DE19520421A1

DE19520421A1 - Thrombosis-associated autoantigen

Info

Publication number: DE19520421A1
Application number: DE1995120421
Authority: DE
Inventors: Gerd Prof Dr Med Schmitz; Udo Dipl Biol Schlosser; Christa Buechler
Original assignee: Progen Biotechnik GmbH
Current assignee: Progen Biotechnik GmbH
Priority date: 1995-06-02
Filing date: 1995-06-02
Publication date: 1996-12-05

Abstract

Autoantigen having the amino acid sequence shown (I), is new, RFYQFKTSFHMYIWNTALFCQENMGNGSSQKPKDT (I). Also claimed is: (1) DNA encoding the autoantigen; (2) expression plasmid contg. the DNA; and (3) transformant contg. the plasmid.

Description

Die Erfindung betrifft ein Autoantigen, das sich zur Feststellung einer Thrombose neigung eignet, eine ein solches Autoantigen kodierende DNA und ein Verfahren zur Herstellung eines solchen Autoantigens und dessen Verwendung.The invention relates to an autoantigen, which is used to detect thrombosis inclination, such a DNA encoding such an autoantigen and a method for the production of such an autoantigen and its use.

Arterielle und venöse Thrombose ist eine häufige Komplikation, die bei einer Vielzahl von Multiorganerkrankungen und insbesondere bei längerer Bettlägrigkeit auftritt. Bisher gibt es noch keine Möglichkeit, vorherzusagen, ob ein Mensch zu einer Thrombose neigt oder ob keine Thrombosegefahr besteht. Es wäre aber sehr wünschenswert, dies feststellen zu können, da dann nicht standardmäßig bei längerer Bettlägrigkeit Blutverdünnungsmittel verabreicht werden müßten und andererseits eine Person mit festgestellter Thromboseneigung sehr viel eingehender betreut und therapiert werden könnte.Arterial and venous thrombosis is a common complication associated with a Variety of multi-organ diseases and especially in the case of prolonged bedriddenness occurs. So far, there is no way to predict whether a person will tends to thrombosis or if there is no risk of thrombosis. But it would be very desirable to be able to determine this, because then not by default prolonged bed sickness blood thinners would have to be administered and on the other hand, a person with a determined tendency to thrombosis is much more detailed could be cared for and treated.

Der vorliegenden Erfindung liegt somit die Aufgabe zugrunde, ein Mittel bereitzu stellen, mit dem eine Thromboseneigung festgestellt werden kann.The present invention is therefore based on the object of providing a means with which a tendency to thrombosis can be determined.

Erfindungsgemäß wird dies durch die Bereitstellung der Gegenstände in den Patentansprüchen erreicht.According to the invention, this is achieved by providing the objects in the Claims achieved.

Gegenstand der Erfindung ist somit ein Autoantigen, das die Aminosäuresequenz von Fig. 2 oder ein funktionelles Derivat oder Fragment davon umfaßt.The invention thus relates to an autoantigen which comprises the amino acid sequence of FIG. 2 or a functional derivative or fragment thereof.

Die vorliegende Erfindung beruht auf der Erkenntnis des Anmelders, daß in Seren von Personen mit einer Thromboseneigung spezifische Autoantikörper vorliegen. Der Anmelder hat solche Seren zum Screenen einer humanen Lambda-Phagen-Expressionsbibliothek, z. B. λgt 11, Clontech # HL 1123 b (vgl. Huynh, T.V. et al., DNA Cloning, (1985), IRL Press Ltd., Oxford, England, Band 1) verwendet und positive Phagen erhalten. Die Inserts dieser Phagen wurden subkloniert und se quenziert, wodurch ein Insert, HMhk-B, gefunden wurde, das die in Fig. 1 angege bene Sequenz aufweist. Diese Sequenz umfaßt die Nukleotidsequenz und die davon abgeleitete Aminosäuresequenz eines Autoantigens. HMhk-B wurde bei der DSM (Deutsche Sammlung von Mikroorganismen und Zellkulturen) als pX-B1 unter DSM 9962 am 6. Mai 1 994 hinterlegt. Durch ein übliches chemisches Synthese-Verfahren wurde das von HMhk-B kodierte Autoantigen hergestellt. Es wurde mit vorstehenden Seren inkubiert, wodurch die Bindung der Autoantikörper an die in Fig. 2 angegebene Sequenz des Autoantigens bestätigt wurde.The present invention is based on the knowledge of the applicant that specific autoantibodies are present in sera from persons with a tendency to thrombosis. The applicant has such sera for screening a human lambda phage expression library, e.g. B. λgt 11, Clontech # HL 1123 b (cf. Huynh, TV et al., DNA Cloning, (1985), IRL Press Ltd., Oxford, England, Volume 1) and obtained positive phages. The inserts of these phages were subcloned and sequenced, whereby an insert, HMhk-B, was found which has the sequence given in FIG. 1. This sequence comprises the nucleotide sequence and the amino acid sequence of an autoantigen derived therefrom. HMhk-B was deposited with the DSM (German Collection of Microorganisms and Cell Cultures) as pX-B1 under DSM 9962 on May 6, 994. The autoantigen encoded by HMhk-B was produced by a conventional chemical synthesis method. It was incubated with the above sera, whereby the binding of the autoantibodies to the sequence of the autoantigen shown in FIG. 2 was confirmed.

Der vorstehende Ausdruck "funktionelles Derivat oder Fragment der Aminosäurese quenz von Fig. 2" umfaßt jegliches Derivat oder Fragment dieser Aminosäurese quenz, gegen die ein Autoantikörper gebildet werden kann. Insbesondere betrifft der Ausdruck Epitope in der Aminosäuresequenz, die als Autoantigene wirken können. Auch kann die Aminosäuresequenz von Fig. 2 Additionen, Substitutionen und/oder Deletionen von ein oder mehreren Aminosäuren aufweisen, was auch für die funktionellen Derivate oder Fragmente gilt.The above term "functional derivative or fragment of the amino acid sequence of Fig. 2" includes any derivative or fragment of this amino acid sequence against which an autoantibody can be raised. In particular, the term refers to epitopes in the amino acid sequence that can act as autoantigens. The amino acid sequence of FIG. 2 can also have additions, substitutions and / or deletions of one or more amino acids, which also applies to the functional derivatives or fragments.

Ein weiterer Gegenstand der Erfindung ist eine für ein vorstehendes Autoantigen kodierende Nukleinsäure. Dies kann eine RNA oder eine DNA sein. Letztere kann z. B. eine genomische DNA oder eine cDNA sein. Bevorzugt ist eine DNA, die folgendes umfaßt:Another object of the invention is one for an autoantigen above coding nucleic acid. This can be an RNA or a DNA. The latter can e.g. B. be a genomic DNA or a cDNA. Preferred is a DNA that includes the following:

(a) the DNA of Figure 2 or a portion thereof,
(b) a DNA hybridizing with the DNA of (a), or
(c) one with the DNA of (a) or (b) via the degenerate genetic code related DNA.

Der Ausdruck "hybridisierende DNA" weist auf eine DNA hin, die unter üblichen Bedingungen, insbesondere bei 20°C unter dem Schmelzpunkt der DNA, mit einer DNA von (a) hybridisiert. The term "hybridizing DNA" indicates a DNA that is commonly used Conditions, especially at 20 ° C below the melting point of the DNA, with a DNA hybridized from (a).

Zur Herstellung einer erfindungsgemäßen DNA ist es günstig, eine humane Lamb da-Phagen-Expressionsbibliothek, z. B. λgt11 Clontech # HL 1123 b (vgl. vor stehend) mit Seren von Patienten mit einer Thromboseneigung zu screenen. Von positiven Phagen können dann die Inserts subkloniert und sequenziert werden, wodurch die Autoantigen-kodierenden Sequenzen erkannt werden können. Weiter hin können die Bindungsstellen für die Autoantikörper eingegrenzt werden. Hierzu eignet es sich, durch ein PCR-Verfahren Fragmente der Phagen-Inserts herzustellen und diese mit den Seren zu inkubieren.To produce a DNA according to the invention, it is favorable to use a human Lamb da phage expression library, e.g. B. λgt11 Clontech # HL 1123 b (cf. standing) with sera from patients with a tendency to thrombosis. Of positive phages, the inserts can then be subcloned and sequenced, whereby the autoantigen coding sequences can be recognized. Next the binding sites for the autoantibodies can be limited. For this it is suitable to use a PCR method to produce fragments of the phage inserts and incubate them with the sera.

Eine erfindungsgemäße DNA kann in einem Vektor bzw. Expressionsvektor vor liegen. Beispiele solcher sind dem Fachmann bekannt. Im Falle eines Expressions vektors für E.coli sind dies z. B. λgt11, pGEMEX, pUC-Derivate, pGEX-2T, pET3b, pXa1 und pQE31. Für die Expression in Hefe sind z. B. pY100 und Ycpad1 zu nennen, während für die Expression in tierischen Zellen z. B. pKCR, pEFBOS, cDM8 und pCEV4, anzugeben sind. Für die Expression in Insektenzellen eignet sich besonders der Baculovirus-Expressionsvektor pAc SG His NT-A.A DNA according to the invention can exist in a vector or expression vector lie. Examples of such are known to the person skilled in the art. In the case of an expression vectors for E.coli are z. B. λgt11, pGEMEX, pUC derivatives, pGEX-2T, pET3b, pXa1 and pQE31. For expression in yeast z. B. pY100 and Ycpad1 too call, while for expression in animal cells z. B. pKCR, pEFBOS, cDM8 and pCEV4. Is suitable for expression in insect cells especially the baculovirus expression vector pAc SG His NT-A.

Der Fachmann kennt geeignete Zellen, um eine erfindungsgemäße, in einem Expressionsvektor vorliegende DNA zu exprimieren. Beispiele solcher Zellen um fassen die E.coli-Stämme Y1089, HB101, DH1, x1776, JM101, JM 109, BL21 und XL1 blue, den Hefe-Stamm Saccharomyces cerevisiae und die tierischen Zellen L, 3T3, FM3A, CHO, CQS, Vero und HeLa sowie die Insektenzellen Sf9.The person skilled in the art knows suitable cells in order to use one according to the invention Expression vector to express existing DNA. Examples of such cells around summarize the E. coli strains Y1089, HB101, DH1, x1776, JM101, JM 109, BL21 and XL1 blue, the yeast strain Saccharomyces cerevisiae and the animal strain Cells L, 3T3, FM3A, CHO, CQS, Vero and HeLa as well as the insect cells Sf9.

Der Fachmann weiß, in welcher Weise eine erfindungsgemäße DNA in einen Expressionsvektor inseriert werden muß. Ihm ist auch bekannt, daß diese DNA in Verbindung mit einer für ein anderes Protein bzw. Peptid kodierenden DNA inse riert werden kann, so daß die erfindungsgemäße DNA in Form eines Fusions proteins exprimiert werden kann.The person skilled in the art knows in what way a DNA according to the invention is in a Expression vector must be inserted. He is also aware that this DNA is found in Connection with a DNA coding for another protein or peptide can be riert, so that the DNA of the invention in the form of a fusion proteins can be expressed.

Des weiteren kennt der Fachmann Bedingungen, transformierte bzw. transfizierte Zellen zu kultivieren. Auch sind ihm Verfahren bekannt, das exprimierte Auto antigen zu isolieren und zu reinigen. Ein vorstehendes, rekombinant hergestelltes Autoantigen, das auch ein Fusionsprotein sein kann, ist somit ebenfalls Gegen stand der Erfindung.Furthermore, the person skilled in the art knows conditions, transformed or transfected Cultivate cells. He is also familiar with processes, the expressed car isolate and purify antigen. A foregoing recombinantly made Autoantigen, which can also be a fusion protein, is therefore also a counter state of the invention.

Erfindungsgemäße Autoantigene zeichnen sich dadurch aus, daß sie in Personen mit einer Thromboseneigung spezifische Autoantikörper erkennen. Sie eignen sich daher als Mittel zur Feststellung (Diagnose) einer Thromboseneigung. Eine solche Feststellung kann durch übliche Nachweisverfahren, insbesondere einen Western Blot, einen ELISA, eine Immunpräzipitation oder durch Immunfluoreszenz, erfolgen. Hierzu können die erfindungsgemäßen Autoantigene, wenn es angebracht ist, markiert sein oder in Kombination mit markierten, gegen sie gerichteten Anti körpern eingesetzt werden. Auch können erfindungsgemäße Autoantigene in einem Biosensor-Verfahren verwendet werden.Autoantigens according to the invention are distinguished in that they are in persons recognize specific autoantibodies with a tendency to thrombosis. They are suitable therefore as a means of determining (diagnosing) a tendency to thrombosis. Such Detection can be carried out using standard detection methods, in particular a Western Blot, an ELISA, immunoprecipitation or by immunofluorescence. For this purpose, the autoantigens according to the invention, if appropriate, be marked or in combination with marked anti directed against them bodies are used. Autoantigens according to the invention can also be used in one Biosensor method can be used.

Ferner können erfindungsgemäße Autoantigene in einem Kit vorliegen. Dieser kann die Autoantigene, wie in vorstehender Form angegeben, zusammen mit üblichen Zusatzstoffen, wie Puffer, Trägermaterial und Kontrollen, enthalten. Ein solcher Kit ist ebenfalls Gegenstand der Erfindung.Furthermore, autoantigens according to the invention can be present in a kit. This can the autoantigens, as indicated in the above form, along with common ones Contain additives, such as buffers, carrier material and controls. Such a kit is also the subject of the invention.

Darüberhinaus eignen sich erfindungsgemäße Autoantigene auch für therapeuti sche Zwecke. Beispielsweise können durch sie Autoantikörper affinitätschromato graphisch aus dem Kreislauf von Patienten mit einer Thromboseneigung entfernt werden. Auch ist an eine Entfernung von für eine Thromboseneigung spezifischen Autoantikörper-produzierenden Lymphozyten durch Kopplung der erfindungs gemäßen Autoantigene an Zell-Toxine zu denken.In addition, autoantigens according to the invention are also suitable for therapeuti purposes. For example, they can have autoantibodies with affinity chromatography graphically removed from the circulation of patients with a tendency to thrombosis will. Also, removal is specific for a thrombotic tendency Autoantibody-producing lymphocytes by coupling the invention according to autoantigens of cell toxins.

Des weiteren eignen sich erfindungsgemäße Nukleinsäuren, insbesondere DNAs, für diagnostische Zwecke aller Art. Auch können solche Nukleinsäuren für thera peutische Maßnahmen verwendet werden. Beispielsweise können die Nukleinsäu ren in übliche Expressionsvektoren inseriert werden und diese in Personen mit einer Thromboseneigung eingeschleust werden. Durch Expression der Nukleinsäuren werden Autoantigene erhalten, die dann die Autoantikörper abfangen können. Also suitable are nucleic acids according to the invention, in particular DNAs, for diagnostic purposes of all kinds. Such nucleic acids can also be used for thera measures are used. For example, the nucleic acid can be inserted into conventional expression vectors and these into persons with a Thrombosis tendency to be introduced. By expression of the nucleic acids will receive autoantigens that can then intercept the autoantibodies.

Kurze Beschreibung der Zeichnungen:Brief description of the drawings:

Fig. 1 zeigt die Sequenz eines Phageninserts, HMhk-B, das mit Seren von Personen mit einer Thromboseneigung reagiert, und Figure 1 shows the sequence of a phage insert, HMhk-B, which reacts with sera from individuals with a tendency to thrombosis, and

Fig. 2 zeigt die Nukleotidsequenz und die davon abgeleitete Aminosäurese quenz des durch HMhk-B kodierten Autoantigens. Fig. 2 shows the nucleotide sequence and the deduced sequence of the protein encoded by Aminosäurese HMhk-B autoantigen.

Die folgenden Beispiele erläutern die Erfindung.The following examples illustrate the invention.

Example 1: Production of a DNA according to the invention or of an invention according to autoantigen

Eine humane Lambda-Phagen-Expressionsbibliothek, λgt11 Clontech # HL 1123 b (vgl. vorstehend) wurde mit dem Serum einer eine Thromboseneigung aufweisen den Person HM gescreent. Es wurden positive Phagen erhalten. Die Inserts dieser Phagen wurden über ein PCR-Verfahren, in dem übliche λ-univers und λ-revers Primer verwendet wurden, amplifiziert. Die Amplifikationsprodukte wurden "blunt end" in Hincll-gespaltenem Vektor pUC 18 (vgl. Yanisch-Perron, C. et al., Gene 33, (1985), 103) subkloniert und sequenziert. Es wurde ein Insert, HMhk-B, identi fiziert, das die in Fig. 1 angegebene Sequenz aufweist. Diese umfaßt die Nukleotid (Aminosäure)sequenz eines erfindungsgemäßen Autoantigens. Ein solches Auto antigen wurde durch ein übliches chemisches Verfahren synthetisiert. Die Amino säure (Nukleotid)sequenz des Autoantigens ist in Fig. 2 angegeben.A human lambda phage expression library, λgt11 Clontech # HL 1123 b (see above) was screened with the serum of a person HM who had a tendency to thrombosis. Positive phages were obtained. The inserts of these phages were amplified using a PCR method in which the usual λ-universal and λ-revers primers were used. The amplification products were "blunt end" subcloned and sequenced in Hincll-cleaved vector pUC 18 (cf. Yanisch-Perron, C. et al., Gene 33, (1985), 103). An insert, HMhk-B, was identified which has the sequence given in FIG. 1. This comprises the nucleotide (amino acid) sequence of an autoantigen according to the invention. Such an autoantigen was synthesized by a common chemical method. The amino acid (nucleotide) sequence of the autoantigen is shown in Fig. 2.

Example 2: Expression of a DNA according to the invention 1. Expression in E. coli

1.1 The insert HMhk-B (EcoRI / PstI insert fragment from pUC 1 8) from Example 1 was inserted between the EcoRI and PstI site of the expression vector pXa1 (see product information from Boehringer Mannheim), as a result of which the expression plasmid pX- B1 was obtained. This expression plasmid was deposited with the DSM under DSM 9962 on May 6, 1995. pX-B1 codes for a fusion protein from a β Gal portion (N-terminal fusion partner) and the autoantigen according to the invention from FIG. 1 (2) (C-terminal fusion partner). pX-B was used to transform E.coli XL1 blue (see Bullock, WO et al., Bio Techniques 5, (1987), 376-278). The above fusion protein was obtained. It was detected by an antibody directed against the ßGal portion or by an antibody directed against the autoantigen.
1.2 The DNA from FIG. 2 was provided with the linkers, EcoRI and PstI by a PCR method. The DNA obtained was inserted between the EcoRI and PstI site of pXa1 (see 1.1 above), whereby the expression plasmid pX-B2 was obtained. This codes for a fusion protein composed of a βGal portion (N-terminal fusion partner) and the inventive autoantigen from FIG. 2 (1) (C-terminal fusion partner). pX-B2 was used to transform E.coli XL1 blue (see 1.1 above). The above fusion protein was obtained. It was verified as in 1 above.

2. Expression in insect cells

Das Insert HMhk-B (vgl. Beispiel 2, 1.1) wurde zwischen die EcoRl- und Psfi-Stelle des Expressionsvektors pAc SG His NT-A, B, C (vgl. Produktinformation der Firma PharMingen, Dianova, Raboisen) inseriert, wodurch das Expressionsplasmid pAc-B1 erhalten wurde. Dieses kodiert für ein Fusionsprotein aus einem Histidin-Anteil (N-terminaler Fusionspartner) und dem erfindungsgemäßen Autoantigen von Fig. 1 (C-terminaler Fusionspartner). pAc-B1 wurde zur Transformation von Sf9-Insek tenzellen (vgl. Produktionsformation vorstehend) verwendet. Es wurde das vor stehende Fusionsprotein erhalten. Sein Nachweis erfolgte durch einen gegen den Histidin-Anteil gerichteten Antikörper bzw. durch einen gegen das Autoantigen gerichteten Antikörper. The insert HMhk-B (see Example 2, 1.1) was inserted between the EcoRI and Psfi site of the expression vector pAc SG His NT-A, B, C (see product information from PharMingen, Dianova, Raboisen), which means that Expression plasmid pAc-B1 was obtained. This codes for a fusion protein consisting of a histidine portion (N-terminal fusion partner) and the autoantigen according to the invention from FIG. 1 (C-terminal fusion partner). pAc-B1 was used to transform Sf9 insect cells (see production formation above). The above fusion protein was obtained. It was detected by an antibody directed against the histidine portion or by an antibody directed against the autoantigen.

Example 3: Detection of autoantibodies by a car according to the invention antigen

Das exprimierte Fusionsprotein von Beispiel 2, 1.1 bzw. 1.2 wurde einer Poly acrylamid-Gelelektrophorese unterzogen und auf eine PVDF-Membran übertragen. Die Membran wurde nach üblichen Verfahren abgesättigt und mit Seren von vorstehender Person HM wie auch von Personen ohne Thromboseneigung in einer Verdünnung von 1 : 100 1 h bei 25°C inkubiert. Nach mehreren Waschschritten mit PBS (0,05% Tween 20) wurde ein käuflicher POD-konjugierter Anti-human Ig-Antikörper (1 : 1000, DAKO) zugegeben und ebenfalls 1 h inkubiert. Die Nachweis reaktion erfolgte nach mehreren Waschschritten mit dem POD-Substrat AEC (Ami noethylcarbazol, Sigma) nach Herstellerangaben, bis Banden sichtbar waren.The expressed fusion protein from Example 2, 1.1 and 1.2 was a poly subjected to acrylamide gel electrophoresis and transferred to a PVDF membrane. The membrane was saturated by conventional methods and with sera from above person HM as well as persons without a tendency to thrombosis in one Dilution of 1: 100 incubated for 1 h at 25 ° C. After several washing steps with PBS (0.05% Tween 20) became a commercially available POD-conjugated anti-human Ig antibody (1: 1000, DAKO) added and also incubated for 1 h. The proof reaction took place after several washing steps with the POD substrate AEC (Ami noethylcarbazol, Sigma) according to the manufacturer's instructions until bands were visible.

Es zeigte sich, daß das erfindungsgemäße Autoantigen spezifische Autoantikörper im Serum einer eine Thromboseneigung aufweisenden Person erkennt.The autoantigen according to the invention was found to be specific autoantibodies in the serum of a person with a tendency to thrombosis.

Claims

1. Autoantigen comprising the amino acid sequence of Fig. 2 or a functional derivative or fragment thereof.

2. DNA coding for the autoantigen according to claim 1.

3. DNA according to claim 2, wherein the DNA comprises:

(a) the DNA of Figure 2 or a portion thereof,
(b) a DNA hybridizing with the DNA of (a) or
(c) a DNA related to the DNA of (a) or (b) via the degenerate genetic code.

4. Expression plasmid comprising the DNA of claim 2 or 3.

5. Transformant containing the expression plasmid according to claim 4.

6. A method for producing the autoantigen of claim 1 comprising culturing the transformant according to claim 5 under suitable Conditions.

7. Use of the autoantigen according to claim 1 as a reagent for diagnosis and / or therapy.

8. Use of the DNA according to claim 2 or 3 as a reagent for diagnosis.

9. Kit comprising the autoantigen according to claim 1 and conventional additives.