOIC ACID BIOSYNTHESIS AND 1,4-BUTANHYDROL |
| CA2712779C (en) | 2008-01-22 | 2021-03-16 | Genomatica, Inc. | Methods and organisms for utilizing synthesis gas or other gaseous carbon sources and methanol |
| DK2262901T3 (en) | 2008-03-05 | 2019-01-21 | Genomatica Inc | ORGANISMS PRODUCING PRIMARY ALCOHOL |
| JP5395063B2 (en) * | 2008-04-25 | 2014-01-22 | 公益財団法人地球環境産業技術研究機構 | Transformants of coryneform bacteria having the ability to produce isopropanol |
| WO2009135074A2 (en) | 2008-05-01 | 2009-11-05 | Genomatica, Inc. | Microorganisms for the production of methacrylic acid |
| EP3514242A3 (en) | 2008-09-10 | 2019-08-28 | Genomatica, Inc. | Microrganisms for the production of 1,4-butanediol |
| BRPI1013505A2 (en) | 2009-04-30 | 2018-02-14 | Genomatica Inc | organisms for the production of isopropanol, n-butanol, and isobutanol |
| MY176050A (en) | 2009-04-30 | 2020-07-22 | Genomatica Inc | Organisms for the production of 1,3-butanediol |
| WO2010141920A2 (en) | 2009-06-04 | 2010-12-09 | Genomatica, Inc. | Microorganisms for the production of 1,4-butanediol and related methods |
| EP3190174A1 (en) | 2009-08-05 | 2017-07-12 | Genomatica, Inc. | Semi-synthetic terephthalic acid via microorganisms that produce muconic acid |
| KR20180014240A (en) | 2009-10-23 | 2018-02-07 | 게노마티카 인코포레이티드 | Microorganisms for the production of aniline |
| US8530210B2 (en) | 2009-11-25 | 2013-09-10 | Genomatica, Inc. | Microorganisms and methods for the coproduction 1,4-butanediol and gamma-butyrolactone |
| NZ600509A (en) | 2009-12-29 | 2014-08-29 | Butamax Tm Advanced Biofuels | Alcohol dehydrogenases (adh) useful for fermentive production of lower alkyl alcohols |
| JP2013517796A (en) | 2010-01-29 | 2013-05-20 | ジェノマティカ・インコーポレイテッド | Method and microorganism for biosynthesis of p-toluic acid and terephthalic acid |
| JP2011205921A (en) * | 2010-03-29 | 2011-10-20 | Mitsubishi Rayon Co Ltd | Recombinant rhodococcus bacterium and method for producing optically active (r)-3-quinuclidinol by using the same |
| US9023636B2 (en) | 2010-04-30 | 2015-05-05 | Genomatica, Inc. | Microorganisms and methods for the biosynthesis of propylene |
| PH12013500158A1 (en) | 2010-07-26 | 2013-03-11 | Genomatica Inc | Microorganisms and methods for the biosynthesis of aromatics, 2,4-pentadienoate and 1,3-butadiene |
| SI2855687T1 (en) | 2012-06-04 | 2020-09-30 | Genomatica, Inc. | Microorganisms and methods for production of 4-hydroxybutyrate, 1,4-butanediol and related compounds |
| CN121780636A (en) | 2019-07-10 | 2026-04-03 | 弗门尼舍有限公司 | Biocatalytic methods for controlled degradation of terpenoids |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2005520517A (en) * | 2002-03-18 | 2005-07-14 | チバ スペシャルティ ケミカルズ ホールディング インコーポレーテッド | Alcohol dehydrogenase with high solvent and temperature stability |
-
2004
- 2004-09-08 EP EP04766745A patent/EP1664286A1/en not_active Withdrawn
- 2004-09-08 CA CA002535710A patent/CA2535710A1/en not_active Abandoned
- 2004-09-08 WO PCT/EP2004/052095 patent/WO2005026338A1/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2005026338A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2005026338A1 (en) | 2005-03-24 |
| CA2535710A1 (en) | 2005-03-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7569375B2 (en) | Alcohol dehydrogenases with increased solvent and temperature stability | |
| EP1664286A1 (en) | Alcohol dehydrogenases with increased solvent and temperature stability | |
| Peters et al. | A novel NADH-dependent carbonyl reductase with an extremely broad substrate range from Candida parapsilosis: purification and characterization | |
| JP4651896B2 (en) | (R) -2-Octanol dehydrogenase, method for producing the enzyme, DNA encoding the enzyme, and method for producing alcohol using the same | |
| EP1262550A2 (en) | (R)-2,3-butanediol dehydrogenase, methods for producing same, and methods for producing optically active alcohol using the dehydrogenase | |
| Patel et al. | Mutation of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase at Trp-110 affects stereoselectivity of aromatic ketone reduction | |
| Hanson et al. | Purification and cloning of a ketoreductase used for the preparation of chiral alcohols | |
| US20150010968A1 (en) | Biological alkene oxidation | |
| JPWO1998035025A1 (en) | Novel carbonyl reductase, gene encoding same, and method of using same | |
| WO2016138641A1 (en) | Generation and use of candida and carbonyl reductase thereof | |
| TWI601825B (en) | Process for the enantioselective enzymatic reduction of intermediates | |
| JPWO2001061014A1 (en) | (R)-2-octanol dehydrogenase, method for producing said enzyme, DNA encoding said enzyme, and method for producing alcohol using said DNA | |
| CA2372097C (en) | Epoxide hydrolases of aspergillus origin | |
| JP4938786B2 (en) | Citronellal production method | |
| US6001618A (en) | Haloacetoacetate reductase, method for producing said enzyme, and method for producing alcohols using said enzyme | |
| JP4753273B2 (en) | Method for producing optically active pyridine ethanol derivative | |
| WO2008066018A1 (en) | Novel alcohol dehydrogenase, gene for the alcohol dehydrogenase, vector, transformant, and method for production of optically active alcohol by using them | |
| JP4587348B2 (en) | Novel (R) -2,3-butanediol dehydrogenase | |
| JP2008212144A (en) | Alcohol dehydrogenase, gene encoding the same, and method for producing optically active (R) -3-quinuclidinol using the same | |
| JP5030067B2 (en) | New alkane polyol dehydrogenase | |
| CN103820521B (en) | Living things catalysis Dynamic Kinetic Resolution prepares the method for R-o-chloromandelic acid methyl ester | |
| JP2005517442A (en) | Enone reductase | |
| JPH08103269A (en) | Nucleotide sequence of carbonyl reductase gene and its use | |
| EP1031625A2 (en) | Method for enhancing activity to regenerate electron acceptor for oxidoreductase in microorganism capable of producing said oxidoreductase, and use of microorganism prepared by said method | |
| JP2007274901A (en) | Process for producing optically active propargyl alcohol |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20060131 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR |
|
| 17Q | First examination report despatched |
Effective date: 20060913 |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: BIOCATALYTICS INC. |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20070124 |