EP1194550A1 - Peptides anti-microbiens de mollusques - Google Patents

Peptides anti-microbiens de mollusques

Info

Publication number
EP1194550A1
EP1194550A1 EP00949681A EP00949681A EP1194550A1 EP 1194550 A1 EP1194550 A1 EP 1194550A1 EP 00949681 A EP00949681 A EP 00949681A EP 00949681 A EP00949681 A EP 00949681A EP 1194550 A1 EP1194550 A1 EP 1194550A1
Authority
EP
European Patent Office
Prior art keywords
peptide
nucleic acid
myticin
sequence
peptides
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP00949681A
Other languages
German (de)
English (en)
Inventor
Philippe Roch
Guillaume Mitta
Florence Hubert
Thierry Noel
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Institut Francais de Recherche pour lExploitation de la Mer (IFREMER)
Original Assignee
Centre National de la Recherche Scientifique CNRS
Institut Francais de Recherche pour lExploitation de la Mer (IFREMER)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National de la Recherche Scientifique CNRS, Institut Francais de Recherche pour lExploitation de la Mer (IFREMER) filed Critical Centre National de la Recherche Scientifique CNRS
Publication of EP1194550A1 publication Critical patent/EP1194550A1/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1003—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor
    • C12N15/1006—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor by means of a solid support carrier, e.g. particles, polymers
    • C12N15/101—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor by means of a solid support carrier, e.g. particles, polymers by chromatography, e.g. electrophoresis, ion-exchange, reverse phase
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the invention relates to new antimicrobial peptides produced by molluscs.
  • Polypeptides with antimicrobial properties are produced by a wide variety of species (animal or plant), in which they participate in non-specific defense mechanisms against infections.
  • MGD-1 Mytil us galloprovincialis up to now, related to insect defensins [HUBERT et al., Eur. J. Bioche. , 240, 302-306, (1996)]; peptides from the defensin family have also been demonstrated in Mytilus edulis, as well as peptides called "mytilines” [CHARLET et al., J. Biol. Chem., 271, 21808-21813, (1996);.
  • the inventors have now demonstrated new anti-microbial peptides produced by Mytilus galloprovincialis, which are different from the defensins MGD1, and from the previously known Mytilines.
  • the present invention relates to anti-microbial peptides, hereinafter called: "myticins” which have the following characteristics: - their molecular mass is approximately 4.5 kDa;
  • an anti-microbial peptide in accordance with the invention, it comprises the following sequence (I) (code 1 letter):
  • a peptide in accordance with the invention comprises one of the following sequences (la) or (Ib) (code 1 letter):
  • sequences (la) and (Ib) represent the mature forms, isolated from the hemolymph of Mytilus galloprovincialis, of 2 Myticins called Myticin a and Myticin b, whose cDNAs were also cloned by the inventors.
  • Myticin a and Myticin b whose cDNAs were also cloned by the inventors.
  • the cDNA sequence and the polypeptide sequence of Myticin a are represented in the sequence list in the appendix under the numbers SEQ ID NO: 1 and SEQ ID NO: 2.
  • the cDNA sequence and the polypeptide sequence of Myticin b are represented in the attached sequence list under the numbers SEQ ID NO: 3 and SEQ ID NO: 4.
  • the active peptide of 40 amino acids, corresponding to the sequence (I), and more particularly to one of the sequences (la) and (Ib) is flanked by a signal sequence of 20 amino acids, and a peptide C - terminal of 36 amino acids.
  • the signal sequence would allow the translation product to be addressed to the endoplasmic reticulum.
  • the C-terminal peptide would then allow addressing to the cytoplasmic granules in which the Myticins are stored in mature form and / or the protection of the cell against possible cytolytic activity of the mature peptide.
  • the molecular mass of the mature form of Myticin a is 4438 Da; the molecular mass of the mature form of Myticin b is 4562 Da.
  • Myticins have no significant homology with the anti-microbial peptides known in the prior art, and define a new group of anti-microbial peptides.
  • Myticins can be obtained by extraction from the molluscs which produce them, or by peptide synthesis, or, advantageously, by genetic engineering, by expressing at least one nucleic acid sequence coding for a Myticin, in an appropriate host cell.
  • the present invention also encompasses nucleic acids comprising a sequence encoding a Myticin, as defined above.
  • Nucleic acids in accordance with the invention can be obtained by screening nucleic acid libraries using oligonucleotides derived from the sequences SEQ ID NO: 1 or SEQ ID NO: 3, or from their complementary sequences.
  • the oligonucleotides which can be used for this purpose also form part of the object of the present invention; advantageously, these oligonucleotides comprise at least 15 bp, and preferably at least 20 bp, of the coding portion of one of the sequences SEQ ID NO: 1 or SEQ ID NO: 3, or its complement.
  • the nucleic acids in accordance with the invention also include the expression cassettes, comprising at least one nucleic acid sequence coding for a Myticin, placed under transcriptional control of an appropriate promoter.
  • appropriate promoter any promoter functional in the host cell intended to host the expression cassette. It can be a constitutive promoter or an inducible promoter; it may also be, in the case where the cassette is intended for the expression of a Myticin in an animal or a plant, a tissue-specific promoter.
  • An expression cassette according to the invention can also comprise at least one sequence coding for an appropriate addressing sequence; said addressing sequence can be chosen from those which are naturally associated with Myticins, such as the signal sequences and / or the C-terminal sequences associated with the isoforms Myticin a and Myticin b described above; it is also possible to choose one or more heterologous addressing sequences, which are functional in a given host cell: these may in particular be sequences allowing the addressing of a Myticin to a determined cellular compartment, or its secretion in the culture centre.
  • the subject of the invention is also:
  • - Recombinant vectors characterized in that they comprise at least one nucleic acid sequence in accordance with the invention, encoding a Myticin, and in particular vectors comprising an expression cassette as defined above.
  • prokaryotic or eukaryotic cells transformed with at least one nucleic acid sequence according to the invention can be cells in culture, or cells that are part of a multicellular organism, animal or plant.
  • the nucleic acid sequence according to the invention present in a transformed cell can either be incorporated into the chromosomal DNA of said cell, or be carried by an extra-chromosomal vector.
  • the invention also relates to a method for producing a Myticin, characterized in that it comprises the expression of said Myticin, in at least one transformed cell in accordance with the invention.
  • the Myticins in accordance with the invention can be expressed in cultures of transformed cells using techniques similar to those used for prior art antimicrobial peptides, for example in insect cells, as described by HELLERS et al. [Eur. J. Bioche. 199, pp. 435-439, (1991)] for cecropins, or in yeast, as described by REICHHART et al. [Invertebrate Reproduction and Development, 21, pp. 15-24, (1992)].
  • Myticins can be used in particular for obtaining products and in particular anti-infectious drugs, for example anti-bacteria or fungicides.
  • anti-infectious drugs for example anti-bacteria or fungicides.
  • Such products find their application for the prevention and treatment of various microbial diseases, in very varied sectors, in particular in the fields of health and agriculture, and in that of aquaculture, to limit the development of infectious diseases in farms.
  • An immune reaction is induced in adult mussels (Mytilus galloprovincialis) according to the following protocol: the shell is emptied of its liquid, and 100 ⁇ l of a suspension of bacteria (10 9 bacteria / ml) or of fungi (suspension of hyphae at 1 DO at 600 nm), previously killed by heat, are injected into the adductor muscle.
  • the hemolymph approximately 0.5 ml / animal
  • the supernatant corresponding to the plasma fraction, is added with aprotinin (5 ⁇ g / ml) and frozen (-80 ° C.) until use, and the cell pellet is dried and stored at -80 ° C. until use. Purification of Myticins.
  • Plasma fraction The plasma is diluted (1: 1 v / v) in water sterilized by ultrafiltration
  • the pH is brought to 3.9 by addition of 1M HCl, with stirring in an ice-water bath for 30 min. After centrifugation (10,000 g, 20 min, 4 ° C) the supernatant is collected and kept at 4 ° C until use.
  • Hemocytes After thawing, the hemocyte pellet is resuspended in 5 volumes of 50 mM Tris buffer, pH 8.7, containing 50 mM NaCl, and homogenized. After centrifugation (10,000 g, 20 min, 4 ° C), the pellet containing the cell organelles is taken up in 3 volumes of 2 M acetic acid, and treated by sonication (3 ⁇ 30 s) in an ice-water bath. After removing debris by • centrifugation (10,000 g, 20 min, 4 ° C) the acid extract is stored at 4 ° C until use. HPLC purification
  • the plasma fraction or the hemocyte acid extracts are deposited on SEP-PAK C18 VAC columns
  • Step 1 the fractions eluted on SEP-PAK with 40% acetonitrile are deposited on a reverse phase HPLC column SEPHASIL C18 (250 mm X 4.1 mm) (PHARMACIA). The elution is carried out by a linear gradient of 5 to 50% acetonitrile in acidified water, for 90 min at a flow rate of 0.9 ml / min. The fractions corresponding to the peaks of absorbance are collected in polypropylene tubes (MICROSORB 75 X 12 mm, NUNC IMMUNOTUBES), dried under vacuum, and reconstituted with ultrafiltered water, before testing their antimicrobial activity.
  • polypropylene tubes MICROSORB 75 X 12 mm, NUNC IMMUNOTUBES
  • Step 2 The active fractions recovered at the end of step 1 are deposited on a SEPHASIL C8 reverse phase HPLC column (250 mm X 4.1 mm) (PHARMACIA). The elution is carried out, at a flow rate of 0.9 ml / min, by a linear gradient of 20 to 30% of acetonitrile in acidified water for 40 min.
  • Step 3 The active fractions recovered at the end of step 2, are deposited on a SEPHASIL C18 column (250 mm X 4.1 mm) (PHARMACIA) using the biphasic gradient described in step 2, at a flow rate of 0.9 ml / min.
  • Step 4 The last purification step is carried out on a DELTA PAK HPI C18 reverse phase column
  • CMB minimum bactericidal concentration
  • a series of successive 1/2 dilutions of the peptides is carried out in an aqueous solution containing 0.01% acetic acid and 0.2% bovine serum albumin (BSA).
  • BSA bovine serum albumin
  • the antifungal activity was determined by calculation of the MIC (minimum inhibitory concentration) in a growth inhibition test of Fusarium oxysporum in the liquid phase, according to the protocol described by FELHBAUM et al [J. Biol. Chem. , 269: 33159-63, (1994)]. A series of successive 1/2 dilutions of the peptides is carried out, as indicated above for the determination of the antibacterial activity.
  • the parasitic protozoan of oysters, Perkinsus marinus is cultivated in DMEM medium (GIBCO), according to the protocol described by GAUTHIER and VASTA [J. Invertebr.
  • a cDNA library was constructed in the ZAP EXPRESS vector (STRATAGENE) from the total poly (A) + RNAs of adult mussels hemocytes.
  • a DNA probe representing 83 bp of Myticin aa cDNA was constructed using the SCRIPT Amp PCR cloning kit
  • the amino acid sequence deduced from the open reading frame begins with a signal peptide of 20 amino acids; this signal peptide is directly followed, at its C-terminal end, by a peptide of 40 amino acids, starting with a histidine residue, which corresponds to the active form of the peptide; this active peptide is followed by a C-terminal extension of 36 amino acids.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Analytical Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Public Health (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Plant Pathology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

Peptide anti-microbien, dénommé myticine, caractérisé en ce qu'il est susceptible d'être obtenu à partir d'un mollusque bivalve, et en ce que sa masse moléculaire est d'environ 4,5 kDa; son pI est d'environ 8,7; il comprend 8 résidus cystéine, son procédé de préparation et ses applications. Acide nucléique codant pour ledit peptide.

Description

PEPTIDES ANTI-MICROBIENS DE MOLLUSQUES.
L' Invention est relative à de nouveaux peptides anti-microbiens produits par des mollusques.
Des polypeptides dotés de propriétés anti- microbiennes sont produits par une grande variété d'espèces (animales ou végétales), chez lesquelles ils participent à des mécanismes non-spécifiques de défense contre les infections.
Dans le cas des mollusques bivalves, on a jusqu'à présent identifié chez Mytil us galloprovincialis, un peptide dénommé MGD-1, apparenté aux défensines d'insectes [HUBERT et al., Eur. J. Bioche . , 240, 302- 306, (1996)] ; des peptides de la famille des défensines ont également été mis en évidence chez Mytilus edulis, ainsi que des peptides dénommés « mytilines » [CHARLET et al., J. Biol. Chem.,271, 21808-21813, (1996) ;.
Les Inventeurs ont maintenant mis en évidence de nouveaux peptides anti-microbiens produits par Mytilus galloprovincialis, qui sont différents des défensines MGD1, et des Mytilines précédemment connues.
La présente invention a pour objet des peptides anti-microbiens, dénommés ci-après : « myticines » qui possèdent les caractéristiques suivantes : - leur masse moléculaire est d'environ 4,5 kDa ;
- leur pi est d'environ 8,7 ;
- ils comprennent 8 résidus cystéine.
Selon un mode de réalisation préféré d'un peptide anti-microbien conforme à l'invention, il comprend la séquence (I) suivante (code 1 lettre) :
HX1HX2CTSYX3CX4KFCGTAX5CTX6YX7CRX8LHX9GKXιoCXιιCXι2HCSR ( I ) dans laquelle : Xι= P ou S, X2= V ou A, X3= Y ou , X4= S ou G, X5= S ou G, X6= R ou H, X7= G ou L, X8= N ou V, X9= R ou P, Xιo= L ou M, Xu= F ou A, Xi2= L ou H. Avantageusement, un peptide conforme à l'invention comprend l'une des séquences (la) ou (Ib) suivantes (code 1 lettre) :
HSHACTSY CGKFCGTASCTHYLCRVLHPGKMCACVHCSR ( la) HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR (Ib)
Les séquences (la) et (Ib) représentent les formes matures, isolées à partir de l' hémolymphe de Mytilus galloprovincialis, de 2 Myticines dénommées Myticine a et Myticine b, dont les ADNc ont également été clones par les Inventeurs. A titre d'illustration de l'objet de la présente invention, les caractéristiques des Myticines a et b sont plus spécifiquement indiquées ci-après .
La séquence d'ADNc et la séquence polypeptidique de la Myticine a sont représentées dans la liste de séquences en annexe sous les numéros SEQ ID NO: 1 et SEQ ID NO: 2. La séquence d'ADNc et la séquence polypeptidique de la Myticine b, sont représentées dans la liste de séquences en annexe sous les numéros SEQ ID NO: 3 et SEQ ID NO: 4.
Le peptide actif de 40 acides aminés, correspondant à la séquence (I), et plus particulièrement à l'une des séquences (la) et (Ib) est flanqué d'une séquence signal de 20 acides aminés, et d'un peptide C- terminal de 36 acides aminés. La séquence signal permettrait l'adressage du produit de traduction vers le réticulum endoplasmique. Le peptide C-terminal permettrait ensuite l'adressage vers les granules cytoplasmiques dans lesquels les Myticines sont stockées sous forme mature et/ou la protection de la cellule contre une éventuelle activité cytolytique du peptide mature.
La masse moléculaire de la forme mature de la Myticine a est de 4438 Da ; la masse moléculaire de la forme mature de la Myticine b est de 4562 Da. Les Myticines ne présentent aucune homologie significative avec les peptides anti-microbiens connus dans l'art antérieur, et définissent un nouveau groupe de peptides anti-microbiens. Les Myticines peuvent être obtenues par extraction à partir des mollusques qui les produisent, ou bien par synthèse peptidique, ou, avantageusement, par génie génétique, en exprimant au moins une séquence d'acide nucléique codant une Myticine, dans une cellule hôte appropriée.
La présente Invention englobe également des acides nucléiques comprenant une séquence codant une Myticine, tel que définie ci-dessus.
Des acides nucléiques conformes à l'invention, peuvent être obtenus par criblage de banques d'acide nucléique à l'aide d'oligonucléotides dérivés des séquences SEQ ID NO: 1 ou SEQ ID NO: 3, ou de leurs séquences complémentaires. Les oligonucléotides utilisables dans ce but font également partie de l'objet de la présente invention ; avantageusement, ces oligonucléotides comprennent au moins 15 pb, et de préférence au moins 20 pb, de la portion codante de l'une des séquences SEQ ID NO: 1 ou SEQ ID NO: 3, ou de son complémentaire . Les acides nucléiques conformes à l'invention englobent également les cassettes d'expression, comprenant au moins une séquence d'acide nucléique codant une Myticine, placée sous contrôle transcriptionnel d'un promoteur approprié. Par « promoteur approprié » on entend tout promoteur fonctionnel dans la cellule-hôte destinée à héberger la cassette d'expression. Il peut s'agir d'un promoteur constitutif ou d'un promoteur inductible ; il peut également s'agir, dans le cas où la cassette est destinée à l'expression d'une Myticine chez un animal ou une plante, d'un promoteur tissu-spécifique. Une cassette d'expression conforme à 1 ' invention peut comprendre également au moins une séquence codant une séquence d'adressage appropriée ; ladite séquence d'adressage peut être choisie parmi celles qui sont naturellement associées aux Myticines, telles que les séquences signal et/ou les séquences C- terminales associées aux isoformes Myticine a et Myticine b décrites ci-dessus ; il est également possible de choisir une ou plusieurs séquences d'adressage hétérologues, fonctionnelles dans une cellule-hôte donnée : il peut s'agir notamment de séquences permettant l'adressage d'une Myticine vers un compartiment cellulaire déterminé, ou sa sécrétion dans le milieu de culture. L'Invention a également pour objet :
- des vecteurs recombinants caractérisés en ce qu'ils comprennent au moins une séquence d'acide nucléique conforme à l'invention, codant une Myticine, et en particulier des vecteurs comprenant une cassette d'expression telle que définie ci-dessus. des cellules procaryotes ou eucaryotes transformées par au moins une séquence d'acide nucléique conforme à l'invention. Il peut s'agir de cellules en culture, ou de cellules faisant partie d'un organisme pluricellulaire, animal ou plante. La séquence d'acide nucléique conforme à l'invention présente dans une cellule transformée peut être soit incorporée dans l'ADN chromosomique de ladite cellule, soit être portée par un vecteur extra-chromosomique. L'invention a également pour objet un procédé de production d'une Myticine, caractérisé en ce qu'il comprend l'expression de ladite Myticine, dans au moins une cellule transformée conforme à l'invention.
Les Myticines conformes à l'invention peuvent être exprimées dans des cultures de cellules transformées en utilisant des techniques similaires à celles utilisées pour des peptides antimicrobiens de l'art antérieur, par exemple dans des cellules d'insecte, comme décrit par HELLERS et al. [Eur. J. Bioche . 199, pp. 435-439, (1991)] pour les cécropines, ou dans la levure, comme décrit par REICHHART et al. [Invertebrate Reproduction and Development, 21, pp. 15-24, (1992)].
Elles peuvent également être exprimées dans des animaux ou des plantes transgéniques, pour augmenter la résistance de ceux-ci aux infections, comme décrit par exemple par JAYNES et al., [Plant Science, 89, pp. 43-53
(1993)] dans le cas de peptides analogues de la cécropine
B, exprimés dans des plants de tabac transgénique, ou par
NORELLI et al. [Euphytica, 77, pp. 123-128 (1994)] pour des plants de pommiers transgéniques exprimant le gène de l' attacine-E.
Les Myticines sont utilisables en particulier pour l'obtention de produits et en particulier de médicaments anti-infectieux, par exemple anti-bactériens ou fongicides. De tels produits trouvent leur application pour la prévention et le traitement de différentes maladies microbiennes, dans des secteurs très variés, en particulier dans les domaines de la santé et de l'agriculture, et dans celui de l'aquaculture, pour limiter le développement de maladies infectieuses dans les élevages.
La présente invention sera mieux comprise à l'aide du complément de description qui va suivre, qui se réfère à des exemples de purification et de caractérisation des Myticines.
EXEMPLE 1 ISOLATION DE PEPTIDES ANTI-MICROBIENS A PARTIR DE L'HEMOLYMPHE DE MYTILUS GALLOPROVINCIALIS.
Préparation des fractions de l' émolymphe
Une réaction immunitaire est induite chez des moules (Mytilus galloprovincialis) adultes selon le protocole suivant : la coquille est vidée de son liquide, et 100 μl d'une suspension de bactéries (109 bactéries/ml) ou de champignons (suspension d'hyphes à 1 DO à 600nm) , préalablement tués par la chaleur sont injectés dans le muscle adducteur. L' hémolymphe (approximativement 0,5 ml/animal) est prélevée à partir du muscle postérieur adducteur à l'aide d'une seringue en présence de 1 volume de tampon anti-agrégant MAS (Modified Alsevier Solution) et centrifugée immédiatement à 800g pendant 15 min à 4°C. Le surnageant, correspondant à la fraction plasmatique, est additionné d'aprotinine (5μg/ml) et congelé (-80°C) jusqu'à utilisation, et le culot cellulaire est séché et conservé à -80°C jusqu'à utilisation. Purification des Myticines .
Fraction plasmatique : Le plasma est dilué (1:1 v/v) dans de l'eau stérilisée par ultrafiltration
(MilliQ) additionnée de 0,1% d'acide trifluoroacétique.
Le pH est amené à 3,9 par addition d'HCl 1M, sous agitation dans un bain-marie glacé pendant 30 min. Après centrifugation (10000 g, 20 min, 4°C) le surnageant est recueilli et maintenu à 4°C jusqu'à utilisation.
Hémocytes : Après décongélation le culot d'hémocytes est resuspendu dans 5 volumes de tampon Tris 50 mM, pH 8.7, contenant 50mM NaCl, et homogénéisé. Après centrifugation (10000 g, 20 min, 4°C), le culot contenant les organites cellulaires est repris dans 3 volumes d'acide acétique 2 M, et traité par sonication (3 X 30s) dans dans un bain-marie glacé. Après élimination des débris par • centrifugation (10000 g, 20 min, 4°C) l'extrait acide est conservé à 4°C jusqu'à utilisation. Purification HPLC
La fraction plasmatique ou les extraits acides d'hémocytes sont déposés sur des colonnes SEP-PAK C18 VAC
(WATERS ASSOCIATES) pré-équilibrées par de l'eau acidifiée (0,05% acide trifluoroacétique) . Après lavage à l'eau acidifiée, on effectue 2 elutions successives par des solutions d' acétonitrile à 10% et 40% dans de l'eau acidifiée (0,05% acide trifluoroacétique). Les fractions obtenues sont lyophilisées et reconstituées avec de l'eau ultrafiltrée avant d'être soumises à une chromatographie HPLC en phase inverse. Toutes les étapes de purification HPLC ont été effectuées sur un système HPLC BECKMAN GOLD HPLC équipé d'un détecteur BECKMAN 168. L'élution est suivie par mesure de l'absorption UV à 225 nm.
Etape 1: les fractions éluées sur SEP-PAK à 40% d' acétonitrile sont déposées sur une colonne HPLC phase inverse SEPHASIL C18 (250 mm X 4,1 mm) (PHARMACIA). L'élution est effectuée par un gradient linéaire de 5 à 50% d' acétonitrile dans l'eau acidifiée, pendant 90 min à un débit de 0,9 ml/min. Les fractions correspondant aux pics d'absorbance sont collectées dans des tubes de polypropylène (MICROSORB 75 X 12 mm, NUNC IMMUNOTUBES) , séchées sous vide, et reconstituées avec de l'eau ultrafiltrée, préalablement au test de leur activité antimicrobienne . Etape 2: Les fractions actives récupérées à l'issue de l'étape 1 sont déposées sur une colonne HPLC phase inverse SEPHASIL C8 (250 mm X 4,1 mm) (PHARMACIA). L'élution est effectuée, à un débit de 0,9 ml/min, par un gradient linéaire de 20 à 30% d' acétonitrile dans l'eau acidifiée pendant 40 min.
Etape 3: Les fractions actives récupérées à l'issue de l'étape 2, sont déposées sur une colonne SEPHASIL C18, (250 mm X 4,1 mm) (PHARMACIA) en utilisant le gradient biphasique décrit dans l'étape 2, à un débit de 0, 9 ml/min.
Etape 4: La dernière étape de purification est effectuée sur une colonne phase inverse DELTA PAK HPI C18
(2 X 150 mm) (WATERS ASSOCIATES) en utilisant le gradient biphasique décrit dans l'étape 2, à un débit de 0,3 ml/min. EXEMPLE 2 : ACTIVITE ANTIMICROBIENNE DES PEPTIDES OBTENUS
Micro-organismes utilisés :
La liste des micro-organismes utilisés pour déterminer les activités anti-microbiennes de la Myticine a et de la Myticine b est indiquée ci-après, dans le Tableau 1
Essais antibactériens et détermination de la CMB:
La concentration minimale bactéricide (CMB) des peptides a été déterminée selon le protocole décrit par HANCOCK et al. [http://www.interchg.ubc.ca/bobh/ methods .htm] .
On effectue une série de dilutions successives au 1/2 des peptides dans une solution aqueuse contenant 0,01% d'acide acétique et 0,2% de sérum albumine bovine (BSA) .
Des aliquotes de 10 μl de chaque dilution sont incubées dans des plaques stériles de microtitation en polypropylène à 96 puits, en présence de 100 μl de suspension bactérienne à une densité optique de départ A600 = 0,001 dans du milieu liquide MUELLER HINTON BROTH. L'incubation est effectuée pendant 18 h à 37 °C sous agitation, sauf dans le cas des bactéries marines, pour lesquelles l'incubation est effectuée à 25°C. La CMB est déterminée en étalant sur milieu solide MUELLER HINTON AGAR le contenu des puits correspondant aux 3 premières dilutions pour lesquelles on n'observe aucune croissance bactérienne, et en incubant à 37 °C pendant 18 heures. La plus faible concentration de peptide qui prévient toute formation résiduelle de colonies correspond à la CMB. Activité antifongique :
L'activité antifongique a été déterminée par calcul de la CMI (concentration minimale inhibitrice) dans un test d'inhibition de croissance de Fusarium oxysporum en phase liquide, selon le protocole décrit par FELHBAUM et al [J. Biol . Chem. , 269:33159-63, (1994)]. On effectue une série de dilutions successives au 1/2 des peptides, comme indiqué ci-dessus pour la détermination de l'activité antibactérienne.
80μl de spores suspendues (concentration finale, 104 spores/ml) dans du milieu « Potato Dextrose
Broth » (DIFCO) sont ajoutés à lOμl de solution de peptide dans des plaques stériles de microtitation en polypropylène à 96 puits. Le volume final est ajusté à lOOμl par addition d'eau. L'inhibition de croissance est déterminée après une incubation de 24 heures à 25°C à l'obscurité, par observation au microscope et mesure de l'augmentation de la D06oo- La valeur de la CMI correspond à un intervalle (a-b) de concentrations en peptide, où
(a) représente la concentration la plus élevée à laquelle on observe une croissance, et (b) représente la concentration la plus faible qui induit 100% d'inhibition de croissance.
Activité anti-protozoaire :
Le protozoaire parasite des huitres, Perkinsus marinus est cultivé en milieu DMEM (GIBCO) , selon le protocole décrit par GAUTHIER et VASTA [J. Invertebr.
Pathol., 66, 156-168, (1995)].
10 μM de peptide purifié sont additionnés à
4 x 10^ P. marinus, dans de l'eau de mer (volume final 20 μl) . Le mélange est incubé pendant 1 heure à température de la pièce. La viabilité des parasites est estimée par coloration à l'orange d'acridine et au bromure d'éthidium, comme décrit par MORVAN et al. [J.
Invertebr. Pathol., 69, 177-82, (1997)]. La viabilité maximale est évaluée, à titre de contrôle positif, dans des échantillons dans lesquels le peptide n'a pas été ajouté .
Les résultats des différentes expérimentations effectuées, pour les peptides Myticine a et Myticine b sont illustrées par le Tableau 1 ci-dessous ; les activités biologiques sont exprimées en μM. TABLEAU 1
N.D : non déterminé
Ces résultats montrent que les 2 peptides sont actifs en particulier sur Micrococcus luteus ; le peptide Myticine b apparaît en outre plus actif que le peptide Myticine a sur Micrococcus luteus , Escherichia coli , et Fusari um oxysporum. EXEMPLE 3 : CLONAGE DES ADNC DES PEPTIDES MYTICINE.
Une banque d'ADNc a été construite dans le vecteur ZAP EXPRESS (STRATAGENE) à partir des ARN poly(A)+ totaux d'hémocytes de moules adultes. Une sonde d'ADN représentant 83 pb de l'ADNc de la Myticine a a été construite en utilisant le kit de clonage PCR SCRIPT Amp
(SK+) (STRATAGENE) , et marquée par amorçage aléatoire en utilisant le kit de marquage d'ADN READY-TO-GO
(PHARMACIA), et utilisée pour cribler la banque d'ADN transférée sur membranes HYBOND-N, (AMERSHAM) . Des hybridations à stringence élevée ont été effectuées pendant une nuit à 65°C en solution de Denhardt 5X, 5X SSPE, 0,1 %SDS, 100 μg/ml d'ADN de sperme de saumon. Les filtres préalablement rincés à 65°C en solution 0,5 X SSC contenant 0,1 % SDS, ont été autoradiographiés . Un criblage secondaire a été effectué pour purifier les clones positifs. Les phagemides ont été obtenus par excision in vivo et leurs 2 brins ont été séquences.
110 clones positifs ont été obtenus. Parmi ces clones, 4 ont été séquences, et correspondent aux peptides Myticine a et Myticine B.
Dans les 2 cas, la séquence en acides aminés déduite du cadre de lecture ouverte commence par un peptide signal de 20 acides aminés ; ce peptide-signal est directement suivi, à son extrémité C-terminale, par un peptide de 40 acides aminés, débutant par un résidu histidine, qui correspond à la forme active du peptide ; ce peptide actif est suivi par une extension C-terminale de 36 acides aminés.

Claims

REVENDICATIONS
1) Peptide anti-microbien, dénommé myticine, caractérisé en ce qu'il est susceptible d'être obtenu à partir d'un mollusque bivalve, et en ce que - sa masse moléculaire est d'environ 4,5 kDa ;
- son pi est d'environ 8,7 ;
- il comprend 8 résidus cystéine.
2) Peptide selon la revendication 1, caractérisé en ce qu'il comprend la séquence (I) suivante :
HXιHX2CTS YX3ÇX4KFCGTAX5ÇTX6YX7CRX8LHX9GKXιoÇXιιCXι2HCSR ( I ) dans laquelle : Xι = P ou S , X2= V ou A, X3= Y ou W, X4= S ou G, X5= S ou G, X6= R ou H, X7= G ou L, X8= N ou V, X9= R ou P, Xio≈ L ou M, Xu= F ou A, Xi2= L ou H. 3) Peptide selon la revendication 2, choisi dans le groupe constitué par : un peptide comprenant la séquence (la) suivante :
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR ( la ) - un peptide comprenant la séquence (Ib) suivante :
HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR ( Ib)
4) Acide nucléique comprenant une séquence codant pour un peptide selon une quelconque des revendications 1 à 3.
5) Oligonucléotide comprenant un segment d'au moins 15 pb, et de préférence au moins 20 pb d'un acide nucléique selon la revendication 4.
6) Cassette d'expression, comprenant au moins une séquence d'acide nucléique selon la revendication 4, sous contrôle transcriptionnel d'un promoteur approprié.
7) Vecteur recombinant caractérisé en ce qu'il comprend au moins une séquence d' acide nucléique selon la revendication 4. 8) Cellule procaryote ou eucaryote transformée par une séquence d'acide nucléique selon la revendication 4.
9) Procédé de production d'un peptide selon l'une quelconque des revendications 1 à 3, caractérisé en ce qu'il comprend l'expression d'un acide nucléique selon la revendication 4, dans au moins une cellule transformée selon la revendication 8.
10) Utilisation d'un peptide selon l'une quelconque des revendications 1 à 3 pour l'obtention d'un agent anti-microbien.
EP00949681A 1999-07-08 2000-07-07 Peptides anti-microbiens de mollusques Withdrawn EP1194550A1 (fr)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
FR9908858A FR2796072B1 (fr) 1999-07-08 1999-07-08 Peptides anti-microbiens de mollusques
FR9908858 1999-07-08
PCT/FR2000/001975 WO2001004294A1 (fr) 1999-07-08 2000-07-07 Peptides anti-microbiens de mollusques

Publications (1)

Publication Number Publication Date
EP1194550A1 true EP1194550A1 (fr) 2002-04-10

Family

ID=9547874

Family Applications (1)

Application Number Title Priority Date Filing Date
EP00949681A Withdrawn EP1194550A1 (fr) 1999-07-08 2000-07-07 Peptides anti-microbiens de mollusques

Country Status (7)

Country Link
US (1) US6911524B1 (fr)
EP (1) EP1194550A1 (fr)
JP (1) JP2003504055A (fr)
AU (1) AU6296200A (fr)
CA (1) CA2378452A1 (fr)
FR (1) FR2796072B1 (fr)
WO (1) WO2001004294A1 (fr)

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2796072B1 (fr) * 1999-07-08 2003-09-19 Centre Nat Rech Scient Peptides anti-microbiens de mollusques
ES2178960B1 (es) * 2001-03-02 2004-05-16 Consejo Superior De Investigaciones Cientificas Utilizacion de fracciones de lanolina ricas en ceramidas para el tratamiento de la piel, y composiciones que las contienen.
WO2003092382A1 (fr) * 2002-04-30 2003-11-13 Danish Institute For Fisheries Research Composition et procede pour reguler l'adherence microbienne a la formation de biofilms sur des surfaces
FR2839514A1 (fr) * 2002-05-07 2003-11-14 Centre Nat Rech Scient Nouveaux peptides cycliques, leur utilisation comme agents anti-microbiens
ES2334083B1 (es) * 2007-11-28 2011-04-19 Consejo Superior De Investigaciones Cientificas Metodo para la identificacion de polipeptidos antibacterianos y antivirales obtenidos de mytilus edulis.
KR101263452B1 (ko) 2011-06-02 2013-05-10 조선대학교산학협력단 키조개로부터 유래된 신규한 항균 펩타이드 및 이의 용도
WO2013039861A2 (fr) 2011-09-12 2013-03-21 modeRNA Therapeutics Acides nucléiques modifiés et leurs procédés d'utilisation
KR101384578B1 (ko) 2012-03-27 2014-04-11 부경대학교 산학협력단 전복 유래의 새로운 항미생물성 펩타이드 및 이의 용도
WO2013151665A2 (fr) 2012-04-02 2013-10-10 modeRNA Therapeutics Polynucléotides modifiés destinés à la production de protéines associées à une maladie humaine
CN104411338A (zh) 2012-04-02 2015-03-11 现代治疗公司 用于产生与人类疾病相关的生物制剂和蛋白质的修饰多核苷酸
WO2017083515A2 (fr) 2015-11-10 2017-05-18 Visterra, Inc. Conjugués molécules anticorps-médicaments et leurs utilisations
JP7303110B2 (ja) 2017-01-18 2023-07-04 ビステラ， インコーポレイテッド 抗体分子－薬物コンジュゲートおよびその使用
ES2763349B2 (es) * 2018-11-28 2021-12-28 Consejo Superior Investigacion Péptido de miticina y su uso en regeneración celular
CN110724175B (zh) * 2019-10-14 2021-10-22 浙江海洋大学 一种利用超声匀浆从紫贻贝加工下脚料中提取抗菌肽的制备方法
KR20240085798A (ko) 2020-04-03 2024-06-17 비스테라, 인크. 항체 분자-약물 접합체 및 이의 용도
CN114106103B (zh) * 2022-01-24 2022-04-15 中国科学院南海海洋研究所 一种贝类来源的抗菌肽p-amp108及在制备治疗痤疮药物中的应用

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2633296B1 (fr) * 1988-06-24 1991-11-15 Centre Nat Rech Scient Molecules peptidiques a action sur les germes a gram positif
FR2796072B1 (fr) * 1999-07-08 2003-09-19 Centre Nat Rech Scient Peptides anti-microbiens de mollusques
RU2172322C1 (ru) * 1999-12-27 2001-08-20 Энтофарм Ко., Лтд. Аллофероны-иммуномодулирующие пептиды
WO2002062836A2 (fr) * 2000-11-06 2002-08-15 Michigan State University Detection de l'activite antibacterienne dans un produit d'excretion-secretion de trichuris suis adulte

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0104294A1 *

Also Published As

Publication number Publication date
WO2001004294A1 (fr) 2001-01-18
AU6296200A (en) 2001-01-30
US6911524B1 (en) 2005-06-28
FR2796072A1 (fr) 2001-01-12
FR2796072B1 (fr) 2003-09-19
JP2003504055A (ja) 2003-02-04
CA2378452A1 (fr) 2001-01-18

Similar Documents

Publication Publication Date Title
Mitta et al. Myticin, a novel cysteine‐rich antimicrobial peptide isolated from haemocytes and plasma of the mussel Mytilus galloprovincialis
EP1194550A1 (fr) Peptides anti-microbiens de mollusques
Cho et al. Lumbricin I, a novel proline-rich antimicrobial peptide from the earthworm: purification, cDNA cloning and molecular characterization
Samakovlis et al. The immune response in Drosophila: pattern of cecropin expression and biological activity.
Lorenzini et al. Acanthoscurrin: a novel glycine-rich antimicrobial peptide constitutively expressed in the hemocytes of the spider Acanthoscurria gomesiana
Carballar-Lejarazú et al. Recombinant scorpine: a multifunctional antimicrobial peptide with activity against different pathogens
Supungul et al. Cloning, expression and antimicrobial activity of crustinPm1, a major isoform of crustin, from the black tiger shrimp Penaeus monodon
Boman et al. Cell-free immunity in Cecropia: a model system for antibacterial proteins
Otero‐Gonzáiez et al. Antimicrobial peptides from marine invertebrates as a new frontier for microbial infection control
Kang et al. Characterization and expression of a new subfamily member of penaeidin antimicrobial peptides (penaeidin 5) from Fenneropenaeus chinensis
Kumaresan et al. A novel antimicrobial peptide derived from fish goose type lysozyme disrupts the membrane of Salmonella enterica
EP1000153B1 (fr) Peptides anti-microbiens de crustaces, denommes penaeidines
FR2723951A1 (fr) Peptide, agent antibacterien contenant ce peptide, gene de ce peptide, adn recombine contenant ce gene et procede de preparation de ce peptide.
CA2325658A1 (fr) Gene codant pour l'heliomicine et son utilisation
He et al. Separation, identification and gene expression analysis of PmAMP-1 from Pinctada fucata martensii
Xu et al. Defensin of the zebra mussel (Dreissena polymorpha): molecular structure, in vitro expression, antimicrobial activity, and potential functions
Park et al. Protein purification and cDNA cloning of a cecropin-like peptide from the larvae of fall webworm (Hyphantria cunea)
CA2755472A1 (fr) Analogues de la temporine-sha et leurs utilisations
WO2005080423A1 (fr) Peptides antifongiques
FR2695392A1 (fr) Peptides possédant notamment des propriétés antibactériennes, leur procédé d'obtention, et leurs applications biologiques.
Sitaram et al. Antimicrobial peptides as novel therapeutic agents to combat drug-resistant microbial infections
EP1601768B1 (fr) Peptide antimicrobien appele halocyntin, gene codant ledit peptide, vecteur, organisme transforme et composition le contenant.
WO2003095482A2 (fr) Nouveaux peptides cycliques, leur utilisation comme agents anti-microbiens.
CA2410575A1 (fr) Peptides antimicrobiens de la famille des defensines, polynucleotides codant ces peptides, vecteurs et organismes transformes les contenant
EP1601769B1 (fr) Peptide antimicrobien appele papillosin, gene codant ledit peptide, vecteur, organisme transforme et composition le contenant

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20020208

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE

AX Request for extension of the european patent

Free format text: AL;LT;LV;MK;RO;SI

17Q First examination report despatched

Effective date: 20031218

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20070905