EP1451309A2 - Love variant regulator molecules - Google Patents
Love variant regulator moleculesInfo
- Publication number
- EP1451309A2 EP1451309A2 EP02776194A EP02776194A EP1451309A2 EP 1451309 A2 EP1451309 A2 EP 1451309A2 EP 02776194 A EP02776194 A EP 02776194A EP 02776194 A EP02776194 A EP 02776194A EP 1451309 A2 EP1451309 A2 EP 1451309A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- amino acid
- seq
- polypeptide
- group
- changed
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/37—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
- C07K14/38—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from Aspergillus
Definitions
- the invention relates to the fields of microbiology and molecular biology.
- the invention relates to the field of mycology and the production of secondary metabolites from fungi.
- statin drugs e.g., see Waters D.D., Am. J. Cardiol. 88:10F-5F (2001)).
- demand for statin drugs is likely to increase substantially.
- new and improved methods for the production of secondary metabolites must be identified.
- the invention provides variant secondary metabolite regulator proteins that enable increased production of secondary metabolites.
- the invention also provides methods to make these improved regulator proteins.
- Certain of the variant secondary metabolite regulator proteins have increased ability to stimulate production of secondary metabolites in at least some strains of certain fungal species, e.g., certain strains of Aspergillus terreus or Saccromyces cereviae.
- the invention provides a variant regulator protein of secondary metabolite production with the same greater activity than that of the cognate, wild-type protein in at least some fungal strains
- the regulator protein is a fungal regulator protein.
- the invention provides an improved regulator protein comprising an amino acid sequence coding for a variant lovE protein having at least one specific mutation that gives rise to greater transcription-activating properties of the regulator protein and/or induction of secondary metabolite synthesis in at least some fungal strains.
- certain preferred regulator proteins of this aspect of the invention include at least one of the following mutations (amino acid changes), e.g., in a polypeptide comprising the amino acid sequence of SEQ ID NO:91): (1) a Group 6 amino acid residue (e.g., F) mutated to a Group 2 amino acid residue at position 31 , in one embodiment the mutation represented by F3 IL; (2) a Group 3 amino acid residue (e.g., Q) mutated to a Group 5 amino acid residue at position 41, in one embodiment the mutation represented by Q41K or Q41R; (3) a Group 4 amino acid residue (e.g., T) mutated to a Group 2 amino acid residue at position 52, in one embodiment the mutation represented by T52I; (4) a Group 4 amino acid residue (e.g., T) mutated to a Group 3 amino acid residue at position 52, in one embodiment the mutation represented by T52N; (5) a Group 4 amino acid residue (e.g., C) mut
- the invention provides regulator proteins with at least two, or at least three, or at least four, or at least five, or at least six, or at least seven, or at least eight, or at least nine, or at least ten, or at least eleven, or at least twelve, or at least thirteen, or at least fourteen, or at least fifteen, or at least sixteen, or at least seventeen, or at least eighteen of the above described specific mutations.
- the invention provides an isolated lovE variant regulator protein or a polypeptide comprising, consisting of or consisting essentially of an amino acid sequence selected from the group consisting of SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ 3D NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:91, SEQ ID NO:93, and SEQ ID NO:94.
- the invention provides an isolated lovE variant regulator protein or a polypeptide comprising, consisting of or consisting essentially of an amino acid sequence selected from the group consisting of: SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:91, with the addition of the amino acid sequence of SEQ ID NO:95 or SEQ ID NO:96 at
- the invention provides a nucleic acid molecule encoding a lovE regulator of the first aspect of the invention.
- the invention provides a nucleic acid molecule encoding the lovE variant regulator protein or a polypeptide comprising, consisting or consisting essentially of an amino acid sequence selected from the group consisting of SEQ ID NO: 66, SEQ ID NO: 67, SEQ 3D NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ 3D NO:73, SEQ 3D NO:74, SEQ ID NO:75, SEQ 3D NO:76, SEQ 3D NO:78, SEQ 3D NO:79, SEQ 3D NO:81, SEQ 3D NO:82, SEQ 3D NO:83, SEQ 3D NO:84, SEQ 3D NO:86, SEQ 3D NO:87, SEQ 3D NO:88, SEQ 3D NO:89, SEQ ID NO: 66, SEQ ID NO
- the polypeptide comprises the amino acid sequence of SEQ 3D NO:95 or SEQ ID NO:96 at its amino terminus.
- the nucleic acid molecule lacks mtrons that interrupt the polypeptide coding sequence.
- the nucleotide sequence encoding the polypeptide is contiguous.
- the invention provides a method of increasing the activity of a protein that regulates secondary metabolite production comprising: (a) selecting a nucleic acid comprising a polynucleotide encoding a protein regulator of secondary metabolite production; (b) mutating the nucleic acid to create a plurality of nucleic acid molecules encoding variant regulator proteins of secondary metabolite production; and (c) selecting a variant regulator protein with more activity than the cognate, wild-type protein.
- the secondary metabolite is a fungal secondary metabolite.
- the protein regulator of secondary metabolite production is a transcription factor.
- the protein regulator of secondary metabolite production is a transmembrane transporter, protein that mediates secretion, kinase, G- protein, cell surface receptor, GTPase activating protein, guanine nucleotide exchange factor, phosphatase, protease, phosphodiesterase, bacterial protein toxin, importin, PJSTA-binding protein, SCF complex component, adherin, or protein encoded within a biosynthetic cluster.
- the variant regulator protein is selected to have more activity in a heterologous cell and/or more activity in a homologous cell than the cognate, wild-type regulator protein.
- the variant regulator protein is selected to have more activity in a heterologous cell and/or more activity in a homologous cell than the cognate, wild- type protein and to cause more secondary metabolite to be produced in a homologous cell and/or a heterologous cell when compared to the cognate, wild-type regulator protein.
- the variant regulator protein is a lovE variant regulator protein.
- the invention provides a method of increasing production of a secondary metabolite comprising: (a) selecting a nucleic acid comprising a polynucleotide encoding a protein regulator of secondary metabolite production; (b) mutating the nucleic acid to create a plurality of nucleic acid molecules encoding variant regulator proteins of secondary metabolite production; (c) selecting a variant regulator protein with more activity than the cognate, wild-type protein; and (d) expressing the selected variant regulator protein in a cell, thereby increasing production of the secondary metabolite in the cell.
- the secondary metabolite is a fungal secondary metabolite.
- the protein regulator of secondary metabolite production is a transcription factor.
- the protein regulator of secondary metabolite production is a transmembrane transporter, a protein that mediates secretion, a kinase, a G-protein, a cell surface receptor, a GTPase activating protein, a guanine nucleotide exchange factor, a phosphatase, a protease, a phosphodiesterase, a bacterial protein toxin, an importin, an PvNA-binding protein, an SCF complex component, an adherin, or a protein encoded within a biosynthetic cluster.
- the variant regulator protein is selected to have more activity in a heterologous cell and/or more activity in a homologous cell. In certain embodiments, the variant regulator protein is selected to have more activity in a heterologous cell and/or more activity in a homologous cell and to cause more secondary metabolite to be produced in a homologous cell and/or a heterologous cell when compared to the cognate, wild-type regulator protein. In a particularly preferred embodiment, the variant regulator protein is a lovE variant regulator protein.
- the invention provides an isolated variant regulator protein of secondary metabolite production having increased activity compared to a cognate, wild-type protein, the variant regulator protein made by the process comprising: (a) selecting a nucleic acid comprising a polynucleotide encoding a protein regulator of secondary metabolite production; (b) mutating the nucleic acid to create a plurality of nucleic acid molecules encoding variant regulator proteins of secondary metabolite production; (c) selecting a variant regulator protein with more activity than the cognate, wild-type protein; and (d) recovering the selected variant regulator protein.
- the secondary metabolite is a fungal secondary metabolite.
- the protein regulator of secondary metabolite production is a transcription factor.
- the protein regulator of secondary metabolite production is a transmembrane transporter, a protein that mediates secretion, a kinase, a G-protein, a cell surface receptor, a GTPase activating protein, a guanine nucleotide exchange factor, a phosphatase, a protease, a phosphodiesterase, a bacterial protein toxin, an importin, an RNA-binding protein, an SCF complex component, an adherin, or a protein encoded within a biosynthetic cluster.
- the variant regulator protein has more activity in a heterologous and/or a homologous cell than the cognate, wild-type protein in at least some fungal strains, e.g., in at least some strains of A. terreus.
- the variant regulator protein increases production of a secondary metabolite in a heterologous cell and/or a homologous cell when compared to the cognate, wild-type protein.
- the variant regulator protein is a lovE variant regulator protein.
- the invention provides a fungus having improved lovastatin production made by the process of transforming a fungal cell with a nucleic acid molecule encoding a lovE variant protein of the first aspect of the invention.
- the nucleic acid molecule is selected from a nucleic acid molecule of the second aspect of the invention.
- the invention provides an improved process for making lovastatin comprising transforming a fungal cell with a nucleic acid molecule encoding a variant of the lovE protein of the first aspect of the invention.
- the fungal cell is transformed with a nucleic acid molecule of the second aspect of the invention.
- the invention provides a nucleic acid molecule encoding a lovE protein defined by SEQ 3D NO:91.
- the nucleic acid molecule comprises a contiguous coding sequence lacking introns encoding a polypeptide comprising SEQ 3D NO:91.
- the invention provides an isolated lovE nucleic acid molecule defined by SEQ 3D NO:92.
- the invention provides a nucleic acid molecule encoding a lovE protein defined by SEQ 3D NO:91.
- the invention provides an isolated lovE nucleic acid molecule defined by SEQ 3D NO:92.
- the invention features an isolated polypeptide comprising, consisting of, or consisting essentially of the amino acid sequence of SEQ 3D NO:91 having an amino acid change selected from the group consisting of: (a) a Phe changed to a Group 2 amino acid residue at position 31; (b) a Gin changed to a Group 5 amino acid residue at position 41; (c) a Thr changed to a Group 2 amino acid residue at position 52; (d) a Thr changed to a Group 3 amino acid residue at position 52; (e) a Cys changed to a Group 5 amino acid residue at position 73; (f) a Pro changed to a Group 4 amino acid residue at position 101 ; (g) a Pro changed to a Group 3 amino acid residue at position 101; (h) a Val changed to a Group 2 amino acid residue other than Val at position 111; (i) a Ser changed to a Group 2 amino acid residue at position 133; (j) a Glu changed to a Group 2 amino acid residue at position 141 ;
- the polypeptide when expressed in an A. terreus cell harboring a lovF gene increases expression of the lovF gene relative to an otherwise identical cell not expressing the polypeptide; the polypeptide when expressed in a S. cerevisiae harboring a gene under the control of the A.
- the terreus lovF expression control region increases expression of the gene relative to an otherwise identical cell not expressing the polypeptide; the polypeptide has fewer than 11, fewer than 10, fewer than 8, or fewer than 5 amino acid changes; the polypeptide further comprises the amino acid sequence of SEQ 3D NO:95 immediately amino terminal to the amino acid of SEQ 3D NO:91; the polypeptide further comprises the amino acid sequence of SEQ 3D NO:96 immediately amino terminal to the amino acid of SEQ ID NO:91; the isolated polypeptide has the amino acid change F31L, Q41K, Q41R, T52N, C73R, P101S, P101Q, V111L S133L, E141V, E141K, C153Y, C153R, T281A, N367I, N367Y, P389S, or P389L; and the isolated polypeptide comprises, consists of or consists essentially of an amino acid sequence selected from the group consisting of SEQ ID NO:41, SEQ ID NO:42, SEQ 3D
- the invention features an isolated nucleic acid molecule comprising a nucleotide sequence encoding a polypeptide comprising the amino acid sequence of SEQ 3D NO:91 having at least one amino acid change selected from the group consisting of: : (a) a Phe changed to a Group 2 amino acid residue at position 31 ; (b) a Gin changed to a Group 5 amino acid residue at position 41 ; (c) a Thr changed to a Group 2 amino acid residue at position 52; (d) a Thr changed to a Group 3 amino acid residue at position 52; (e) a Cys changed to a Group 5 amino acid residue at position 73; (f) a Pro changed to a Group 4 amino acid residue at position 101 ; (g) a Pro changed to a Group 3 amino acid residue at position 101 ; (h) a Val changed to a Group 2 amino acid residue other than Val at position 111 ; (i) a Ser changed to a Group 2 amino acid residue at position 133; (j
- the polypeptide when expressed in an A. terreus cell harboring a lovF gene increases expression of the lovF gene relative to an otherwise identical cell not expressing the polypeptide; the polypeptide when expressed in a S. cerevisiae harboring a gene under the control of the A.
- the terreus lovF expression control region increases expression of the gene relative to an otherwise identical cell not expressing the polypeptide;
- the polypeptide has fewer than 11, fewer than 10, fewer than 8, or fewer than 5 amino acid changes;
- the polypeptide further comprises the amino acid sequence of SEQ 3D NO:95 immediately amino terminal to the amino acid of SEQ ID NO:91 ;
- the polypeptide further comprises the amino acid sequence of SEQ 3D NO:96 immediately amino terminal to the amino acid of SEQ 3D NO:91;
- the isolated polypeptide has the amino acid change F31L, Q41K, Q41R, T52N, C73R, P101S, P101Q, Nil II, S133L, E141N, E141K, C153Y, C153R, T281A, ⁇ 367I, N367Y, P389S, or P389L;
- the isolated polypeptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of SEQ 3D NO
- the isolated nucleic acid molecule comprises, consists of, or consists essentially of a nucleotide sequence selected from the group consisting of: SEQ 3D NO:66, SEQ 3D NO:67, SEQ 3D NO:68, SEQ 3D NO:69, SEQ 3D NO:70, SEQ 3D NO:71, SEQ 3D NO:72, SEQ 3D NO:73, SEQ 3D NO:74, SEQ 3D NO:75, SEQ 3D NO:76, SEQ 3D NO:77, SEQ 3D NO:78, SEQ 3D NO:79, SEQ 3D NO:80, SEQ 3D NO:81, SEQ 3D NO:82, SEQ ID NO:83, SEQ 3D NO:84, SEQ 3D NO:85, SEQ 3D NO:86, SEQ 3D NO:87, SEQ 3D NO:88, SEQ 3D NO:
- the invention features a fungal cell containing a nucleic acid molecule encoding any of the forgoing polypeptides.
- the invention feature a fungal cell (e.g., an A. terreus cell) containing any of the forgoing nucleic acid molecules, of any of claims 29-56.
- a fungal cell e.g., an A. terreus cell
- the invention features a method for providing a fungal cell having improved production of a secondary metabolite (e.g., lovastatin), the method comprising transforming the fungal cell with a nucleic acid molecule described above whereby the fungal cell has increased secondary metabolite production compared to an otherwise identical fungal cell that has not been so transformed.
- a secondary metabolite e.g., lovastatin
- the invention features a method for producing a secondary metabolite(e.g., lovastatin), the method comprising providing a fungal cell containing a forgoing nucleic acid molecule, culturing the cell under conditions so as to produce the secondary metabolite, and isolating from the cells a fraction containing the secondary metabolite.
- a secondary metabolite e.g., lovastatin
- the invention features an isolated polypeptide comprising, consisting of, or consisting essentially of the amino acid sequence of SEQ ID NO:91 having an amino acid change selected from the group consisting of:
- the polypeptide includes at least one such amino acid change.
- the invention features In various embodiments of the ninth aspect: the polypeptide when expressed in an A. terreus cell harboring a lovF gene increases expression of the lovF gene relative to an otherwise identical cell not expressing the polypeptide; the polypeptide when expressed in a S. cerevisiae harboring a gene under the control of the A.
- terreus lovF expression control region increases expression of the gene relative to an otherwise identical cell not expressing the polypeptide; the polypeptide has fewer than 11, fewer than 10, fewer than 8, or fewer than 5 amino acid changes; the polypeptide further comprises the amino acid sequence of SEQ ID NO: 95 immediately amino terminal to the amino acid of SEQ 3D NO:91; the polypeptide further comprises the amino acid sequence of SEQ ID NO:96 immediately amino terminal to the amino acid of SEQ 3D NO:91.
- Figure 1 is a photographic representation of cells growing on media with and without G418 selection demonstrating /ovEp-H7S3p ⁇ Neo activation in S. cerevisiae.
- Controls include MB968 (vector only), MB2478 (lowly expressed wild-type lovE), and MB 1644 (highly expressed wild-type lovE). All lovE variants are expressed in an MB968 vector backbone similar to MB2478.
- Figure 2A is a graphic representation of lovF ⁇ -CYClp-lacZ expression in S. cerevisiae strains expressing lov ⁇ variant proteins from the clones lovE 1-10.
- Figure 2B is a graphic representation of lovFp-CYCIp-lacZ expression in S. cerevisiae strains expressing lov ⁇ variant proteins from the clones lovE 1-10 from a separate transformation than that of Figure 2 A.
- Figure 3 is a graphic presentation of /ovEp-C7C7p-lacZ expression in S. cerevisiae strains expressing lov ⁇ variant proteins from clones lovE 16-41.
- Figure 4 is a graphic presentation of ZovEp-lacZ expression in S. cerevisiae strains expressing lovE variant proteins from clones lovE 1-10.
- Figure 5 is a graphic presentation of ZovEp-lacZ expression in S. cerevisiae strains expressing lov ⁇ variant proteins from clones lovE 16, 20, 21, 30-34, and 36- 41.
- Figure 6 is a graphic presentation of lovastatin culture concentration, as measured by enzyme inhibition assay, from broths of A. terreus cultures expressing lovE variant proteins 1 - 10 in.
- Figure 7 A is a graphic depiction of lovastatin culture concentration, as measured by HPLC analysis, from broths of A. terreus cultures expressing lovE variant proteins 1-10 in MF117.
- Figure 7B is a graphic depiction of lovastatin culture concentration, as measured by HPLC analysis, from broths of A. terreus cultures expressing lovE variant proteins 2, 6, 30, 32, 36, 37, 39, and 41 in MF117.
- the invention provides variant secondary metabolite regulator proteins that enable production of secondary metabolites.
- the invention also provides methods to make these variant regulator proteins.
- Certain of the variant secondary metabolite regulator proteins have increased ability to stimulate production of secondary metabolites in at least some strains of certain fungal species, e.g., certain strains of Aspergillus terreus or Saccromyces cereviae, compared to the cognate wild-type protein.
- the invention relates to the biosynthesis and improved production of secondary metabolites.
- the invention provides variant regulator proteins useful for the production of secondary metabolites, nucleic acid molecules encoding variant regulator proteins, and methods for their production.
- fungal and “fungus” refer generally to eukaryotic, heterotrophic organisms with an abso ⁇ tive mode of nutrition. Fungi typically contain chitin in their cell walls and exhibit mycelial or yeast-like growth habits (More Gene Manipulations in Fungi, edited by J.W. Bennet and L.L. Lasure, Academic Press Inc. (1991), ISBN 0120886421).
- the terms refer to secondary metabolite producing organisms including, without limitation, Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis,
- variant regulator protein is used herein to refer to any regulatory protein having at least one change or difference in the amino acid sequence of the protein when compared to its cognate, wild-type regulatory protein sequence.
- the term does not include naturally occurring allelic variations of the cognate, wild-type regulatory protein.
- regulator protein is meant to refer to a protein having a positive or negative function that modifies the production of a secondary metabolite.
- the function of the protein may be at the level of transcription, e.g., repression or activation, protein synthesis, or transport.
- the regulator may alter the level of transcription, RNA stability, translation, post-translational modification, or cellular localization of proteins involved in secondary metabolite synthesis and/or transport.
- the regulator may also have effects on precursor metabolite pools, flux through specific pathways and metabolite resistance.
- a regulator protein that is a protein that contributes and/or promotes transcription of a gene sequence
- a transcription-activating protein i.e., a transcription-activating protein.
- Transcription-activating is a term used to refer to characteristics of a protein that promote transcription.
- a transcription-activating protein would include proteins that increase accessibility of the DNA to transcription complexes, for example, by opening or relaxing chromatin structure, proteins that promote the recognition and/or binding of transcription complexes to a target gene sequence, and/or proteins that promote transcription complex movement along the length of the template DNA sequence.
- regulatory proteins of secondary metabolite production and the nucleic acid sequences encoding these are known to those skilled in the art.
- Non-limiting examples of regulatory proteins of secondary metabolite synthesis include: regulator proteins of the aflatoxin/sterigmatocystin biosynthetic cluster (Woloshuk, C.P., et al, Appl, Environ. Microbiol. 60:2408-2414 (1994) and Brown, D.W., et al. , Proc Natl
- regulator proteins of the paxilline biosynthetic cluster (Young, C, et al, Mol, Microbiol. 39:754-764 (2001)); regulator proteins of the cephalosporin and penicillin biosynthetic clusters (Litzka O., et al, Antonie Van Leeuwenhoek 75:95-105 (1999); Schmitt E.K. and Kuck U., J. Biol. Chem. 275:9348- 9357 (2000); MacCabe et al. Mol. Gen. Genet. 250:367-374 (1996); Suarez et al. Mol. Microbiol. 20:529-540 (1996); Lambert et al. Mol Cell. Biol. 17:3966-3976 (1997); Su et al Genetics 133:67-77 (1993); regulator proteins of tricothecene synthesis
- Certain embodiments of the aspects of the invention disclosed herein relate to the lovE regulator protein, a protein which plays a key role in the biosynthesis of lovastatin. More particularly, certain embodiments of the aspects of the invention relate to variant proteins of the lovE regulator protein and methods of making the same. Such proteins are variant with respect to the following A. terreus wild-type lovE sequences (SEQ ID NOS:91 and 92).
- the invention utilizes techniques and methods common to the fields of molecular biology, genetics and microbiology. Useful laboratory references for these types of methodologies are readily available to those skilled in the art. See, for example, Molecular Cloning, A Laboratory Manual, 3 rd edition, edited by Sambrook, j., MacCallum, P., and Russell, D.W. (2001), Cold Spring Harbor Laboratory Press
- secondary metabolite means a compound, derived from primary metabolites, that is produced by an organism, is not a primary metabolite, is not ethanol or a fusel alcohol, and is not required for growth under standard conditions. Secondary metabolites are derived from intermediates of many pathways of primary metabolism. These pathways include, without limitation, pathways for biosynthesis of amino acids, the shikimic acid pathway for biosynthesis of aromatic amino acids, the polyketide biosynthetic pathway from acetyl coenzyme A (CoA), the mevalonic acid pathway from acetyl CoA, and pathways for biosynthesis of polysaccharides and peptidopolysaccharides. Collectively, secondary metabolism involves all primary pathways of carbon metabolism.
- fungal secondary metabolites See, Fungal Physiology, Chapter 9 (Secondary(Special) Metabolism), Griffin, D. H., John Wiley & Sons, Inc.; ISBN: 0471166154).
- "Secondary metabolite” also includes intermediate compounds in the biosynthetic pathway for a secondary metabolite that are dedicated to the pathway for synthesis of the secondary metabolite. "Dedicated to the pathway for synthesis of the secondary metabolite” means that once the intermediate is synthesized by the cell, the cell will not convert the intermediate to a primary metabolite.
- Intermediate compounds also include secondary metabolite intermediate compounds which can be converted to useful compounds by subsequent chemical conversion or subsequent biotransformation. As such, providing improved availability of such intermediate compounds would still lead to improved production of the ultimate useful compound, which itself may be referred to herein as a secondary metabolite.
- the yeast Saccharomyces cerevisiae is not known to produce secondary metabolites.
- the term "primary metabolite” means a natural product that has an obvious role in the functioning of almost all organisms. Primary metabolites include, without limitation, compounds involved in the biosynthesis of lipids, carbohydrates, proteins, and nucleic acids.
- the term “increasing the yield of the secondary metabolite” means increasing the quantity of the secondary metabolite present in the total fermentation broth per unit volume of fermentation broth or culture.
- moduleate production of a secondary metabolite refers to a positive or negative or desirable change in one or more of the variables or values that affect the process or results of production of the primary or secondary metabolites in a liquid or solid state fungal fermentation.
- positive or negative or desirable changes include, without limitation, an increase or decrease in the amount of a primary or secondary metabolite being produced (in absolute terms or in quantity per unit volume of fermentation broth or per unit mass of solid substrate); a decrease in the volume of the broth or the mass/quantity of substrate required for the production of sufficient quantities; a decrease in the cost of raw materials and energy, the time of fermentor or culture run, or the amount of waste that must be processed after a fermentor run; an increase or decrease in the specific production of the desired metabolite (both in total amounts and as a fraction of all metabolites and side products made by the fungus); an increase or decrease in the percent of the produced secondary metabolite that can be recovered from the fermentation broth or culture; and an increase in the resistance of an organism producing a primary or secondary metabolite to possible deleterious effects of contact with the secondary metabolite.
- a secondary metabolite is an anti-bacterial.
- An "anti-bacterial" is a molecule that has cytocidal or cytostatic activity against some or all bacteria.
- Preferred anti-bacterials include, without limitation, ⁇ -lactams.
- Preferred ⁇ -lactams include, without limitation, penicillins and cephalosporins and biosynthetic intermediates thereof.
- Preferred penicillins and biosynthetic intermediates include, without limitation, isopenicillin N, 6- aminopenicillanic acid (6-APA), penicillin G, penicillin N, and penicillin V.
- cephalosporins and biosynthetic intermediates include, without limitation, deacetoxycephalosporin V (DAOC V), deacetoxycephalosporin C (DAOC), deacetylcephalosporin C (DAC), 7-aminodeacetoxycephalosporanic acid (7-ADCA), cephalosporin C, 7-B-(5-carboxy-5-oxopentanamido)-cephalosporanic acid (keto-AD- 7ACA), 7-B -(4-carboxybutanamido)-cephalosporanic acid (GL-7ACA), and 7- aminocephalosporanic acid (7 ACA).
- DAOC V deacetoxycephalosporin V
- DAOC deacetoxycephalosporin C
- DAC deacetylcephalosporin C
- 7-ADCA 7-aminodeacetoxycephalosporanic acid
- keto-AD- 7ACA cephalosporin
- the secondary metabolite is an anti-hypercholesterolemic or a biosynthetic intermediate thereof.
- An "anti- hypercholesterolemic” is a drug administered to a patient diagnosed with elevated cholesterol levels for the pu ⁇ ose of lowering the cholesterol levels.
- Preferred anti- hypercholesterolemics include, without limitation, lovastatin, mevastatin, simvastatin, and pravastatin.
- a secondary metabolite is an immunosuppressant or a biosynthetic intermediate thereof.
- immunosuppressant is a molecule that reduces or eliminates an immune response in a host when the host is challenged with an immunogenic molecule, including immunogenic molecules present on transplanted organs, tissues or cells.
- Preferred immunosuppressants include, without limitation, members of the cyclosporin family and beauverolide L.
- Preferred cyclosporins include, without limitation, cyclosporin A and cyclosporin C.
- the secondary metabolite is an ergot alkaloid or a biosynthetic intermediate thereof.
- An "ergot alkaloid” is a member of a large family of alkaloid compounds that are most often produced in the sclerotia of fungi of the genus Claviceps.
- An "alkaloid” is a small molecule that contains nitrogen and has basic pH characteristics.
- the classes of ergot alkaloids include clavine alkaloids, lysergic acids, lysergic acid amides, and ergot peptide alkaloids.
- Preferred ergot alkaloids include, without limitation, ergotamine, ergosine, ergocristine, ergocryptine, ergocornine, ergotaminine, ergosinine, ergocristinine, ergocryptinine, ergocorninine, ergonovine, ergometrinine, and ergoclavine.
- the secondary metabolite is an inhibitor of angiogenesis or a biosynthetic intermediate thereof.
- An "angiogenesis inhibitor” is a molecule that decreases or prevents the formation of new blood vessels.
- Angiogenesis inhibitors have proven effective in the treatment of several human diseases including, without limitation, cancer, rheumatoid arthritis, and diabetic retinopathy.
- Preferred inhibitors of angiogenesis include, without limitation, fumagillin and ovalicin.
- the secondary metabolite is a glucan synthase inhibitor or a biosynthetic intermediate thereof.
- a "glucan synthase inhibitor” is a molecule that decreases or inhibits the production of 1,3- ⁇ -D- glucan, a structural polymer of fungal cell walls.
- Glucan synthase inhibitors are a class of antifungal agents.
- Preferred glucan synthase inhibitors include, without limitation, echinocandin B, pneumocandin B, aculeacin A, and papulacandin.
- the secondary metabolite is a member of the gliotoxin family of compounds or a biosynthetic intermediate thereof.
- the "gliotoxin family of compounds” are related molecules of the epipolythiodioxopiperazine class. Gliotoxins display diverse biological activities, including, without limitation, antimicrobial, antifungal, antiviral, and immunomodulating activities.
- Preferred members of the "gliotoxin family of compounds” include, without limitation, gliotoxin and aspirochlorine.
- the secondary metabolite is a fungal toxin or a biosynthetic intermediate thereof.
- a "fungal toxin” is a compound that causes a pathological condition in a host, either plant or animal. Fungal toxins could be mycotoxins present in food products, toxins produced by phytopathogens, toxins from poisonous mushrooms, or toxins produced by zoopathogens.
- Preferred fungal toxins include, without limitation, aflatoxins, patulin, zearalenone, cytochalasin, griseofulvin, ergochrome, cercosporin, marticin, xanthocillin, coumarins, tricothecenes, fusidanes, seste ⁇ enes, amatoxins, malformin A, phallotoxins, pentoxin, HC toxin, psilocybin, bufotenine, lysergic acid, sporodesmin, pulcheriminic acid, sordarins, fumonisins, ochratoxin A, and fusaric acid.
- the secondary metabolite is a modulator of cell surface receptor signaling or a biosynthetic intermediate thereof.
- the term "cell surface receptor” is as used before. Modulators of cell surface receptor signaling might function by one of several mechanisms including, without limitation, acting as agonists or antagonists, sequestering a molecule that interacts with a receptor such as a ligand, or stabilizing the interaction of a receptor and molecule with which it interacts.
- Preferred modulators of cell surface signaling include, without limitation, the insulin receptor agonist L-783,281 and the cholecystokinin receptor antagonist asperlicin.
- the secondary metabolite is a plant growth regulator or a biosynthetic intermediate thereof.
- a "plant growth regulator” is a molecule that controls growth and development of a plant by affecting processes that include, without limitation, division, elongation, and differentiation of cells.
- Preferred plant growth regulators include, without limitation, cytokinin, auxin, gibberellin, abscisic acid, and ethylene.
- the secondary metabolite is a pigment or a biosynthetic intermediate thereof.
- a "pigment” is a substance that imparts a characteristic color. Preferred pigments include, without limitation, melanins and carotenoids.
- the secondary metabolite is an insecticide or a biosynthetic intermediate thereof.
- An "insecticide” is a molecule that is toxic to insects.
- Preferred insecticides include, without limitation, nodulisporic acid.
- the secondary metabolite is an anti-neoplastic compound or a biosynthetic intermediate thereof.
- An "anti- neoplastic” compound is a molecule that prevents or reduces tumor formation.
- Preferred anti-neoplastic compounds include, without limitation, taxol (paclitaxel) and related taxoids.
- the phrase "increased activity" is used herein to refer to a characteristic that results in an augmentation of the inherent negative or positive function of the regulatory protein.
- the invention provides variant regulator proteins of secondary metabolite production with increased activity and methods of producing the same.
- the invention further provides for the identification of specific amino acid residues that are important to the functioning of secondary metabolite regulator proteins.
- variant regulator proteins of the secondary metabolite regulator lovE are presented herein.
- substitutions of one amino acid for another may be tolerated at one or more amino acid residues of a wild-type regulator protein absent a change in the structure, activity and/or function of the wild-type protein.
- substitutions are referred to in the art as “conservative” substitutions, and amino acids may be categorized into groups that identify which amino acids may be substituted for another without altering the structure and/or function of the protein.
- conservative substitution refers to the exchange of one amino acid for another in the same conservative substitution grouping in a protein sequence.
- Conservative amino acid substitutions are known in the art and are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- conservative substitutions typically include substitutions within the following groups: Group 1: glycine, alanine, and proline; Group 2: valine, isoleucine, leucine, and methionine; Group 3: aspartic acid, glutamic acid, asparagine, glutamine; Group 4: serine, threonine, and cysteine; Group 5: lysine, arginine, and histidine; Group 6: phenylalanine, tyrosine, and tryptophan.
- Each group provides a listing of amino acids that may be substituted in a protein sequence for any one of the other amino acids in that particular group.
- the invention provides an improved regulator protein comprising an amino acid sequence coding for a variant of the lovE protein having at least one specific mutation that gives rise to greater transcription- activating properties of the regulator protein and/or increased lovastatin synthesis.
- certain amino acid residues and mutations thereof in the lovE regulatory protein of A. terreus are identified by the invention described herein. Mutations at residues 31, 41, 52, 73, 101, 111, 133, 141, 153, 281, 367, and 389 of the wild-type lovE protein of A. terreus have been identified as being critical for the improvement of lovE regulator protein function.
- mutations include: F31L, Q41K, Q41R, T52I, T52N, C73R, P101S, P101Q, VI 111, S133L, E141N, E141K, C153Y, C153R, T281A, ⁇ 367I, ⁇ 367Y, P389S and P389L.
- Each mutation therefore, represents a change of one conservative class of amino acids for another.
- the mutation F31L represents a change from a Group 6 amino acid residue to a Group 2 amino acid residue at position 31 of the wild-type, lovE regulator protein.
- the invention described herein takes advantage of the genetically tractable and experimentally amenable organism Saccharomyces cerevisiae for screening large numbers of variant regulator proteins of secondary metabolite production. Techniques common to the field of molecular biology are well developed in S. cerevisiae, and large numbers of vectors are available to assist the genetic manipulation and cloning of variant regulator proteins involved in secondary metabolite production. Other genetically tractable organisms could also be used for this pu ⁇ ose.
- "mutating” is used to refer to the deliberate alteration of at least one nucleotide residue of a wild-type, cognate nucleic acid sequence encoding a regulator protein of secondary metabolite production.
- a deliberate alteration or change in at least one nucleotide residue of a polynucleotide may be accomplished by any method known in the art.
- the mutation(s) can be made in vivo or in vitro and can include random, partially random or not random, i.e., directed, mutagenesis techniques.
- in vivo mutagenesis can be done by placing this nucleic acid molecule in a cell with a high mutation frequency, i.e. a mutagenic strain.
- Muhlrad et al. Yeast 8:79-82 (1992) have developed a rapid method for localized mutagenesis of yeast genes.
- PCR polymerase chain reaction
- Muhlrad et al. the PCR product is then co-transformed with a gapped plasmid containing homology to both ends of the PCR product, resulting in in vivo recombination to repair the gap with the mutagenized DNA.
- kits that may be used to produce mutant nucleic acid molecules by error-prone PCR (see, e.g., GeneMo ⁇ hTM PCR Mutagenesis Kit (Stratagene, La Jolla, California); and DiversifyTM PCR Random Mutagenesis Kit (BD Biosciences Clontech, Palo Alto, CA).
- GeneMo ⁇ hTM PCR Mutagenesis Kit (Stratagene, La Jolla, California); and DiversifyTM PCR Random Mutagenesis Kit (BD Biosciences Clontech, Palo Alto, CA).
- a plurality of variant, i.e., mutated, regulator proteins of secondary metabolite production may be produced using established mutagenesis techniques.
- the term "activity" refers to a characteristic of the regulator protein that negatively or positively affects the biological system to bring about a modulation in secondary metabolite production.
- the activity is the transcription of downstream genes involved in the biosynthetic pathway of the secondary metabolite of choice.
- the phrase "more activity” refers to the property of a variant regulator protein to bring about more transcription than that effected by the cognate, wild-type regulator protein.
- the selected variant regulator protein has more activity in a fungal cell than the cognate, wild-type protein.
- the protein regulator of secondary metabolite production is a transcription factor.
- the protein regulator of secondary metabolite production is a transmembrane transporter, a protein that mediates secretion, a kinase, a G-protein, a cell surface receptor, a GTPase activating protein, a guanine nucleotide exchange factor, a phosphatase, a protease, a phosphodiesterase, a bacterial protein toxin, an importin, an RNA-binding protein, an SCF complex component, an adherin, or a protein encoded within a biosynthetic cluster.
- the selected variant regulator protein has more activity in a heterologous cell than the cognate, wild-type protein.
- the heterologous cell is an organism selected from the group consisting of S. cerevisiae, E. coli, A. nidulans,
- the selected variant regulator protein has more activity in a homologous cell than the cognate, wild-type protein.
- the homologous cell is an organism selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp.,
- the selected variant regulator protein has more activity in a heterologous cell and a homologous cell than the cognate, wild-type protein.
- the heterologous cell is an organism selected from the group consisting of S. cerevisiae, E. coli, A. nidulans, Candida sp., and N. crassa and the homologous cell is an organism selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum,
- Yarrowia lipolytica Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neurospora sp., Pestalotiopsis sp. and Phaffia rhodozyma.
- heterologous cell refers to a system for gene expression, i.e., an organism for gene expression, that is one other than the organism from which the selected regulator protein of secondary metabolite production has been isolated.
- Preferred heterologous cells include, but are not limited to, S. cerevisiae, E. coli, A. nidulans, and Candida sp.,. and N. crassa. Particularly preferred are fungal heterologous cells.
- the method comprises: (a) selecting a nucleic acid comprising a polynucleotide encoding a protein regulator of secondary metabolite production; (b) mutating the nucleic acid to create a plurality of nucleic acid molecules encoding variant regulator proteins of secondary metabolite production; and (c) selecting a mutagenized nucleic acid encoding a variant regulator protein with increased activity in a homologous cell than the cognate, wild-type protein.
- homologous cell refers to a system for gene expression, i.e., an organism for gene expression, that is the organism from which the regulator protein of secondary metabolite production has been isolated.
- Preferred homologous cells are fungal homologous cells, including, but not limited to, Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neuronasp.,
- the method further comprises selecting a variant regulator protein that also increases production of a secondary metabolite in a cell when compared to the cognate, wild-type protein.
- the cell is a fungal cell.
- the cell is a heterologous cell, preferably selected from the group consisting of S. cerevisiae, E. coli, A. nidulans, Candida sp., and N. crassa.
- the cell is a homologous cell, preferably selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp., Monascus sp.,
- Claviceps sp. Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neurospora sp., Pestalotiopsis sp., and Phaffia rhodozyma.
- Certain embodiments of the aspects of the invention relate to regulator proteins that promote secondary metabolite production by increasing transcription of one or more genes involved with secondary metabolite production. These wild-type sequences may be selected for mutagenesis to create a plurality of variant regulator proteins. The activity of these transcription-activating variant regulator proteins may be determined by measuring the activity of a reporter gene having the appropriate promoter sequences. These tests are done in a homologous and/or a heterologous cell. Certain embodiments of aspects of the invention are directed to fungal regulator proteins with transcription-activating activity that is tested in fungal heterologous and homologous cells.
- Reporter genes are useful for isolating transformants expressing improved variant regulator proteins.
- the reporter genes may be operably linked to a promoter sequence that is normally regulated by the wild-type regulator protein.
- Reporter genes include, but are not limited to, genes encoding ⁇ -galactosidase (lacZ), ⁇ - glucoronidase (GUS), ⁇ -glucosidase, amylase and invertase, amino acid biosynthetic genes, e.g., the yeast LEU2, HIS3, LYS2, TRP1 genes (or homologous genes from other fungi, such as filamentous fungi, that encode proteins with the similar functional activities), nucleic acid biosynthetic genes, e.g., the yeast URA3 and ADE2 genes (or homologous genes from other fungi, such as filamentous fungi, that encode proteins with the similar functional activities), the mammalian chloramphenicol transacetylase (CAT) gene, or any surface antigen gene
- a reporter gene can also be a neomycin phosphotransferase(neo) gene, which encodes neomycin, kanamycin resistance gene and G418 (geneticin) resistance gene.
- a reporter gene may encode a protein detectable by luminescence or fluorescence, such as green fluorescent protein (GFP). Reporter genes may additionally or alternatively encode any protein that provides a phenotypic marker, for example, a protein that is necessary for cell growth or viability, or a toxic protein that causes cell death. Alternatively, the reporter gene may encode a protein detectable by a color assay leading to the presence or absence of color. The choice of reporter gene will depend on the type of cell to be transformed. Preferred reporter genes are those that are operable in fungal cells.
- reporter gene when expressed, provides a growth advantage to transformed cells that are expressing the variant regulator protein. This allows for the isolation of such transformants though selective pressures.
- the other reporter gene provides a colorimetric marker, such as the lacZ gene and its encoded protein, ⁇ -galactosidase.
- the second reporter provides a fluorescent or luminescent marker, such as green fluorescent protein (GFP).
- the invention provides a method of increasing production of a secondary metabolite comprising: (a) selecting a nucleic acid comprising a polynucleotide encoding a protein regulator of secondary metabolite production; (b) mutating the nucleic acid to create a plurality of nucleic acid molecules encoding variant regulator proteins of secondary metabolite production; (c) selecting a variant regulator protein with more activity than the cognate, wild-type protein; and (d) expressing the selected variant regulator protein in a cell, thereby increasing production of the secondary metabolite in the cell.
- the ceil is a fungal cell.
- the protein regulator of secondary metabolite production is a transcription factor.
- the protein regulator of secondary metabolite production is a transmembrane transporter, a protein that mediates secretion, a kinase, a G-protein, a cell surface receptor, a GTPase activating protein, a guanine nucleotide exchange factor, a phosphatase, a protease, a phosphodiesterase, a bacterial protein toxin, an importin, an PxNA-binding protein, an SCF complex component, an adherin, or a protein encoded within a biosynthetic cluster.
- the cell is a heterologous cell, preferably selected from the group consisting of S. cerevisiae, E. coli, A. nidulans, Candida sp., andN. crassa.
- the cell is a homologous cell, preferably selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neurospora sp., Pestalotiopsis sp., zndPhaffia rhodozyma.
- the cell is a heterologous cell and the method further comprises expressing the variant regulator protein in a homologous cell, thereby increasing secondary metabolite production in the homologous cell.
- the heterologous cell is an organism selected from the group consisting of S. cerevisiae, E. coli, A. nidulans, Candida sp., , and N. crassa and the homologous cell is an organism selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum,
- Yarrowia lipolytica Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neurospora sp., Pestalotiopsis .sp.and Phaffia rhodozyma.
- the invention provides an isolated variant regulator protein of secondary metabolite production having increased activity compared to a cognate, wild-type protein, made by the process comprising: (a) selecting a nucleic acid comprising a polynucleotide encoding a protein regulator of secondary metabolite production; (b) mutating the nucleic acid to create a plurality of nucleic acid molecules encoding variant regulator proteins of secondary metabolite production; (c) selecting a variant regulator protein with more activity than the cognate, wild-type protein; and (d) recovering the selected variant regulator protein.
- the variant regulator protein selected has more activity in a fungal cell.
- the protein regulator of secondary metabolite production is a transcription factor.
- the protein regulator of secondary metabolite production is a transmembrane transporter, a protein that mediates secretion, a kinase, a G-protein, a cell surface receptor, a GTPase activating protein, a guanine nucleotide exchange factor, a phosphatase, a protease, a phosphodiesterase, a bacterial protein toxin, an importin, an R ⁇ A-binding protein, an SCF complex component, an adherin, or a protein encoded within a biosynthetic cluster.
- the variant regulator protein selected has more activity in a heterologous cell, preferably selected from the group consisting of S. cerevisiae, E. coli, A. nidulans, Candida sp., Neurospora sp., Pestalotiopsis sp., andN. crassa.
- the variant regulator protein selected has more activity in a homologous cell, preferably selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neurospora sp., Pestalotiopsis sp., and Phaffia rhodozyma.
- the variant regulator protein selected has more activity in a homologous cell and a heterologous cell.
- the heterologous cell is an organism selected from the group consisting of S. cerevisiae, E. coli, A. nidulans, Candida sp., Neurospora sp., Pestalotiopsis sp., and N.
- the homologous cell is an organism selected from the group consisting of Aspergillus sp., Penicillium sp., Acremonium chrysogenum, Yarrowia lipolytica, Nodulisporium sp., Fusarium sp., Monascus sp., Claviceps sp., Trichoderma sp., Tolypocladium sp., Tricotheicium sp., Fusidium sp., Emericellopsis sp., Cephalosporium sp., Cochliobolus sp., Helminthosporium sp., Agaricus brunescens, Ustilago maydis, Neurospora sp., Pestalotiopsis sp., and Phaffia rhodozyma.
- the variant regulator protein is a variant protein of the lovE protein having at least one of the following mutations: (1) a Group 6 amino acid residue mutated to a Group 2 amino acid residue at position 31, for example, the mutation represented by F31L;(2) a Group 3 amino acid residue mutated to a Group 5 amino acid residue at position 41, for example, the mutation represented by Q41K or Q41R; (3) a Group 4 amino acid residue mutated to a Group 2 amino acid residue at position 52, for example, the mutation represented by T52I; (4) a Group 4 amino acid residue mutated to a Group 3 amino acid residue at position 52, for example, the mutation represented by T52 ⁇ ; (5) a Group 4 amino acid residue mutated to a Group 5 amino acid residue at position 73, for example, the mutation represented by C73R; (6) a Group 1 amino acid residue mutated to a Group 4 amino acid residue at position 101, for example, the mutation represented by P101S; (7) a Group 1 amino acid residues: (1) a Group 6 amino acid
- the invention provides a fungus having improved lovastatin production made by the process of transforming a fungal cell with a nucleic acid molecule encoding a variant of the lovE protein of the first aspect of the invention, hi an embodiment thereof, the nucleic acid molecule is selected from a nucleic acid molecule of the second aspect of the invention.
- the invention provides an improved process for making lovastatin comprising transforming a fungal cell with a nucleic acid molecule encoding a variant of the lovE protein of the first aspect of the invention.
- the fungal cell is transformed with a nucleic acid molecule of the second aspect of the invention.
- International Patent Application PCT US99/29583 discloses lovastatin production genes.
- this reference does not provide a mature lovE cDNA sequence.
- the invention herein remedies the shortcoming of this reference by providing a complete cDNA sequence for the lovE mRNA.
- MY2124 was derived from the Sigma 1278b strain background of S. cerevisiae and its complete genotype is as follows: MATa/MATa::LEU2 ura3 ⁇ 0 /ura3 ⁇ 0 leu2 ⁇ 0/leu2 ⁇ 0 trpl ⁇ 0::hisG/trpl ⁇ 0::hisG Ms3 ⁇ 0::hisG/his3 ⁇ 0::hisG ura3 ⁇ 0::lovF-HIS3p-neo/ura3 ⁇ 0. MY2124 can be constructed by mating S.
- MY2112 MATaura3 ⁇ 0 leul ⁇ O trpl ⁇ Or.hisG his3 ⁇ 0::hisG ura3 ⁇ 0::lovFp-HIS3 ⁇ p-neo
- MY1555 mata::LEU2 ura3 ⁇ 0 leu2 ⁇ 0 trpl ⁇ Or.hisG his3 ⁇ 0::hisG
- the ura3 ⁇ 0::lovFp-HIS3p-neo allele of MY2112 was derived by cotransforming Stzl-linearized plasmid MB2254 with pRS424 (Sikorski and Hieter (1989) Genetics 122:19-27) into MY1413 (MATa leul ⁇ O trpl ⁇ Or.hisG his3 ⁇ 0::hisG). Transformants were selected on SC-T ⁇ media and subsequently screened for 5-fluoro-orotic acid resistance to identify those transformants containing the ura3 ⁇ 0::lovFp-HIS3p-neo allele. T ⁇ " segregants lacking plasmid pRS424 were isolated by growing the strain under non-selective conditions.
- oligonucleotides were used in the construction of plasmids.
- M0666 (5 ' GGCGGCCGCTCTAGAACTAGTCTCGAGGGTACC3 ' ) (SEQ ID NO: 3)
- MOl786 (5 ' CACAGGATCCGTCATCTTTGCCTTCGTTTATC3 ' ) (SEQ ID NO: 8)
- Ol95 (5 ' CGCGGATCCTATTGAACAAGATGGATTGCAC3 ' ) (SEQ ID NO: 9)
- MOl96 (5 ' CCGGAATTCAGAAGAACTCGTCAAGAAG3 ' ) (SEQ ID NO:10)
- MO842 (5' ACAAGAAAGCTGGGTTCATGGAGGAATATTGTTGA3 ' ) (SEQ ID NO: 12)
- M02278 (5 ' GGGGATCCAATCGAGGTCCACGACCAGT3 ' ) (SEQ ID NO: 13)
- MO2701 (5 ' ATACTTCTATAGACACACAAACACAAATACACACAC3 ' ) (SEQ ID NO: 24)
- MO107 (5 ' CGCGGATCCCGTCGTTTTACAAC3 ' ) (SEQ ID NO:25)
- M0511 (5 ' GGCCATCGATACAAGTTTGTACAAAAAAGCTGAAC3 ' ) (SEQ ID NO: 33)
- MO540 (5'GGCGCCCTATTACACCACTTTGTACAAGAAAGC3 ') (SEQ ID NO: 34)
- MOl985 (5 ' CACACGTCTCCGGCCTCAACCTTCCCATTGGGGCG3 ' ) (SEQ ID NO: 35)
- MOl986 (5 ' CACACAGATCTCGTGGCCAATTTCTTCTAGTTTGA3 ' ) (SEQ ID NO: 36)
- MOl993 (5 ' CACAGCGGCCGCTTCATTGTTTGCCTCCCTGCTG3 ' ) (SEQ ID NO: 38)
- Plasmid MB2254 contains the lovFp-HIS3p-neo reporter gene flanked by URA3 sequence.
- First primers MO664 (SEQ ID NO:l) and MO665 (SEQ 3D NO:2) were annealed and inserted into the Kpnl-Sacl sites of plasmid pBluescript II KS (Stratagene,).
- the resulting vector, MB1038, contains a Sail site in the polylinker.
- the Spel-Xhol fragment from pJL164 (Brachmann et al.
- the following four fragments were combined in MB 1054 to obtain plasmid MB2254.
- terreus genomic DNA was PCR amplified with MO1794 (SEQ ID NO:5) and MO1793 (SEQ 3D NO:6) and inserted into MB 1054 on a Notl-Spel fragment.
- MO1794 SEQ ID NO:5
- MO1793 SEQ 3D NO:6
- the H/S3 basal promoter from pRS403 was PCR amplified with primers MO1785 (SEQ ID NO:7) and MO1786 (SEQ 3D NO:8) and inserted into MB 1054 on a Spel-BamBI fragment.
- neo gene (PCR amplified with MO195 (BamHT) (SEQ 3D NO:) and MO196 (EcoRI) (SEQ 3D NO:10) from plasmid pYXl 1 (Xiao and Weaver, Nucl Acids Res. 25:2985-2991 (1997;) and CYCl terminator sequences (Xhol-Kpnl fragment from pRS426-G ⁇ E-S (Mumberg, et al., Nucl. Acids. Res.
- the lovFp-HIS3 ⁇ -neo reporter in MY2124 can confer resistance to the drug geneticin (G418). It was empirically determined that MY2124 (untransformed or transformed with parental plasmids MB2478 (CYCl-lovEICEN) or MB2848 (CYC1- lovEIAt274ICEN) was unable to grow on YPD media supplemented with 100 ⁇ g /ml
- Plasmid MB2478 contains the CYCl promoter operationally linked to the entire A. terreus lovE open reading frame.
- the CYCl promoter is a relatively weak promoter and thus the lovE ORF in MB2478 was expressed at low levels.
- MB2478 was the parental vector plasmid for creating full length lovE variants.
- Plasmid MB2848 contains the CYCl promoter operationally linked to a chimeric open reading frame consisting of the A. terreus lovE DNA binding domain fused to the carboxy- terminal portion of the Atl74 gene (U.S. Serial No. 60/257,431, filed December 22, 2000).
- MB2848 was used to create lovE variants in which the DNA binding domain was not mutated. Both MB2478 and MB2848 contain yeast CEN and autonomously replicating sequences and both are maintained at 1-2 copies per cell. In contrast to strains transformed with MB2478 or MB2848, strains transformed with plasmid MB1644 (TEFl-lovE/2 micron) were able to grow on G418-supplemented YPD media. The lovE gene of MB 1644 is under control of the constitutively strong S. cerevisiae TEF1 promoter. MB 1644 contains a 2-micron origin for high-copy replication in yeast.
- MB968 is a low copy S cerevisiae URA3 based expression vector. MB968 was created by inserting the EcoRV fragment (containing the destination cassette) from gateway pEZC7201 (InvitrogenTM, Carlsbad, CA) into XhoVSatt. (filled in with Klenow) linearized pRS416 CYCl (Mumberg, et al, Gene 156:119-122 (1995)).
- MB 1644 and MB2478 are ⁇ 43-based S. cerevisiae expression plasmids that contain the wild-type lovE gene. They are both derivatives of MB 1199.
- MB 1199 was created by using primers MO841 (SEQ ID NO: 11) and MO842 (SEQ 3D NO: 12) to amplify the lovE ORF from A. terreus cDNA.
- Gateway InvitrogenTM, Carlsbad, CA
- Cloning Technology US Patent 5,888,732 was used to clone the lovE PCR fragment into the gateway entry vector pDONR206 (InvitrogenTM, Carlsbad, CA) to create MB 1199.
- Gateway Cloning Technology was used to transfer the lovE ORF from MB1199 into MB968 to create MB2478 and into MB969 (U.S. Serial No. 60/198,335, filed April 18, 2000) to create MB 1644.
- MB2848 is a derivative of MB968 that contains a lovE-AT174 chimera.
- the lovE portion of MB2848 was derived by using oligos MO841 (SEQ ID NO:l 1) and MO2278 (SEQ 3D NO: 13) to PCR amplify the lovE DNA binding domain from terreus cDNA.
- MO841 SEQ ID NO:l 1
- MO2278 SEQ 3D NO: 13
- the Atl 74 portion of MB2848 can be derived by using primers MO2273 (SEQ ID NO: 15) and MO2274 (SEQ ID NO: 16) to PCR amplify the carboxy-terminal domain of Atl '74 from A. terreus cDNA.
- a second round of PCR was performed with primers MO344 (SEQ ID NO: 17) and MO2273 to add appropriate Gateway Cloning Technology compatible sequences.
- the lovE and Atl 74 PCR products were cut with BamBI and purified over a QIAquick PCR purification kit (Qiagen, Valencia, CA) according to manufacturer's instructions. Finally, the products were mixed 3-4 hours in a standard ligation reaction and used in Gateway entry and destination reactions to create MB2848.
- Gateway cloning technology was used to clone the lovE variants of interest into plasmid MB 1419 which is a filamentous fungal expression vector.
- the MB 1419 fungal selection marker is the A. nidulans GPD promoter controlling the ble gene from S. hindustanus.
- the transgene is controlled by the A. nidulans PGK promoter.
- A. terreus strain MF117 is a derivative of A. terreus strain ATCC 20542.
- Example 2 PCR Mutagenesis of the lovE DNA Binding Domain
- the zinc finger DNA binding domain of lovE is encoded by nucleotides 100-201 (SEQ ID NO:92).
- Oligos MO2624 (SEQ 3D NO:18) and MO2654 (SEQ ID NO:19) were used to PCR amplify a lovE containing fragment from plasmid MB2478.
- the 1.7 kb product contains nucleotides 212-1410 of lovE and ⁇ 500 bp of flanking vector sequence.
- Two rounds of standard PCR 1.5 mM MgCl 2 ) were performed with
- Plasmid MB2848 was cut with KpnI-Bam ⁇ I to release a 1.1 kb fragment containing the Atl74 portion of the lovE-At!74 chimeric open reading frame. The remaining 5.5 kb vector sequence retains the lovE DNA binding domain.
- Example 3 PCR Mutagenesis of the lovE Open Reading Frame lovE open reading frame insert was prepared according to the following procedure. Oligo pairs MO2680 (SEQ ID NO:20) /MO2686 (SEQ 3D NO:21), MO2681 (SEQ 3D NO:22) /MO2686, and MO2700 (SEQ 3D NO:23) /MO2701 (SEQ 3D NO:24) were used to PCR amplify the entire lovE open reading frame from plasmid MB2478. The PCR products differ in the amount of 5' and 3' vector sequence flanking the lovE open reading frame.
- PCR was performed using a GeneMo ⁇ h PCR mutagenesis kit (Stratagene, La Jolla, Ca) according to manufacturer's instructions to achieve medium and high range mutation frequencies.
- Plasmid MB2478 was cut with Aspl Xbal to release a 1.7 kb fragment. The remaining 5.0 kb vector sequence completely lacks lovE ORF sequence.
- PCR products were purified using a QIAquick PCR purification kit (Qiagen) according to manufacturer's instructions. All vectors were gel purified using a QIAquick gel extraction kit (Qiagen) according to manufacturer's instructions.
- the mutagenesis strategy of Muhlrad et al. (Yeast 8:79-82 (1992)) was used which involves corransforming a mutated PCR product and gapped plasmids into S. cerevisiae, and then screening for in vivo recombinants having the desired phenotype). Transformation of Saccharomyces cerevisiae was accomplished by the lithium acetate/single-stranded carrier DNA/polyethylene glycol (LiAc/ss-DNA/PEG) protocol (Woods R.A. and Gietz R.D. Methods Mol. Biol.
- Transformants were transferred by replica printing to YPD plates containing 100 ⁇ g/ml G418 and allowed to grow for 2-4 days at 30°C ( Figure 1).
- Drug resistant clones were confirmed in secondary assays including growth on G418 concentrations up to 2000 ⁇ g/ml.
- the plasmid-dependence of the phenotype was determined by observing the re-appearance of drug sensitivity correlating with loss of the library plasmid.
- lovE variant plasmids were recovered from promising candidates (Hoffman and Winston (1986) Gene 57:267). More than 70 lovE variants were identified and definitively characterized by DNA sequence and/or restriction digestion analysis.
- Table 3 summarizes the G418 resistance phenotype and sequence analysis of
- Table 4 summarizes amino acid substitutions that were isolated multiple times, suggesting that they are particularly important for improving lovE variant activity on lovFp-HIS3 ⁇ p-neo expression.
- Example 5 Increased lovF-lacZ Expression in S. cerevisiae
- lovF-lacZ reporter derivative plasmids were constructed as follows.
- Plasmid MB1918 contains the lovFp-lacZ reporter gene. It can be derived from pRS424 (Sikorski and Hieter (1989) Genetics 122:19-27). First, primers MO107 (SEQ ID NO:25) and MO197 (SEQ ID NO:26) are used to PCR amplify the lacZ gene from Yep355 (Myers, et al, Gene 45:299-310 (1986)). This lacZ- containing fragment was inserted into the BamBI-HindUl sites of pRS416 (Sikors i and Hieter, Genetics 122:19-27 (1989)).
- This same lacZ fragment can be cut out of the resulting vector with Kpnl-Notl and inserted into the same sites of pRS424 to create pRS424-lacZ.
- Primers MO1293 (SEQ ID NO:27) and MO1294 (SEQ ID NO:28) are used to PCR amplify a 2.09 kb fragment of the lovF promoter from A. terreus genomic DNA.
- the lovF promoter fragment was then cut with Notl-Bg ⁇ l and inserted into Notl-BamHl linearized pRS424-/ ⁇ cZ.
- Plasmid MB2114 contains the lovF ⁇ p-CYC Ip-lacZ reporter gene. It can be derived from pRS424-lacZ (see MB1918 plasmid construction). Primers MO1787
- SEQ ID NO:29 and MO1788 (SEQ ID NO:30) are used to amplify the 264 bp basal CYCl element from pRS415 CYCl (Mumberg, et al, Gene 156:119-122 (1995)). This 264 bp fragment was inserted upstream of the pRS424-lacZ derivative which has been digested with Spel-BamHI. Finally, the lovF promoter from MB1918 was PCR amplified with MO1793 (SEQ ID NO:31) and MO1794 (SEQ ID NO:32) and inserted into the Notl-Spel sites to create MB2114.
- Yeast strains utilized in this study include strains MY2145 and MY2159, which are both derived from the S. cerevisiae sigma 1278b strain background; the genotypes are both strains are as follows: MATa ura3 ⁇ 0 leul ⁇ O Ms3 ⁇ ::hisG trpl ⁇ Or.hisG. MY2145 and MY2159 contain the /ovEp-lacZ reporter plasmids
- MY2124 transformed with individual lovE variant plasmids was mated to S. cerevisiae strains MY2154 and MY2159. Diploids were selected on SC-UraTrp media. Multiple diploids from each individual mating were assayed for lovF ⁇ p-lacZ expression using 96 well format ⁇ -galactosidase assays. For ⁇ -galactosidase assays, cells were transferred from transformation plates to 96-well microtiter plates containing 200 ⁇ l Z buffer. 12 strains were transferred simultaneously using a 12- channel multi-pipettor to scoop cells from transformation plates. Duplicate samples were prepared for all assays. OD 6O Q readings were taken on samples in Z buffer.
- Z buffer is made by dissolving the following in 1 L of water (16.1 g Na 2 HPO 4 -7H O, 5.5g NaH 2 PO 4 -H 2 O, 0.75 g KCl and 0.246 g MgSO 4 -7H 2 0).
- Z buffer with detergents and ⁇ ME is made as follows: 9.8 ml Z buffer, 100 ⁇ l 20 mg/ml CTAB, 100 ⁇ l 10 mg/ml sodium deoxycholate, and 69 ⁇ l ⁇ ME Control plasmids utilized in these studies included MB968, MB2478 andMB1644.
- Transformation of filamentous fungi was performed according to the following procedure.
- Protoplasts were generated by inoculating rich media with spores. Spores were allowed to germinate for about 20 hrs or until germ tubes were between 5 and 10 spore lengths. The germlings were centrifuged and washed twice with sterile distilled water and once with 1 M magnesium sulfate. Germlings were then resuspended in IM magnesium sulfate containing approximately 2 mg ml of Novozyme. Tubes were then incubated at 30°C shaking at 80 RPM for about 2 hrs or until most of the hyphae were digested and protoplasts were abundant. Protoplasts were filtered through one layer of Miracloth. At least one volume of STC was added and protoplasts were centrifuged. Protoplasts were washed twice with STC.
- Protoplasts then were resuspended in 1ml STC and counted in a hemacytometer. A final concentration of approximately 5 x IO 7 protoplasts/ml were frozen in a 9:1:0.1 solution of STC, SPTC and DMSO in aNalgene Cryo cooler at -80°C (cools - l°C/min). Solutions for transformation were as follows: STC (0.8 M Sorbitol, 25 mM
- Tris-HCl pH 7.5, 25 mM CaCl 2 ) and SPTC (0.8 M Sorbitol, 40% PEG 4000, 25 mM Tris-HCl pH 8, 50 mM CaCl 2 ). Transformation was accomplished according to the following protocol. 1-5 ⁇ g of DNA comprising a lovE variant according to the invention in a fungal expression vector was placed in a 50 ml Falcon tube. 100 ⁇ l of previously frozen protoplasts were added to the DNA, gently mixed, and then incubated on ice for 30 min. 15 ⁇ l of SPTC was added, followed by mixing by tapping and incubation at RT for 15 min. 500 ⁇ l SPTC was added and mixed well by tapping and rolling, then incubated at RT for 15 min.
- Regeneration minimal medium contains trace elements, salts, 25 mM sodium nitrate, 0.8 M Sucrose, and 1% agarose at pH 6.5.
- the selection drug that was used successfully with A. terreus is phleomycin, a broad-spectrum glycopeptide antibiotic.
- Transformants were picked onto new plates with a toothpick (if the fungus was sporulating) or with sterile forceps (if the fungus did not sporulate). Purification plates contained minimal medium (same as regeneration minimal medium but containing 2 % instead of 0.8 M sucrose) and IX drug concentration. Picked transformants were incubated at 26°C for 5-6 days.
- Transformants were grown in production media for secondary metabolite production. Briefly, for A. terreus and lovastatin production, spores were used as the inoculum. Spores were obtained from the purification plate by using a wooden inoculation stick. The medium was RPM containing corn steep liquor, sodium nitrate, potassium phosphate, magnesium sulfate, sodium chloride, P2000 (Dow chemical), trace elements and lactose or glucose as carbon source. The medium was pH 6.5. Flasks were incubated at 26°C with shaking at 225 RPM. For static 96-well cultures, the same medium was used and the spores were obtained from the purification plate with a wooden toothpick. 96-well plates were incubated, without shaking at 26°C.
- Example 7 Measurement of Secondary Metabolite Production
- concentration of the secondary metabolite lovastatin was determined by enzyme inhibition assay (Figure 6). Briefly, 10 ⁇ L of sample was removed and diluted 1 : 100 in H 2 O. 10 ⁇ l of this diluted broth was assayed in a reaction (200 ⁇ L total) containing 1 mM HMGCoA, 1 mM NADPH, 0.005 mM DTT and 5 ⁇ l (His) 6 HMGR. The disappearance of absorbance at 340 nm was observed over time. This represents the disappearance of NADPH, and lovastatin inhibits this reaction.
- Lovastatin concentration was also determined by high pressure liquid chromatography (HPLC). Briefly, 100 ⁇ L of broth sample was removed and diluted 1:10 into 70% H 2 O-30% acetonitrile (900 ⁇ l). This mixture was spun down to pellet debris at 13000 RPM for 5 minutes. 900 ⁇ l of this diluted broth was transferred to a vial and the sample was analyzed by HPLC.
- HPLC high pressure liquid chromatography
- amino acid and nucleic acid sequences of lovE variant sequences are presented in Table 5 and Table 6, respectively.
- A. terreus cDNA was screened to identify sequences that increase expression of a lovF reporter gene in A. terreus. This analysis led to the identification of two cDNAs that could encode lovE variants having additional amino aicds at their amino terminus compared to the love of SEQ ID NO:91.
- One variant, at242 has the amino sequence mtqdtaqyrga (SEQ ID NO:95) preceding the sequence of SEQ ID NO:91.
- SEQ ID NO:93 The entire amino acid sequence of at242 (SEQ ID NO:93) is shown in Table 7.
- the other variant, at258, has the amino sequence mlmtqdtaqyrga (SEQ ID NO:96) preceding the sequence of SEQ ID NO:91.
- Table 5 Amino Acid Sequences of Variants of the lovE Gene lovE-1 maadqgiftnsvtlspvegsrtggtlprrafrrscdrchaqkikctgnkevtgrapcqr cqqaglrcvysercpkrklrqsraadlvsadpdpclhmssppvpsqslpldvseshssn tsrqfldppdsydws tsigtdeaidtdcwglsqcdggfscqleptlpdlpspfestve kaplppvssdiaraasaqrelfddlsavsqeleeillavtvewpkqeiwthpigmffna srrlltvlrqqaqadcrqgtldeclrtknlftavhcyil
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Mycology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US32833901P | 2001-10-09 | 2001-10-09 | |
US09/974,760 US7026460B2 (en) | 2001-10-09 | 2001-10-09 | lovE variant regulator molecules |
US974760 | 2001-10-09 | ||
US328339P | 2001-10-09 | ||
PCT/US2002/032248 WO2003031642A2 (en) | 2001-10-09 | 2002-10-09 | lovE VARIANT REGULATOR MOLECULES |
Publications (2)
Publication Number | Publication Date |
---|---|
EP1451309A2 true EP1451309A2 (en) | 2004-09-01 |
EP1451309A4 EP1451309A4 (en) | 2005-01-26 |
Family
ID=32095726
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP02776194A Withdrawn EP1451309A4 (en) | 2001-10-09 | 2002-10-09 | Love variant regulator molecules |
Country Status (2)
Country | Link |
---|---|
EP (1) | EP1451309A4 (en) |
CA (1) | CA2463527A1 (en) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000037629A2 (en) * | 1998-12-18 | 2000-06-29 | Wisconsin Alumni Research Foundation | Method of producing antihypercholesterolemic agents |
-
2002
- 2002-10-09 CA CA002463527A patent/CA2463527A1/en not_active Abandoned
- 2002-10-09 EP EP02776194A patent/EP1451309A4/en not_active Withdrawn
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000037629A2 (en) * | 1998-12-18 | 2000-06-29 | Wisconsin Alumni Research Foundation | Method of producing antihypercholesterolemic agents |
Non-Patent Citations (1)
Title |
---|
See also references of WO03031642A2 * |
Also Published As
Publication number | Publication date |
---|---|
EP1451309A4 (en) | 2005-01-26 |
CA2463527A1 (en) | 2003-04-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6949356B1 (en) | Methods for improving secondary metabolite production in fungi | |
US20020155517A1 (en) | Regulation of fungal gene expression | |
US20060263864A1 (en) | Methods for improving secondary metabolite production of fungi | |
US7026460B2 (en) | lovE variant regulator molecules | |
US7196189B2 (en) | love variant regulator molecules | |
EP1385981A2 (en) | Antifungal compounds and methods of use | |
US20060211089A1 (en) | Expression of defensins in filamentous fungi | |
US20050118690A1 (en) | Love variant regulator molecules | |
US6300067B1 (en) | TFIIB transcription factor from Candida albicans and methods of screening for inhibitors of Candida albicans growth | |
Meyer et al. | The polarisome component SpaA localises to hyphal tips of Aspergillus niger and is important for polar growth | |
EP1451309A2 (en) | Love variant regulator molecules | |
US20090233287A1 (en) | Production of compounds in a recombinant host | |
AU2006224628B2 (en) | Recombinant expression of defensins in filamentous fungi | |
JP2008517591A (en) | Double hybrid system based on gene pausing by transcription interference | |
Kobayashi et al. | Identification of Saccharomyces cerevisiae ribosomal protein L3 as a target of curvularol, a G1-specific inhibitor of mammalian cells | |
US6358708B1 (en) | Candida albicans SRB-7 | |
AU2003202416B2 (en) | Regulation of fungal gene expression | |
Li | A map kinase pathway essential for mating and contributing to asexual development in Neurospora Crassa | |
Dreyer | Global regulators of fungal secondary metabolism: molecular genetic characterization of Velvet in the β-lactam [beta-lactam] producer Acremonium chrysogenum | |
WO2000077215A9 (en) | Cdc68p CHROMATIN REMODELING FACTOR |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20040429 |
|
AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR IE IT LI LU MC NL PT SE SK TR |
|
A4 | Supplementary search report drawn up and despatched |
Effective date: 20041214 |
|
RIC1 | Information provided on ipc code assigned before grant |
Ipc: 7C 12N 9/00 A Ipc: 7C 07K 14/38 B |
|
17Q | First examination report despatched |
Effective date: 20071024 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20080304 |