DE1751351A1 - Device for combining streams of flowable food - Google Patents
Device for combining streams of flowable foodInfo
- Publication number
- DE1751351A1 DE1751351A1 DE19681751351 DE1751351A DE1751351A1 DE 1751351 A1 DE1751351 A1 DE 1751351A1 DE 19681751351 DE19681751351 DE 19681751351 DE 1751351 A DE1751351 A DE 1751351A DE 1751351 A1 DE1751351 A1 DE 1751351A1
- Authority
- DE
- Germany
- Prior art keywords
- chamber
- hollow shaft
- housing
- opening
- wall
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23G—COCOA; COCOA PRODUCTS, e.g. CHOCOLATE; SUBSTITUTES FOR COCOA OR COCOA PRODUCTS; CONFECTIONERY; CHEWING GUM; ICE-CREAM; PREPARATION THEREOF
- A23G9/00—Frozen sweets, e.g. ice confectionery, ice-cream; Mixtures therefor
- A23G9/44—Frozen sweets, e.g. ice confectionery, ice-cream; Mixtures therefor characterised by shape, structure or physical form
- A23G9/48—Composite products, e.g. layered, laminated, coated, filled
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23G—COCOA; COCOA PRODUCTS, e.g. CHOCOLATE; SUBSTITUTES FOR COCOA OR COCOA PRODUCTS; CONFECTIONERY; CHEWING GUM; ICE-CREAM; PREPARATION THEREOF
- A23G9/00—Frozen sweets, e.g. ice confectionery, ice-cream; Mixtures therefor
- A23G9/04—Production of frozen sweets, e.g. ice-cream
- A23G9/22—Details, component parts or accessories of apparatus insofar as not peculiar to a single one of the preceding groups
- A23G9/28—Details, component parts or accessories of apparatus insofar as not peculiar to a single one of the preceding groups for portioning or dispensing
- A23G9/281—Details, component parts or accessories of apparatus insofar as not peculiar to a single one of the preceding groups for portioning or dispensing at the discharge end of freezing chambers
- A23G9/282—Details, component parts or accessories of apparatus insofar as not peculiar to a single one of the preceding groups for portioning or dispensing at the discharge end of freezing chambers for dispensing multi-flavour ice-creams
Description
Patentanwälte Dipl.'Ing, E Weickmann, Dr. Ing. A. WeickmannPatent attorneys Dipl.'Ing, E Weickmann, Dr. Ing.A. Weickmann
Dipl.-Ing, H.Weickmann, DiPi.-PHys. Dr. K. FiNCKE Dipl.-Ing. R A.Weickmann, Dipl.-Chem. B. HuberDipl.-Ing, H.Weickmann, DiPi.-PHys. Dr. K. FiNCKE Dipl.-Ing. R A.Weickmann, Dipl.-Chem. B. Huber
SABM 8 MÜNCHEN 27, DENSABM 8 MUNICH 27, DEN
MÖHLSTRASSE 22, RUFNUMMER 48 3921/22MÖHLSTRASSE 22, CALL NUMBER 48 3921/22
FATIOIAI DAIRY PRODUCTS CORPORATION, 260 Madison Avenue,FATIOIAI DAIRY PRODUCTS CORPORATION, 260 Madison Avenue,
lew York, N.Y., V.St.v.A.lew York, N.Y., V.St.v.A.
Gerät zum Vereinigen von Strömen fließfähiger Nahrungsmittel Apparatus for merging streams of flowable food
Die Erfindung betrifft ein Gerät zum spiraligen Verwinden von zwei oder mehreren Strömen eines Nahrungsmittels, wie etwa Erdnußbutter, türkischer Honig oder Speiseeis. Insbesondere sollen damit Ströme von hinsichtlich !Farbe oder Geschmack-, unterschiedlichen Arten von Rahmeis, !Fruchteis, Wassereis oder dergl. miteinander verwunden werden. Das erfindungsgemäße Gerät soll dabei eine drehbare Düse aufweisen, die die Ströme verwindet und danach dem Behälter einer VerpackungBmaschine zuführt.The invention relates to a device for spiral twisting from two or more streams of a food product such as peanut butter, Turkish honey, or ice cream. In particular should therewith currents of color or taste, Different types of ice cream, fruit ice cream, water ice cream or the like are wound together. That The device according to the invention should have a rotatable nozzle which twists the currents and then the container a packaging machine.
.- 2 -' 1090 U/072S.- 2 - '1090 U / 072S
Dementsprechend besteht die Aufgabe der Erfindung in erster Linie darin, ein Gerät der genannten Art zu schaffen, das in der Lage ist, in kommerziellen Umfang große Mengen von extrudierten Strömen spiralig miteinander zu verwinden. .Accordingly, the object of the invention is in primarily in creating a device of the type mentioned which is capable of large-scale commercial use To twist quantities of extruded streams spirally together. .
Mehr im einzelnen soll ein Gerät geschaffen werden, mit dem zwei oder mehrere Ströme von Speiseeis miteinander spiralenartig verwunden werden, wenn die Ströme aus einer gemeinsamen rotierenden Düse ausgestoßen werden.More specifically, a device is to be created with which two or more streams of ice cream with each other be twisted like a spiral when the streams are ejected from a common rotating nozzle.
Eine weitere, Aufgabe der Erfindung besteht darin, einzelne glatte Durchgänge in einem Mischgerät zu schaffen, um den Durchfluß und die spiralenartige Verwindung relativ umfangreicher Ströme eines viskosen Materials, wie etwa Speiseeis, zu erleichtern.Another object of the invention is to provide individual smooth passages in a blending device around the Flow and the spiral-like twisting of relatively large flows of a viscous material, such as ice cream, to facilitate.
Eine andere Erfindungsaufgabe ist die, eine neue und einfache Vorrichtung zu schaffen, um in den Strom einer ersten Speiseeis-Sorte ein zusätzliches Nahrungsmittel, also etwa ein viskoses Geschmackingredienz oder eine weitere Speiseeis-Sorte, zu überführen, und zwar unter Steuerung der Strömung des zusätzlichen Nahrungsmittels.Another inventive task is, a new and simple one To create a device to add an additional food to the stream of a first type of ice cream, ie for example, to transfer a viscous flavor ingredient or another type of ice cream, under control the flow of additional food.
Im einzelnen galt es dabei, eine neuartige Anordnung konzentrischer Hohlschäfte zu schaffen, und einen damit zusammenwirkenden Auastoßkopf, um das zusätzliche Nahrungs-In particular, the aim was to create a novel arrangement of concentric hollow shafts and one that interacted with it Impact head to remove the additional food
1Q98U/07261Q98U / 0726
mittel in das Hauptnahrungsmittel einzuführen und gleichzeitig die. Ströme der zusätzlichen Nahrungsmittel miteinander apiralig zu verflechten.to introduce agents into the main food and at the same time the. Streams of additional foods to one another to intertwine apiralig.
In den Zeichnungen stellen dar:In the drawings show:
Pig. 1 eine Seitenansicht eines Gerätes nach der Erfindung, längs einer vertikalen Ebene teilweise aufgebrochen;Pig. Fig. 1 is a side view of an apparatus according to the invention, partly broken away along a vertical plane;
Fig. 2 eine Endansicht des Ausstoßkopfes entlang der Linie 2-2 der Pig. I;Figure 2 is an end view of the ejection head taken along the line 2-2 the Pig. I;
Fig. 3 eine Teilschnittansicht eines Gerätes entsprechend einer anderenAusführungsform der Erfindung;Fig. 3 is a partial sectional view of a device accordingly another embodiment of the invention;
Fig. 4 eine perspektivische Ansicht eines spiralig verwundenen Produktes, das mittels des Gerätes nach Fig. hergestellt wurde;Fig. 4 is a perspective view of a spirally twisted product produced by means of the device of Fig. was produced;
Fig. 5 eine fragmentarische Schnittansicht entlang der Linie 5-5 der Fig. 3;Figure 5 is a fragmentary sectional view taken along line 5-5 of Figure 3;
Fig. 6 eine Schnittansicht entlang der Linie 6-6 der Fig. 3;Figure 6 is a sectional view taken along line 6-6 of Figure 3;
Fig. 7 eine vergrößerte fragmentarische Ansicht, die eine Seite der drehbaren Ausstoßdüse der Fig. 3 zeigt;7 is an enlarged fragmentary view showing a Figure 3 shows the side of the rotatable discharge nozzle of Figure 3;
109814/0726 -Α 109814/0726 -Α
Pig. 8 eine fragmeatarischeperspektivische Ansicht des drehbaren Ausstoßendes des Gerätes nach Fig. 3; undPig. Figure 8 is a fragmentary perspective view of the rotatable ejection end of the device of Figure 3; and
Fig. 9 eine in Einzelteile aufgelöste fragmentarische Ansicht des drehbaren Ausstoßendes des Gerätes nach Pig. 3.Figure 9 is an exploded fragmentary view the rotatable ejection end of the device according to Pig. 3.
Das in den Pig. 1 und 2 zur Erläuterung der Erfindung dargestellte Gerät ist speziell eingerichtet für das spiralenartige Verwinden zweier oder mehrerer Ströme unterschiedlicher, fließfähiger Zusatzmaterialien mit dem Strom eines Hauptmaterials. Obwohl man das Gerät natürlich auch für andere Materialien verwenden kann, ist doch in ersterLinie daran gedacht, es in Verbindung mit Speiseeis zu benutzen, welches die Rolle des Hauptnahrungsmittels spielt, während etwa Sirup oder ein anderes viskoses Geschmackingredienz in dieser ersten Ausführungsform des Erfindungsgegenstandes als zusätzliches Nahrungsmittel Verwendung findet.That in the pig. 1 and 2 shown to explain the invention The device is specially designed for the spiral-like twisting of two or more streams of different, flowable additional materials with the flow of a main material. Although the device can of course also be used for can use other materials, it is primarily intended to be used in conjunction with ice cream, which plays the role of the main foodstuff, while syrup or some other viscous flavor ingredient in this first embodiment of the subject matter of the invention is used as an additional food.
In einer zweiten Ausfuhrungsform der Erfindung, die in den Pig. 3 bis 9 dargestellt ist, sind die zusätzlichen Nahrungsmittel für gewöhnlich weitere Sorten von Speiseeis unterschied licher Farben und Geschmacksarten, obwohl auch hier als zusätzliche Nahrungsmittel Sirup oder ein viskoses Geschmacksingredienz Verwendung finden kann. Im Detail wird das in Verbindung mit diesen Figuren beschrieben.In a second embodiment of the invention, which is in the Pig. 3 to 9, the additional foods are usually different from other types of ice cream lighter colors and flavors, although syrup or a viscous flavor ingredient can also be used here as additional food. This is explained in detail in Connection with these figures described.
1 Ü 9 H 1 Z1 / Π " ·> r 1 Ü 9 H 1 Z 1 / Π "·> r
Die Vorrichtung gemäß -B'ig, 1 und 2 besteht hauptsächlich aus einem Gehäuse 10 mit einer Mischkammer 11, die im Abstand Einlaß- und Auslaßöffnungen 12 und 13 aufweist, einer zweiten Kammer 14» die neben der ersten Kammer, jedoch von dieser getrennt angeordnet ist, und einer von der ersten und der zweiten Kammer abgesonderten dritten Kammer 15. Das Hauptmaterial wird durch die Einlaßöffnung in die Mischkammer eingeführt und ließt durch, diese zur Auslaßöffnung. Verschiedenartige Zusatzmaterialien werden durch die Einlaßöffnungen 16 und 17 in die zweite bzw. die dritte Kammer eingeführt.The device according to -B'ig, 1 and 2 mainly consists from a housing 10 with a mixing chamber 11, which is in Distance inlet and outlet openings 12 and 13, a second chamber 14 »which is next to the first chamber, but is arranged separately from this, and a third chamber separated from the first and second chambers 15. The main material is introduced into the mixing chamber through the inlet port and passes through it to the outlet port. Various additional materials are through the inlet ports 16 and 17 in the second and the third, respectively Chamber introduced.
Der Effekt der spiralenförmigen Yerwindung wird dadurch erreicht, daß die Zusatzmaterialien aus ihren Kammern 14 und 15 zu einem Ausstoßkopf 18 gebracht werden, der zwischen der Einlaßöffnung und der Auslaßöffnung 12 und 13 innerhalb der Mischkammer 11 drehbar angeordnet ist. Dieser Ausstoßkopf 18 besitzt zwei winkelige Ausstoßöffnungen 19 und 20, die " von seiner Drehachse beabstandet und mit ihren Öffnungen gegen die Auslaßöffnung der Mischkammer gerichtet sind, so daß das aus den Ausstoßöffnungen tretende Material in derselben Richtung fließb wie das Ilauptmaterial, das von der-Einlaßöffnung zur Auslaßöffnung der Mischkammer strömt.The effect of the spiral-shaped Yerwindung is achieved in that the additional materials from their chambers 14 and 15 are brought to an ejection head 18 which is located between the inlet port and the outlet port 12 and 13 within the Mixing chamber 11 is rotatably arranged. This discharge head 18 has two angled discharge openings 19 and 20, the " spaced from its axis of rotation and with their openings are directed towards the outlet opening of the mixing chamber, so that the material emerging from the discharge openings in in the same direction as the main material flowing from the inlet opening flows to the outlet opening of the mixing chamber.
ine Verbindung zwischen der zweiten und der dritten Kammer, sowie den Öffnungen im Ausstoßkopf wird durch Hohlschäfte 21 und 22 gebildet, die vorzugsweiae gleichzeitig ala '.-/eilen dieumi, um ilen Aueotoßlcopf drehbar su halbem»A connection between the second and the third chamber, as well as the openings in the ejection head, is established by hollow shafts 21 and 22 formed, which are preferably at the same time ala '.- / hurry dieumi to turn around ilen Aueotoßlcopf su half »
3 -Q-U a 1 L ! ην ν 6 ■ - ■3 -QU a 1 L! ην ν 6 ■ - ■
„. 6 „ ORlG^AL INSPECTS". 6 "ORlG ^ AL INSPECTS
Diese Schäfte sind üblicherweise konzentrisch zueinander und zur Rotationsachse des Ausstoßkopfes angeordnet. 'These shafts are usually arranged concentrically with one another and with the axis of rotation of the ejection head. '
Beim dargestellten Beispiel ist das Gehäuse IO von ' hauptsächlich zylindrischer Gestalt. Die Kammern werden durch axial gefluchtete Gehäuseabschnitte begrenzt und durch radial angeordnete Wände 23 und 24 voneinander getrennt. Die Auslaßöffnung 13 befindet sich am einen Ende des Gehäuses, dessen anderes Ende von einer weiteren radialen Wand 25 abgeschlossen wird. Das ganze Gehäuse ist so gestaltet, daß es innerhalb einer Verpackungsmaschine für Speiseeis montiert werden kann und zwar mit geeigneten Verbindungen zu den verschiedenen Einlaßöffnungen zürn Einfüllen der verschiedenen Materialien in die entsprechenden Kammern.In the example shown, the housing IO is from ' mainly cylindrical in shape. The chambers are delimited by axially aligned housing sections and by radially arranged walls 23 and 24 separated from each other. The outlet opening 13 is located at one end of the housing, the other end of which is closed by a further radial wall 25. The whole case is designed so that it can be mounted inside a packaging machine for ice cream with suitable Connections to the various inlet ports for filling the various materials into the respective ones Chambers.
Der Endteil des Gehäuses, der die Mischkammer 11 bildet, W ist eine Röhre 26 von hauptsächlich zylindrischerForm, die sich gegen die Auslaßöffnung 13 hin leicht konisch ver'üngt. ■^ie Einlaßöffnung 12 wird von einem radial abstehenden Rohrteil 27 gebildet, das mit dem Hauptteil des Abschnittes ein einheitliches Bauteil darstellt. Der danebenliegende Gehäuseteil, der die zweite Kammer bildet, ist ein T-Stück mit einem zylindrischen Teil 28 von gleicher Weite wie die die Mischkammer bildende Röhre und mit einem radial sich erstreckenden Rohrteil 29, das die Einlaßöffnung 16 bildet. Der die zweite Kammer bildende Gehäuseabschnitt grenzt anThe end part of the housing, which forms the mixing chamber 11, W is a tube 26 of mainly cylindrical shape which tapers slightly conically towards the outlet opening 13. ■ ^ he inlet opening 12 is formed by a radially protruding pipe part 27, which is a unitary component with the main part of the section. The adjacent housing part, which forms the second chamber, is a T-piece with a cylindrical part 28 of the same width as the tube forming the mixing chamber and with a radially extending tube part 29 which forms the inlet opening 16. The housing section forming the second chamber is adjacent
10 9 8 14/ f) 72610 9 8 14 / f) 726
— 7 —- 7 -
das benachbarte. Ende des Gehäuseabschnittes an, der die Mischkammer darstellt, und beide Absdnitte sind in dieser Lage durch eine mit einem Ansatz versehene Mutter 30 miteinander verbunden, wobei die Mutter auf einAußengewinde am zweiten Gehäuseabschnitt aufgeschraubt ist und sich mit ihrem Ansatz gegen einen Plansch 31 legt, der vom ersten Gehäuseabschnitt radial absteht.the neighboring. At the end of the housing section that represents the mixing chamber, and both sections are connected to one another in this position by a nut 30 provided with a shoulder, the nut being screwed onto an external thread on the second housing section and its shoulder lying against a surface 31 which from the first G e häuseabschnitt projects radially.
Ein dritter Gehäuseabschnitt bildet die dritte Kammer 15. Er ist ebenfalls einT-Stück mit einem zylindrisehen Teil 32 von gleicher Weite wie die anderen beiden Abschnitte und mit einem radial sich erstreckenden Rohrteil 33» der dieEinlaßöffnung 17 bildet. Sein dem zweiten Gehäuseabschnitt abgewandtes Ende trägt eine radial sich erstreckende äußere Abschlußwand 25. Der zweite und der dritte Gehäuseabschnitt werden in axialer Ausrichtung durch eine mit einem Ansatz versehene Mutter 34 gehalten, die auf ein Außengewinde am dritten Gehäuseabschnitt aufgeschraubt ist und sich mit ihrem Ansatz gegen einen Flansch 35 am zweiten Gehäuseabschnitt legt. Eine radial verlaufende Wand 24» welche die sweite und die dritte Kammer voneinander trennt, ist in dem dem dritten Gehäuseabschnitt gegenüberliegenden Ende des zweiten Gehäuseabschnittes angeordnet. In gleicher Weise trennt die radial verlaufende v/and 23 die zweite Kammr von der Mischkammer. Sie ist in dem dem zweiten Gehäuseabschnitt gegenüberliegenden Ende des ersten Gehäuseabschnittes angeordnet.A third housing section forms the third chamber 15. It is also a T-piece with a cylindrical part 32 of the same width as the other two sections and with a radially extending tubular part 33 »of the inlet port 17 forms. Its the second housing section remote end carries a radially extending outer End wall 25. The second and third housing sections are axially aligned by a with a shoulder provided nut 34 held, which is screwed onto an external thread on the third housing section and with their approach against a flange 35 on the second housing section lays. A radially extending wall 24 »which separates the second and third chambers from one another is shown in FIG the end of the second housing section opposite the third housing section. In the same way separates the radially extending v / and 23 the second Kammr from the mixing chamber. It is in the second housing section arranged opposite end of the first housing section.
10 98 "U/(17 2S10 98 "U / (17 2S
17513E117513E1
Der Hohlschaft 22, der dazu dient, Material von der dritten Kammer zum Ausstoßkopf 18 zu überführen, liegt koaxial zu den verschiedenen Gehäuseabschnitten, er erstreckt sich von Äußeren des dritten Gehäuseabschnittes 32 durch die radialen ;/äride 25» 24 und 23 und endet an einer Stelle in der Mitte zwischen der Einlaßöffnung und der Auslaßöffnung 12 und 13 der Mischkammer 11. Das Endteil 36, das ^ durch die Abschlußwand aus dem Gehäuse herausragt, ist nicht hohl, sondern aus vollem Material und in einem in der Abschlußwand angeordneten Lager 37 gelagert, ■^in geeignetes Dichtungsmittel, also etwa ein O-Ring 38, verhindert das Auslaufen von Flüssigkeit zwischen dem Lager und dem Hohlschaft. Das herausragende endteil ist mit einer Universalkupplung verbunden, über die eine drehungserzeugende Antriebskraft auf den Hohlschaft übertragen werden kann. Das andere Ende des Hohlschaftes, das sich von der dritten Kamer in die Mischkammer erstreckt, besteht aus einer Röhre, die teleskopartig über den nichtiiohlen End teil 36 gesteckt und an diesem angeschweißt ist. nie Röhre ist rundum geschlossen, abgesehen von einer radialen Öffnung 40 innerhalb der dritten Kammer. Durch diese radiale Öffnung kann das in der dritten Kummer befindliche Material in den Hohlschaft eintreten und entlang der Röhre desselben zum Ausstoßkopf 18 fließen.The hollow shaft 22, which serves to transfer material from the third chamber to the ejection head 18, is coaxial with the various housing sections; Place in the middle between the inlet opening and the outlet opening 12 and 13 of the mixing chamber 11. The end part 36, which protrudes through the end wall from the housing, is not hollow, but made of solid material and mounted in a bearing 37 arranged in the end wall, A suitable sealant, such as an O-ring 38, prevents liquid from running out between the bearing and the hollow shaft. The protruding end part is connected to a universal coupling by means of which a rotational drive force can be transmitted to the hollow shaft. The other end of the hollow shaft, which extends from the third camera into the mixing chamber, consists of a tube which is telescoped over the non-hollow end part 36 and is welded to it. The tube is never closed all around, apart from a radial opening 40 within the third chamber. Through this radial opening, the material located in the third worm can enter the hollow shaft and flow along the tube of the same to the ejection head 18.
Der zweite Hohlschaft 21 für Materialförderung in der zweiten Kammer 14 umfaßt eine Röhre 41 j die kotiEonii ischThe second hollow shaft 21 for conveying material in the second chamber 14 comprises a tube 41 j the kotiEonii ik
1 0 9 8 1/,/ 0 ? 2 61 0 9 8 1 /, / 0? 2 6
BAD ORIGINALBATH ORIGINAL
und mit radialem Abstand um den ersten Hohlschaft herum angeordnet ist. An ihrem dem Ausstoßkopf abgewandeten Ende ist die Röhre des zweiten Hohlschaftes in eine Überwurfmutter 42 eingeschraubt, die ihrerseits in eine Manschette 43 eingeschraubt ist, welche eine mit der Außenwand des ersten Hohlschaftes 22 verschweiß be Nabe 44 aufweist, sowie; radiale Öffnungen 45> -He eine Verbindung zwischen der zweiten Kammer und dem Inneren der Manschette, der Überwurfmutter und der Röhre des zweiten Hohlschafbes herstellen. Me Manschette 43 grenzt axial an das eine Ende eines Lagerringes 46? der die Überwurfmutter 42 drehbar aufnimmt und seinerseits drehbar in einem Ring 47 gelagert ist, der an der Innenwandung des ersten Gehäuseabschnittes angeschweißt' ist. Eine nach außen Kgende radiale Planke des Lagerringes 46 grenzt an das axial weisende Ende eines Gehäuseringes, um die Teile in axialer Richtung festzulegen. Der Gehäusring und die Lagerringe bilden zusammen die Wand 24 zwischen der Mischkammer und der zweiten Kammer.and at a radial distance around the first hollow shaft is arranged. At its end facing away from the discharge head is the tube of the second hollow shaft in a union nut 42 screwed, which in turn is screwed into a sleeve 43, which is one with the outer wall of the first Hollow shaft 22 welded be hub 44, as well as; radial openings 45> -He made a connection between the second chamber and the interior of the cuff, the union nut and the tube of the second hollow sheep. Me sleeve 43 axially adjoins one end of a bearing ring 46? which receives the union nut 42 rotatably and in turn is rotatably mounted in a ring 47 which is attached to the inner wall of the first housing section welded on '. An outward facing radial plank of the bearing ring 46 is adjacent to the axially facing end a housing ring to fix the parts in the axial direction. The housing ring and the bearing rings together form the wall 24 between the mixing chamber and the second chamber.
Die beiden fiohlschäfte 21 und 22 aind durch Anliegen der Manschette 43 auf dem zweiten Ilohlschaft am Lagerring 46 axial festgelegt. Um diese Anlage zu bewerkstelligen, legt sich eine um den ersten Ilohlschaft gewiekelte Druckfeder 48 mit ihrem einen Ende gegen die Nabe 44 der Manschette und mit ihrem anderen Ende gegen die gegenüberliegende Wand 2.4, die die zweite und dritte Kammer 14 und 15 voneinanderThe two hollow shafts 21 and 22 are axially fixed on the bearing ring 46 by the sleeve 43 resting on the second hollow shaft. To accomplish this system, a compression spring 48 wrapped around the first Ilohlschaft lays with its one end against the hub 44 of the sleeve and with its other end against the opposite wall 2.4 that separates the second and third chambers 14 and 15 from one another
1098U/D726 BAD original1098U / D726 BAD original
• 10 -• 10 -
trennt. Der erste Hohlschaft 22 erstreckt sich lose durch.separates. The first hollow shaft 22 extends loosely through.
eine zentrale Öffnung in dieser Wand. Das Austreten von Flüssigkeit zwischen dem Hohlschaft 22 und der 'Wand 24 wird durch Dichtungsmittel verhindert, etwa durch einen O-Ring 49» der den Hohlschaft 22 umgbit und in einer Nut liegt, die in der Wand 24, nach innen v/eisend, angebrachta central opening in this wall. The leakage of liquid between the hollow shaft 22 and the wall 24 is prevented by sealing means, for example by an O-ring 49 »which surrounds the hollow shaft 22 and in one Groove is located in the wall 24, v / ironing inwards
Der Ausstoßkopf 18 besitzt in dieser Ausführung am einen .Ende im wesentlichen eine zylindrische Gestalt. Lr ist auf das angrenzende Ende des Rohres des zweiten ' · Hohlschaftes 21 aufgeschraubt. Das Innere dieses Rohres · ist über einen Durchlaß 50 mit der einen Ausstcßjffnung 19 verbunden. Das angrenzende Ende des ersten Hohlschaftes 22 ist in eine zentrale Öffnung im Ausstoßkopf 18 eingepreßt und steht über einen weiteren Durchlaß 51 mit der anderen Ausstoßöffnung 20 in Verbindung. Vorzugsweise sind an den Ausstoßkopf 18 zwei Hülsen 52 und 53 angeschweißt, die eine Verlängerung der entsprechenden Ausstoßöffnungen bilden. Aus alledem geht hervor, daß die Hohlschäfte 21 und 22 einen ersten und einen zweiten Durchlaß bilden, um die Ströme aus den Kammern 14 und 15 zu den Ausstoßöffnungen 19 und 20 zu leiten. Ein dritter Durchlaß wird durch den ringförmigenAbstarid zwischen der Außenfläche des Ausstoßkopfes 18 und der gegenüberliegenden Innewnad der Röhre 26 gebildet. Wenn sich die Hohlschäfte drehen, dann verwinden sich die aus dem ersten und den aweiten DurchlaßThe ejection head 18 has in this embodiment at one .End a substantially cylindrical shape. Lr is screwed onto the adjacent end of the tube of the second hollow shaft 21. The interior of this tube is connected to the one discharge opening 19 via a passage 50. The adjoining end of the first hollow shaft 22 is pressed into a central opening in the ejection head 18 and is connected to the other ejection opening 20 via a further passage 51. Preferably, two sleeves 52 and 53 are welded to the ejection head 18, which form an extension of the corresponding ejection openings. From all of the above, it can be seen that the hollow shafts 21 and 22 define first and second passages for directing the flows from the chambers 14 and 15 to the discharge openings 19 and 20. A third passage is defined by the annular spacing between the outer surface of the ejection head 18 and the opposing interior of the tube 26 . When the hollow shafts rotate, then the first out of the passage and the twist aweiten
1098U/072S1098U / 072S
■-■ 11 -■ - ■ 11 -
austretenden Strömen in spiralenförmiger ^eise "bei ihrer Vereinigung mit dem Strom aus dem dritten Durchgang.exiting currents in a spiral shape at their Merging with the stream from the third round.
Es leuchtet ein,daß nach Vereinigung der Teile und nach Herbeiführung einer Strömung des Hauptmaterials von der Einlaßöffnung 12 durch die Mischkammer 11 zur Auslaßöffnung 13 in diese Hauptströmung eine oder mehrere spiraletiförmige Ströme verschiedener Materialien eingeführt werden können, indem man mittels der Kupplung 39 die beiden Hohlsehäfte 21 und 22 dreht und gleichzeitige Ströme zusätzlicher Materialien durch die zweite und die dritte Kammer 14 und 15 entlang dem Inneren der entsprechenden Hohlsehäfte zu deren Ausstoßöffnungen 19 und 20 fließen läßt. Das Material in den beiden Kammern kann je nach ¥unsch unterschiedlich oder gleich sein, und das spezielle Muster der spiraligen Verwindung kann durch Einstellung der Drehgeschwindigkeit der Hohlsehäfte oder der Menge des im Haupt strom geführten Hauptmaterials pro Zeiteinheit verändert werden. Palis gewünscht, kann auch die Menge des . durch die zweite und die dritte Kamer fließenden Materials in der Zeiteinheit verändert werden.It is evident that after the union of the parts and afterwards Causing the main material to flow away from the Inlet opening 12 through the mixing chamber 11 to the outlet opening 13 in this main flow one or more spiral-shaped Streams of different materials can be introduced by means of the coupling 39 the two Hollow shafts 21 and 22 rotates and simultaneous flows of additional materials through the second and third Chamber 14 and 15 along the interior of the respective one Hollow shafts flow to their discharge openings 19 and 20 leaves. The material in the two chambers can vary depending on the ¥ ¥ ¥ un be different or the same, and the specific pattern of spiral twist can be adjusted by adjusting the rotation speed the hollow shafts or the amount of main material carried in the main stream per unit of time will. Palis desired, the amount of. material flowing through the second and third cameras can be changed in the time unit.
Die beschreibene Ausführungsform der Erfindung ist, ohne darauf unbedingt beschränkt zu sein,, in erster Linie dafür bestimmt, in einen Strom viskosen Speiseeises ein weniger viskoses GeschmacksIngredienz spiral einzuwinden. Die Ausführungsform, wie sie in den Fig. 3 bis 9 dargestelltThe embodiment of the invention described is, without being necessarily limited thereto, primarily intended to be poured into a stream of viscous ice cream Winding in less viscous flavor ingredient in a spiral. The embodiment as shown in FIGS
,. w .109814/0726 BAD OFUGINAL,. w .109814 / 0726 BAD OFUGINAL
ist, ist mehr dafür gedacht, zwei oder mehrere Ströme viskosen Speiseeises miteinander spiralig zu verwinden, wenngleich auch hierbei einer oder mehrere der Ströme aus einem weniger viskosen Stoff gebildet sein können, z.B. einem GeschmacksIngredienz. In der Ausführung gemäß Eig. 3 werden drei Ströme gesonderter Materialien, etwa solche aus Speiseeis, unterschiedlicher Färbungen oder aus Speiseeis und einem Geschmacksingredienz, durch eine Wandung eines, sich vertikal erstreckenden Gehäuses 110 eingeführt, und zwar jeder Strom durch eine der voneinander getrennten Eirikßöffnungen 111, 112 und 113. Jede dieser Einlaßöffnungen steht in flüssigkeitsleitender Verbindung mit je einer von drei zugehörigen ringförmigen Kammern 114, 115 und 116, von denen jeweils der entsprechende Speiseeisstrom durch separate und besondere Durchlässe zu einer drehbaren Ausstoßdüse 121 fließt, die an ihrem unteren Ende drei separate Ausstoßöffnungen 118, 119 und besitzt (vgl. Pig. 6). Wenn die drei Ströme aus der sich drehenden Ausstoßdüse ausgetreten sind, fließen sie nach unten zusammen und werden aufgrund der Drehung der gemeinsamen Ausstoßdüse miteinander spiralig verwunden. is, is more intended for two or more streams of viscous To twist ice cream with each other spirally, although here too one or more of the currents from a less viscous substance, e.g. a flavor ingredient. In the execution according to Prop. 3 are three streams of separate materials, such as those made from ice cream, different colors or made of ice cream and a flavored ingredient, through a wall of a vertically extending housing 110 introduced, each stream through one of the separate egg openings 111, 112 and 113. Each of these Inlet openings are in fluid-conducting connection with one of three associated annular chambers 114, 115 and 116, of which the corresponding ice cream flow through separate and special passages to a rotatable ejection nozzle 121 flows, which at its lower end three separate ejection openings 118, 119 and possesses (see. Pig. 6). When the three streams have exited the rotating discharge nozzle, flow they fall together and are twisted together spirally due to the rotation of the common discharge nozzle.
Wie im ersten Ausführungsbeispiel ist auch hier das Gehäuse 110 im wesentlichen von zylindrischer Gestalt. Die Kammern 114» 115 und 116 werden von axial ausgerichteten Gehäuseteilen gebildet, die durch radial angeordnete, inAs in the first embodiment, the housing 110 is also essentially cylindrical in shape. the Chambers 114 »115 and 116 are formed by axially aligned housing parts, which are formed by radially arranged, in
1098U/fl7261098U / fl726
■ - 13 -■ - 13 -
ihrer Gesamtheit mit 122, 123 und 124 "bezeichnete Wandteile voneinander getrennt siid. Die Oberseite des Gehäuses wird von einer radialen Endwand 125 abgeschlossen. Das untere Gphäuseende bildet eine Auslaßöffnung 126, durch die ein stetiger Strom von spiralig verwunden-em Speiseeis ο»dgl. austritt. Die Einlaßöffnungen 111, 112 und 113 sind mit drei gesonderten Versorgungsquellen, also etwa drei Eismaschinen (nicht dargestellt) verbunden. Das Gehäuse ist so ausgebildet, daß es mit seinem Ausstoß- ™its entirety by 122, 123 and 124 'designated wall parts from each other siid separated. The top of the housing is closed by a radial end wall 125th D a s lower G p häuseende forms an outlet port 126 through which of spirally wound-em a steady stream of ice cream ο »like. exits. The inlet ports 111, 112 and 113 or about three ice machines are equipped with three separate supply sources (not shown). The housing G e is formed such that it with its ejection ™
ende mittels einer Mutter an einer Verpackungsmaschine für Spieiseeis (nicht dargestellt) montiert werden kann.end by means of a nut on a packaging machine for ice cream (not shown) can be mounted.
In der vorliegenden Ausbildung wird das Gehäuse 110 aus drei axial aneinanderstoßenden Abschnitten gebildet. Der obere Abschnitt, der die gammer 114 dargestellt, besitzt die Form eines T-Stückes mit einem vertikalen Zylinderstück 127 uad einem radial abstehenden Rohrstück 128, welches die erste Einlaßöffnung 111 bildet. Die oben- (( liegende radiale Endwand 125 bildet den oberen Abschluß der ersten Kammer, während das radiale Wandteil 122 die erste Kammer unten abschließt und von der darunterliegenden zweiten Kammer 115 trennt. An das untere Ende des vertikalen Zylinderstückes 127 des die erste Kammer bildenden T-3-fcückes schließt sich ein versetztes Kreuteil 130 an, das den zweiten Abschnitt der Gehäuse 110 bildet. Es besitzt ein vertikales ZylinderstUck 129 an seinem oberen Ende, sowie ein oberen t radial ubnbehendem Rohrstiick 131,In the present embodiment, the housing 110 is formed from three axially abutting sections. The upper portion shows the gammer 114 has the fo rm of a T-piece with a vertical cylindrical portion 127 uad a radially projecting tubular piece 128 which forms the first inlet opening 111th The upper radial end wall 125 forms the upper end of the first chamber, while the radial wall part 122 closes the first chamber at the bottom and separates it from the second chamber 115 below -3-fcückes closes an offset Kreuteil 130 of which forms the second portion of the housing 110. es has a vertical cylinder stucco 129 at its upper end, and an upper radially t ubnbehendem Rohrstiick 131
'i.09'8 j l /fi Ί y i- 'i.09'8 j l / fi Ί y i-
BAD ORIGINALBATH ORIGINAL
-H--H-
das die zweite Einlaßöffnung 112 bildet. Um den T-stückigen Abschnitt mit dem oberen Ende des Kreuzteiles 130 zu verbinden, ist auf das untere Ende des T-Stückes eine mit einem Ansatz versehene Mutter 132 aufgeschraubt, deren Ansatz 134 an einer radialen Manschette 135 abgestützt ist, die starr vom oberen Ende des vertikalen Zylinderstückes 129 des Kreuzteiles 130 absteht. Der radiale Wandteil 122, der den ersten und den zweiten Gehäuseabschnitt voneinander trennt, ist im Inneren des zweiten Abschnittes gegenüber dem unteren Ende des ersten Abschnittes festgemacht und wird später näher beschrieben.which forms the second inlet opening 112. Around the T-piece with the upper end of the cross member 130 to connect, a nut 132 provided with a shoulder is screwed onto the lower end of the T-piece, the shoulder of which 134 is supported on a radial sleeve 135 which is rigidly attached to the upper end of the vertical cylinder piece 129 of the cross part 130 protrudes. The radial wall portion 122 separating the first and second housing sections from one another separates is fastened inside the second section opposite the lower end of the first section and will be described later.
obere Zylinderstück 129 des Kreuzteiles 130 ist von gleichem Durchmesser wie das vertikale Zylinderstück 127 des T-stückigen Abschnittes zwischen der oberen Manschette 135 an seinem oberen Ende und einer weiteren Manschette 137 an seinem unteren Ende. Knapp oberhalb der unteren Manschette 137 befindet sich die dritte Einlaßöffnung 113, die von einem radial abstehenden Rohrteil 139 bgebildet ist, das mit dem Kreuzteil aus einem Stück besteht. Die zweite Kammer 115 ist von der dritten Kammer 116 durch das radiale Wandteil 123 getrennt, das im Inneren des Zylinderstückes zwischen der zweiten und der dritten Einlaßöffnung 112 und 113 angeordnet ist und im Einzelnen noch beschrieben wird. Das./andteil 123 bildet das obere Ende der dritten Kammer 116, die sich hinab bis zum radialen Wandteil 124 er-upper cylinder piece 129 of the cross part 130 is of the same diameter as the vertical cylinder piece 127 of the T-piece section between the upper cuff 135 at its upper end and a further cuff 137 at its lower end. Just above the lower cuff 137 is the third inlet opening 113, which is from a radially protruding tubular part 139 is formed, which consists of one piece with the cross part. The second chamber 115 is separated from the third chamber 116 by the radial wall part 123, which is located inside the cylinder piece between the second and the third inlet opening 112 and 113 is arranged and will be described in detail will. Das./andteil 123 forms the upper end of the third chamber 116, which extends down to the radial wall part 124
- 15 1 O 9 Si \ L I π 7 2ί} - 15 1 O 9 Si \ LI π 7 2ί}
. 17.51 3E-1. 17:51 3E-1
streckt, der in Achsrichtung an die Manschette 137 angrenzt, welche sich am unteren Ende des ZylinderStückes 129 des Kreuzteiles 130 befindet.stretches, which is adjacent to the cuff 137 in the axial direction, which is located at the lower end of the cylinder piece 129 of the cross part 130.
An das untere Ende des Kreuzteiles 130 schließt sich ein vertikaler Zylinder 141 an, der den dritten Abschnitt des Gehäuses bildet. Er besitzt einen Flansch 142, der sich an seinem oberen Ende radial nach außen erstreckt und an der Manschette 137 am unteren Ende des Kreuzteiles 130 anliegt. Auf die Manschette 137 ist eine mit Ansatz versehene Mutter 143 aufgeschraubt, die mit ihrem nach innen ragenden Ansatz 144 den Plansch 142 am oberen Ende des ZYLINDERS 3_41 erfafäfc und diesen damit am unteren Ende des Kreuzteiles befestigt. Am unteren Ende des Zylinders 141 ist ein gleichartiger radialer Plansch 147 vorgesehen, der mit der Mutter zusammenwirkt, die das Gehäuse an der Verpackungsmaschine befestigt· At the lower end of the cross part 130 includes vertical cylinder 141 which forms the third section of the Housing forms. He has a flange 142, which is attached to its upper end extends radially outward and at the Cuff 137 rests against the lower end of the cross part 130. The cuff 137 is provided with a shoulder Nut 143 screwed on, with her protruding inward Approach 144 the puddle 142 at the upper end of the CYLINDERS 3_41 acquired and this thus at the lower end of the cross part attached. At the lower end of the cylinder 141, a similar radial flange 147 is provided, which with the nut cooperates, which fixes the housing to the packaging machine
: .■"■ : . ■ "■
Im Gehäuse 110 sind erfindungsgemäß neuartige Mittel vorgesehen, um voneinander getrennteDurchgänge 145» 148 und 149 zu schaffen, die sich in Iängsrichtung durch das Gehäuse von den Kammern 114» 115 und 116 zu den voneinander getrennten Ausstopöffnungen 118, 119 und 120 erstrecken, Der erste Durchgang 145 für das erste Material wird gebildet von der Hälfte eines inneren Hohlschaftes I46; der zweite Durchgang 148 für das zweite Material wird von der anderen Hälfte des Holhschaftes 146 gebildet; den dritten Durchgang 149In the housing 110, novel means are provided according to the invention to create separate passages 145 »148 and 149 to create that extends in the longitudinal direction through the housing from chambers 114 »115 and 116 to the separate ones Stopping openings 118, 119 and 120 extend, the first passage 145 for the first material is formed by half of an inner hollow shaft I46; the second passage 148 for the second material is from the other half formed of hollow shaft 146; the third pass 149
10981 Λ /07 2.610981 Λ / 07 2.6
- 16 -- 16 -
für das dritte Material bildet der radiale Zwischenraum zwischen dem inneren Hohlschaft 146 und einem äußeren koaxialen Hohlschaft 150. Auf diese Weisejwird gemäß der Erfindung der Fluß kontinuierlicher Ströme viskosen Materials hergestellt, der jeweils von einer entsprechenden Einlaßöffnung durch die jeweils zugehörige Kammer und den besonderen Durchgang zu der entsprechenden Öffnung 118, 119 und an der Unterseite der drehbaren Ausstoßdüse 121 führt.for the third material, the radial gap forms between the inner hollow shaft 146 and an outer one coaxial hollow shaft 150. In this way, according to FIG Invention of the flow of continuous streams of viscous material produced, each from a respective inlet port through the respective associated chamber and the special passage to the corresponding opening 118, 119 and leads on the underside of the rotatable discharge nozzle 121.
Zu dem genannten Zweck ist der mit den Durchgängen 145 und 148 versehene Hohlschaft 146 koaxial zu denGehäuseabschnitten angeordnet. Er erstreckt sich in Längsrichtung von der ersten Kamer 114 am oberen Ende des Gerätes bis hinab zu der Ausstoßdüse 121. Am oberen Ende des Hohlschaftes ist eine Endplatte 152 befestigt, von der aus sich ein Achsstummel 154 nach oben durch ein Lager 155 in der radialen Endwand 125 des T-stückigen Gehäseabschnittes erstreckt. Ein O-Ring 156 umgibt den Achsstummel und verhindert das Ausfließen von Material aus der ersten Kammer 114 und aus dem Gehäuse. Das obere Ende des Achsstummels, das über das Gehäuse hinaussteht, ist mit einer Universalkupplung 158 verbunden, über die eine Antriebskraft zum Drehen des Achsstummels 154 und des Hohlschaftes 146 übertragen werden kann. Der Letztere ist im Gehäuse in verschiedenen Lagern drehbar angeordnet, von denen ein oberes Lager 159 in einer Öffnung des radialen Wandteiles 122 zwischen der ersten undFor the stated purpose, the hollow shaft 146 provided with the passages 145 and 148 is coaxial with the housing sections arranged. It extends in the longitudinal direction from the first camera 114 at the upper end of the device downwards to the discharge nozzle 121. At the upper end of the hollow shaft, an end plate 152 is attached, from which an axle stub 154 extends upward through a bearing 155 in the radial End wall 125 of the T-piece housing section extends. An O-ring 156 surrounds the stub axle and prevents this Flow of material out of the first chamber 114 and out of the housing. The top of the stub axle that goes over the Housing protrudes, is with a universal coupling 158 connected, via which a driving force for rotating the stub axle 154 and the hollow shaft 146 are transmitted can. The latter is rotatably arranged in the housing in various bearings, of which an upper bearing 159 in one Opening of the radial wall portion 122 between the first and
1098U/0726 - 17 -1098U / 0726 - 17 -
der zweiten Kammer ruht. Ein äußerer 0-R.ing 160 umgibt die Außenseite des Lagers an dessen Berührungsstelle mit einer an der Außenwand des Hohlschaftes 146 befestigten Manschette 163. Ein weiterer O-Ring 161 mit kleinerem Durchmesser umgibt das Äußere des Hohlschaftes 146, um diesen gegen das Lager abzudichten und damit ein Hinüberflieeßen von Material von der ersten in die zweite Kammer und umgekehrt zu verhindern. ^the second chamber rests. An outer 0 ring 160 surrounds the Outside of the bearing at its point of contact with a Cuff 163 attached to the outer wall of the hollow shaft 146. Another O-ring 161 with a smaller diameter surrounds the exterior of the hollow shaft 146 in order to protect it against the Sealing bearings and thus the overflow of material from the first to the second chamber and vice versa. ^
Um im Inneren des Hohlschaftes 146 zwei voneinander getrennte Durchgänge 145 und 148 zu schaffen, ist ein !Peiler 162 (Pig. 5) in Form einer länglichen Platte vorgesehen, der sich zwischen zwei diametral gegenüberliegenden Seiten der Innenwand des Hohlschaftes erstreckt. Das obere Ende des Teilers 162 grenzt an die obere Endplatte 152 des Hohlschaftes 146 und erstreckt sich über dessen, ganze Länge, um an einem unteren Ende 164 (Fig. 3) abzuschließen, das ä sich im unteren !Dell der Ausstoßdüse befindet.In order to create two separate passages 145 and 148 inside the hollow shaft 146, a direction finder 162 (Pig. 5) in the form of an elongated plate is provided which extends between two diametrically opposite sides of the inner wall of the hollow shaft. The upper end of the divider 162 is adjacent to the upper end plate 152 of the hollow shaft 146 and extends over its whole length to complete at a lower end 164 (Fig. 3), which like in the lower! Dell is the discharge nozzle.
Hin eine flüssigkeitsleitende Verbindung zwischen der alles umgebenden ersten Kammer 114 und dem Durchgang 145 herzustellen, sind radiale öffnungen 165 vorgesehen (Fig. 3). Diese liegen im Winkelabstaad voneinander in der Außenwand des Hohlsehaftes 146 unterhalb des Wandteiles 122 und an der entgegengesetzten Seite der Zyllnderwandung zum Überführen dee zweiten Materials von der zwei ten Ring-Towards a fluid connection between everything To produce the surrounding first chamber 114 and the passage 145, radial openings 165 are provided (FIG. 3). These are angularly spaced from one another in the outer wall of the hollow shaft 146 below the wall part 122 and on the opposite side of the Zyllnderwandung to Transferring the second material from the second ring
7 28 ~ lS."'7 28 ~ lS . "'
kammer in den zweiten Durchgang 148,chamber in the second passage 148,
Zur Bildung der dritten Kammer 116 ist der als Röhre ausgebildete zweite Hohlschaft 150 konzentrisch und mit radialem Abstand zum ersten Hohlschaft 146 um den letzteren herum im unteren Ende des Gehäuses 110 angeordnet. Die dritte Kammer ist der Raum zwischen dem Gehäuse und dem äußeren Hohlschaft 150 in seiner axialen Ausdehnung vom oberen radialen Wandteil 123 zu dem unteren radialen Wandteil 124· ISa das dritte Material aus der dritten Kammer 116 in den dritten, durch den zylindrischen Raum zwischen dem äußeren und dem inneren Hohlschaft gebildeten Durchgang 149 zu bringen, sind in der Außenwand des zweiten Hohlschaftes radiale öffnungen 167 zwischen seinen Flanschen angeordnet. Auf diese Weise fließt das dritte Material in das Innere des zweiten Hohlschaftes und in den Raum um den ersten Hohlschaft 146.To form the third chamber 116, the second hollow shaft 150, designed as a tube, is concentric and with radial distance from the first hollow shaft 146 to the the latter arranged around in the lower end of the housing 110. The third chamber is the space between the housing and the outer hollow shaft 150 in its axial extent from the upper radial wall part 123 to the lower radial wall part 124 · ISa the third material from the third chamber 116 in the third, through the cylindrical To bring space between the outer and inner hollow shaft passage 149 formed are in the outer wall of the second Hollow shaft radial openings 167 arranged between its flanges. This is how the third material flows into the interior of the second hollow shaft and into space around the first hollow shaft 146.
Der erste und der zweite Hohlschaft sind miteinander rerbunden und drehen sich als eine Einheit, zu welche» Zweck ein Flansch 168 am Oberende des zweiten Hohlschaftee 150 auf eine Manschette 169 aufgeschraubt ist, die auf den ersten Hohlschaft 146 aufgeschweißt ist. Ein Abstandebiook 172 von begrenztem Umfang ist in de» Ringepalt zwischen din Hohleohäften. 146 und 150 angeordnet und an eine« der Hohlschäfte befestigt, um deren gegeneeitige konsentrieohe Lage festzulegen. Die verbundenen Hohlachttfte drehen lioh in desThe first and the second hollow shaft are connected to one another and rotate as a unit, for the purpose of which a flange 168 at the top of the second hollow shaft 150 opens a sleeve 169, which is welded onto the first hollow shaft 146, is screwed on. A Distance Biook 172 of limited size is in the ring gap between din Hollow halves. 146 and 150 and attached to one of the hollow shafts attached to their mutual consentrieohe position to be determined. The connected hollow shafts turn lioh in the
1098U/07281098U / 0728
-IS--IS-
Lager 159 und in einem unteren Flanschlager 170, das den Hohlsehaft umgibt und auf einem Ring 171 ruht, der im Inneren des zylindrischen Gehäuseteils 141 angeschweißt ist. Der nach außen ragende Flansch des Lagers 170 grenzt an das obere Ende des Ringes 171. Über dem Lagerflansch befindet sich eine nach außen ragende Schulter an dem mit dem zweiten Hohlschaft in einem Stück gefertigten Flansch HO.Bearing 159 and in a lower flange bearing 170, the surrounds the hollow shaft and rests on a ring 171, which in the Inside the cylindrical housing part 141 is welded. The outwardly protruding flange of the bearing 170 is adjacent to the upper end of the ring 171. Above the bearing flange there is an outwardly protruding shoulder on the with the second hollow shaft made in one piece flange HO.
Der Flansch 168 am oberen Ende des zweiten Hohlschaftes 150 dient als radiale Wand, welche die Kammern 115 und 116 voneinander trennt. Sie zylindrische Wandung des Flansches befindet sick in einen Abstand von 1/32 Zoll (0,8 mm) von der Innenwand des Gehäuses. Wenn in diese Kammern Ströme viskosen Speiseeises bei etwa gleichen Drucken fließen, ist durch diesen engen, ringförmigen Spalt nur ein geringer Materialfluß zwischen den Sammern zu erwarten. An der Unterseite der untersten Kammer 116 dienen der Flansch 140, das Lager 170 und der Ring 171 als radialer Wandteil 124 und verhindern das Auslaufen von Material aus der dritten Kammer 116 abwärts in den ringförmigen Raum zwischen der Wandung des Zylinders 141 und der benachbarten Wand des unteren Endes des zweiten Hohlschaftee 150,The flange 168 at the upper end of the second hollow shaft 150 serves as a radial wall, which the chambers 115 and 116 separates from each other. The cylindrical wall of the flange is 1/32 of an inch (0.8 mm) apart the inner wall of the housing. When viscous ice cream flows into these chambers at approximately the same pressure flow through this narrow, annular gap is only one low material flow between the collectors to be expected. The flange is used on the underside of the lowermost chamber 116 140, the bearing 170 and the ring 171 as a radial wall part 124 and prevent the leakage of material from the third Chamber 116 down into the annular space between the wall of the cylinder 141 and the adjacent wall of the lower end of the second hollow shaft 150,
Es 1st wesentlich, daß hierbei jeder der drei Ströme aus viskoses Speiseeis bestehen kann, bei etwa gleicher Stärke der Ströme* Biss steht im Gegensatz zu der Ausführungs-It is essential that here each of the three streams can consist of viscous ice cream, with about the same strength the currents * bite is in contrast to the execution
10S8U/072610S8U / 0726
- 20 -- 20 -
form nach Pig. 1 und 2, bei der mit dem Speiseeis-Hauptstrom verhältnismäßig kleinere Mengen einer anderen Speiseeissorte oder eines Geschmacksingredienz vervrunden werden. Um die Möglichkeit zu schaffen, daß die "Vorrichtung zwei oder mehrere große Speiseeisströme spiralenförmig vereinigen kann, sind die in der Ausbildung gemäß Pig. 3 bis 8 vorhandenen entsprechenden Durdhgänge so konstruiert, daß ein glatter Fließweg vor allem zu und durch die Ausstoßdüse 121 entsteht, die an ,den unteren Enden des ersten und zweiten Hohlschaftes 146 und 150 angeformt ist.shape according to Pig. 1 and 2, in the case of the main flow of ice cream, relatively smaller quantities of a different type of ice cream or a flavor ingredient. To create the possibility that the "device two or can merge several large streams of ice cream in a spiral, are those in training according to Pig. 3 to 8 existing corresponding passages constructed so that a smooth Flow path is mainly to and through the discharge nozzle 121, which is at the lower ends of the first and second Hollow shaft 146 and 150 is formed.
Hierzu sind gegenüberliegende Seiten des unteren Endes des ersten Hohlschafts 14-6 längs Ebenen geschnitten, die zu einem Punkt 176 konvergieren. Längs einer Seite dieses zulaufenden Endes ist eine Platte 178 befestigt, die diese Unterseite des Hohlschaftes abschließt. Entlang der anderen Seite des zulaufenden Schaftendes ist eine teilende Platte 179 befestigt, die eine geschoßförmige Öffnung 180 besifet, welche in die Bohrung des Hohlschaftes 146 ragt und den Strom aus den Durchgängen 146 und 148 in diesen Hohlschaft treten läßt. Bas obere Ende der Platte 179 bildet eine gewundene Lippe 181, die an der Innenwand 183 des äußeren Hohlschaftes 150 festgeschweißt ist. Von der Lippe 181 erstreckt sich die Platte abwärts und radial nach innen zu ihrem unteren Ende 184· Dieses ist so abgebogen, daß es sich von dem zuaufenden Ende 176 des ersten Hohlschaftee axial nach unten erstreckt. Die Sei/taikanten 185 und 186 der Plat-For this purpose, opposite sides of the lower end of the first hollow shaft 14-6 are cut along planes that converge to a point 176. A plate 178 is attached along one side of this tapered end to support this Completes the bottom of the hollow shaft. Along the other side of the tapering end of the shaft is a dividing plate 179 attached, which besifet a bullet-shaped opening 180 which protrudes into the bore of the hollow shaft 146 and allows the flow of the passages 146 and 148 to pass into this hollow shaft. The upper end of the plate 179 forms a serpentine lip 181 that attaches to the inner wall 183 of the outer hollow shaft 150 is welded in place. From the lip 181 the plate extends downwardly and radially inward to its lower one End 184 · This is bent so that it extends axially from the tapering end 176 of the first hollow shaft extends downwards. The sidewalls 185 and 186 of the plateau
1098U/07261098U / 0726
- 21 -- 21 -
te 179 grenzen an die Innenwand 183 des äußeren Hohlschaftes 150, so daß der dritte Materialstrom, welcher von ober-■ halb der Lippe 181 durch das Innere dieses Hohlschaftes fließt, nach rechts abgelenkt und isoliert, d.h. von den beiden anderen Strömen links von der Platte 179 getrennt wird, wie dies aus Pig. 4 zu sehen ist. Das untere Ende der Platte 179 erstreckt sich hinab bis zum unteren Abschluß des äußeren Hohlschaftes. 150 und bildet eine Trennwand für die Ausstoßdüse 121.te 179 adjoin the inner wall 183 of the outer hollow shaft 150, so that the third stream of material, which from above ■ half of the lip 181 through the interior of this hollow shaft flows, deflected to the right and isolated, i.e. separated from the other two flows to the left of plate 179 will be like this from Pig. 4 can be seen. The lower end of the Plate 179 extends down to the bottom of the outer hollow shaft. 150 and forms a partition wall for the discharge nozzle 121.
Um den ersten und den zweiten Strom voneinander zu trennen, ist das untere Ende des Teilers 162 in der in Pig. 4 dargestellten Weise geformt und von seinem oberen Teil so radial abgesetzt, daß es eich zur und entlang der Innenwand 183 des äußeren Hohlschaftes 150 bis zu dessen unterem Ende erstreckt. Genauer gesagt, das untere Ende I64 ist so ausgebildet, daß es in und durch die geschoßförmige öffnung paßt, wobei sich der abgesetzte Teil mit seiner sich längserstreckenden Kante 188 gegen die Innenwand 183 des zweiten Hohlschaftes legt. Eine gegenüberliegende und abwärts geneigte Kante 189 des Teilers ist in einen Schlitz in der Platte 178 (Pig. 9 oben) eingeführt und dort festgemacht. Sie erstreckt eich nach abwärts zu der unteren axialen Kante 190, die in einen Schlitz 191 im unteren Ende 184 der Platte 179 (Pig. 9 unten) eingeschoben ist.To separate the first and second stream from each other, is the lower end of the divider 162 in the Pig. 4 shown Shaped in a manner and radially offset from its upper part in such a way that it calibrates to and along the inner wall 183 of the outer hollow shaft 150 extends to its lower end. More precisely, the lower end I64 is designed so that it is in and through the bullet-shaped opening fits, with the stepped part with its longitudinally extending Edge 188 places against the inner wall 183 of the second hollow shaft. One opposite and downward sloping edge 189 of the divider is in a slot in the Plate 178 (Pig. 9 above) inserted and fastened there. It extends downward to the lower axial edge 190 which fits into a slot 191 in the lower end 184 of the Plate 179 (Pig. 9 below) is inserted.
- 22 1098U/.0726 - 22 1098U / .0726
In dieser Ausbildung schaffen die das Ende des zweiten. Hohlschaftes 150 teilenden Mittel in der Ausstoßdüse annähernd gleichgroße Ausstoßöffnungen, wobei in diesem Fall die Öffnung 120 etwas größer ist als die Öffnungen 118 und 119. Die Öffnung 120 für den dritten Strom liegt, wie Fig. 6 zeigt, im Raum auf der rechten Seite des unteren Endes der Platte 179 zwischen der letzteren und der gegenüberliegenden Wand des Hohlschaftes 150. An der linken Seite der Platte 179 teilt, wie Fig. 6 zeigt, das untere Ende 164 des Teilers 162 denRaum in die Öffnungen 119 und 118, wobei aus der Öffnung 118 der erste und aus der Öffnung 119 der zweite Strom austritt.In this training they finish the second. Hollow shaft 150 dividing means in the discharge nozzle of approximately the same size discharge openings, in which case the opening 120 is slightly larger than the openings 118 and 119. The opening 120 for the third stream is, as FIG. 6 shows, in the space on the right side of the lower end of the plate divides 179 150. between the latter and the opposite wall of the hollow shaft on the left side of the plate 179, as Fig. 6 shows the lower end 164 of the divider 162 DENR a get out into the openings 119 and 118, wherein the first flow emerges from the opening 118 and the second flow emerges from the opening 119.
Im Betrieb werden bei der in den Fig. 3 bis 9 dargestellten Ausführungsform der Erfindung drei Materialströme, angenommen Speiseeis, durch die entsprechenden Einlaßöffnungen 111, 112, 113 eingeführt. Yon der ersten Einlaßöffnung fließt das Speiseeis in die erste Kammer 114 und danach radial nach innen durch die radialen Öffnungen 165 an der einen Seite des ersten Hohlschaftes 146. Dann fließt es entlang der einen Hälfte des erden Zylinders den inneren Durchgang 145 hinab. Es flej.ßt entlang dem Hohlschaft 146 zu der geschoßförmigen öffnung 180 und längs der Innenseite der Platte 178 am unteren Ende des ersten Hohlschaftes und schließlich radial und abwärts entlang der Innenwand 183 des zweiten Hohlschaftes 150.In operation, in the embodiment of the invention shown in FIGS. 3 to 9, three material flows, say ice cream, introduced through the respective inlet ports 111, 112, 113. From the first inlet port the ice cream flows into the first chamber 114 and then radially inward through radial openings 165 on one Side of the first hollow shaft 146. Then it flows along one half of the earth cylinder, the inner passage 145 down. It flexes along the hollow shaft 146 to form the bullet-shaped one opening 180 and along the inside of the plate 178 at the lower end of the first hollow shaft and finally, radially and downwards along the inner wall 183 of the second hollow shaft 150.
- 23 -109814/0726- 23 -109814/0726
Gleichzeitig und in ähnliche? Weise fließt das zweite Material durch seine Einlaßöffnung 112 in die zweite Kammer 115f durch die radfeien öffnungen 166 in den Durchgang 148 auf der anderen Seite des Teilers 162, in den ersten Hohlschaft 146» diesen hinfeab zu. seinem Ende hei der Platte 178 und durch die geschoßförmige Öffnung 180 zur Innenwand des zweiten Hohlschaftes 150, wobei es durch das untere Ende der Teiler 162 vom ersten Material getrennt wird. Die allmähliche radiale Ablenkung dieser Ströme mittels der Plat- ™ te 178 durch die langgestreckte Öffnung 180 gestattet ein stetiges, glattes Fließen des viskosen Speiseeises.Simultaneously and in similar? As flowing the second material through its inlet port 112 into the second chamber 115f by the radfeien openings 166 in the passageway 148 on the other side of the T e IleRSs 162, in the first hollow shaft 146 'to these hinfeab. its end is called the plate 178 and through the bullet-shaped opening 180 to the inner wall of the second hollow shaft 150, wherein it is separated from the first material by the lower end of the dividers 162. The gradual radial deflection of these currents by means of the plate 178 through the elongated opening 180 allows a steady, smooth flow of the viscous ice cream.
Gleichzeitig Mit dem Fluß des ersten und des zweiten Materials bewegt sich das dritte Material durch die Einlaßöffnung 113 in die dritte Kammer 166, dann durch die radialen öffnungen 167 in den Baum 149 zwischen dem ersten und dem zweiten Hohlschaft, und fließt schließlich zwischen dem unteren Ende 184 der Platte 179 und der Schaft- | wandung 183 hinab zu der Ausstoßöffnung 120 am unteren Ende des zweiten Hohlschaftes 150. Auch dieser Strömungspfad bewirkt eine allmähliche radiale Ablenkung des dritten Speiseeisstromes zur dritten Ausstoßöffnung 120.Simultaneously with the flow of the first and second material, the third material moves through the inlet opening 113 into the third chamber 166, then through the radial openings 167 into the tree 149 between the first and second hollow shafts, and finally flows between the lower E. n de 184 of the plate 179 and the shaft | wall 183 down to the discharge opening 120 at the lower end of the second hollow shaft 150. This flow path also causes a gradual radial deflection of the third ice cream flow to the third discharge opening 120.
Wenn die drei Materialströme kontinuierlich durch die Auestoööffnungen 118, 119 und 120 fließen,wir ddas obere Ende des ersten Hohlschaftee durch die Kupplung 158 angetrieben. Damit drehen sich der erste und der zweite HohlschaftWhen the three streams of material flow continuously through the exhaust openings 118, 119 and 120, the upper end of the first hollow shaft is driven by the coupling 158. The first and second hollow shafts thus rotate
1098U/07261098U / 0726
— 24 -- 24 -
gemeinsam ia den Lagern 159 und 170, so daß sich die drei kontinuierlich nach unten und aus den drei Ausstoßöffnungen herausfließenden Materialströme in einer Weise verwinden, daß ein rodukt entsteht, das eine längsgestreckte, dreispiralige Streifen zeigende Wandung aufweist, wie man aus Fig. 4 sieht.common to camps 159 and 170, so that the three continuously down and out of the three discharge ports twist out flowing material streams in a way, that a product is created that has an elongated, three-spiral strip showing wall, how to from Fig. 4 sees.
Es sei erwähnt, daß man das gleiche Gerät auch dann benutzen kann, wenn ein aus nur zwei Materialströme erzeugtes Material hergestellt werden soll. Man läßt dann eine der Einlaßöffnungen unbenutzt. Wahlweise kann auch in zwei der Einlaßöffnungen die gleiche Speiseeissorte eingegeben werden, um sie mit einer durch eine der anderen Einlaßöffnungen eingeführte dritte Materialsorte zu nLsehen.It should be mentioned that the same device can also be used if one of only two material streams produced material is to be produced. One of the inlet openings is then left unused. Optionally, in The same type of ice cream can be entered into two of the inlet openings in order to see it with a third type of material introduced through one of the other inlet openings.
Man sieht aus dem Vorstehenden,daß bei der ersten Ausführungsform der Erfindung der dritte Strom eines Hauptmaterials um die im Inneren spiralig verwundenen' Ströme eine äußere Wand bildet, während in der zweiten Ausführung form jeder der Ströme als spiraliger Streifen an der Außenwand des Produktes sichtbar ist.It will be seen from the foregoing that in the first embodiment of the invention, the third stream of main material around the internally spirally twisted streams is one outer wall forms, while in the second embodiment form each of the streams is visible as a spiral stripe on the outer wall of the product.
So stellt die Erfindung einen kontinuierlichen, glatten Materialfluß her, etwa aus Speiseeis, einem Geschmacksingredienz, oder dgl. bestehend, der durch zwei oder mehrere voneinander geschiedene Durchgänge zu einer Ausstoßdüse fließt, welche einen Ausstoß in Form eines kompakten Stranges, in welchem die unterschiedlichen Farben der gemischten Materialien sichtbar sind. Dieser Strang stellt das gewünschteSo the invention provides a continuous, smooth Material flow, for example consisting of ice cream, a flavor ingredient, or the like, which flows through two or more separate passages to an ejection nozzle, which an output in the form of a compact strand in which the different colors of the mixed materials are visible. This strand represents the desired
1098U/0726 Endprodukt dar. - 25 -1098U / 0726 End product. - 25 -
Claims (13)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US63842767A | 1967-05-15 | 1967-05-15 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DE1751351A1 true DE1751351A1 (en) | 1971-04-01 |
Family
ID=24559985
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE19681751351 Pending DE1751351A1 (en) | 1967-05-15 | 1968-05-15 | Device for combining streams of flowable food |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US3477393A (en) |
| CH (1) | CH476269A (en) |
| DE (1) | DE1751351A1 (en) |
| FR (1) | FR1578051A (en) |
| GB (1) | GB1169500A (en) |
Families Citing this family (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3767338A (en) * | 1971-09-03 | 1973-10-23 | Kellog Co | Apparatus for producing overland extrudates |
| GB2156727A (en) * | 1984-03-09 | 1985-10-16 | Pemberton Sintermatic | Method for the production of helical protein products |
| US4648828A (en) * | 1984-07-19 | 1987-03-10 | Nisshin-Dca Foods Inc. | Crude material forming machine |
| US4786243A (en) * | 1986-05-15 | 1988-11-22 | Nabisco Brands, Inc. | Apparatus for forming an edible product |
| US4835000A (en) * | 1986-05-15 | 1989-05-30 | Nabisco Brands, Inc. | Method for forming an edible product |
| DE3867909D1 (en) * | 1987-04-22 | 1992-03-05 | Unilever Nv | METHOD FOR MAKING A COLORFUL ICE CONFECTION. |
| US4793520A (en) * | 1987-06-03 | 1988-12-27 | Gerber Ernest C | Flavor dispensing device |
| DK0615692T3 (en) * | 1993-03-18 | 1997-02-24 | Nestle Sa | |
| US6231902B1 (en) | 1993-03-18 | 2001-05-15 | Nestec S.A. | Mousse containing sterilized pieces of chocolate |
| PT800772E (en) * | 1996-04-12 | 2001-11-30 | Nestle Sa | PROCESS AND DEVICE FOR THE MANUFACTURE OF FRESH AND EXTRUDED CONFECTIONERY |
| DK0811324T3 (en) | 1996-06-07 | 2003-03-10 | Nestle Sa | Method and apparatus for making frozen compositions containing pieces |
| US6004606A (en) * | 1998-02-23 | 1999-12-21 | Nestec S.A. | Process for preparation of extruded patterned frozen confectionery products |
| US7621669B1 (en) | 2004-03-09 | 2009-11-24 | Flavor Burst Co., L.L.P. | Blender for ingredients and flavoring for soft-serve freezer product |
| US7665398B2 (en) * | 2004-03-09 | 2010-02-23 | Flavor Burst Co., L.L.P. | Soft-frozen confection blending and dispensing freezer |
| US7178976B2 (en) * | 2004-03-09 | 2007-02-20 | Flavor Burst Co. | Blender for ingredients into soft-serve freezer products |
| IL172097A0 (en) * | 2004-12-21 | 2009-02-11 | Unilever Plc | Apparatus and process for preparing a frozen confection |
| EP1673981B1 (en) * | 2004-12-21 | 2015-07-29 | Unilever PLC | Apparatus and process for preparing a frozen confection |
| EP1741346A1 (en) * | 2005-07-05 | 2007-01-10 | Savvidis Evangelos | Distributor of soft ice cream |
| US10448660B2 (en) * | 2011-10-03 | 2019-10-22 | Kerry Luxembourg S.à.r.l. | Metering the disposition of a food product into cavities forming a pellet |
| US20150150269A1 (en) * | 2012-08-01 | 2015-06-04 | Frito-Lay North America, Inc. | Continuous process and apparatus for making a pita chip |
| US9648898B2 (en) | 2012-09-13 | 2017-05-16 | Kerry Luxembourg S.à.r.l. | Metering the disposition of a food product into cavities forming a pellet |
| EA035526B1 (en) | 2014-05-30 | 2020-06-30 | Юнилевер Н.В. | Process and apparatus for the manufacture of a frozen confection |
| US11596163B2 (en) | 2014-07-29 | 2023-03-07 | Conopco, Inc. | Frozen confection and process of making |
| SI3017702T1 (en) | 2014-11-06 | 2018-04-30 | Ali S.P.A. - Carpigiani Group | Machine for making variegated ice cream or ice cream shake |
| US10123553B2 (en) * | 2015-01-16 | 2018-11-13 | Ali S.p.A.—Carpigiani Group | Machine and method for making liquid or semi-liquid products |
| DE102015203708A1 (en) | 2015-03-02 | 2016-09-08 | Sram Deutschland Gmbh | Gear for a bicycle drive |
| CN107846929B (en) * | 2015-07-21 | 2021-04-27 | 荷兰联合利华有限公司 | Filling head for filling containers with frozen confectionery |
| CN110099570A (en) | 2016-12-21 | 2019-08-06 | 荷兰联合利华有限公司 | Colour mixing machine |
| WO2021140188A1 (en) | 2020-01-10 | 2021-07-15 | Unilever Ip Holdings B.V. | Novel frozen confection architecture and process of preparation |
| CN115104663B (en) * | 2021-03-23 | 2023-09-01 | 杨皓翔 | A mould for producing ice cream |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BE655136A (en) * | 1900-01-01 | |||
| US1951694A (en) * | 1929-12-11 | 1934-03-20 | Goulstone James Price | Manufacture of vari-colored ice cream and like frozen food products |
| US2463112A (en) * | 1947-05-28 | 1949-03-01 | Kipnis Abraham | Twisted cruller machine |
| US2866420A (en) * | 1950-05-11 | 1958-12-30 | William A Nutty | Ice cream stick machine |
| US2917008A (en) * | 1955-12-12 | 1959-12-15 | Kipnis Abraham | Deep-fried extruded-dough comestible machine |
| US3267971A (en) * | 1963-07-22 | 1966-08-23 | Seymour C Graham | Packaging apparatus and process |
| US3347287A (en) * | 1965-03-22 | 1967-10-17 | Anderson Bros Mfg Co | Nozzle apparatus |
-
1967
- 1967-05-15 US US638427A patent/US3477393A/en not_active Expired - Lifetime
-
1968
- 1968-04-26 GB GB09844/68A patent/GB1169500A/en not_active Expired
- 1968-05-14 FR FR1578051D patent/FR1578051A/fr not_active Expired
- 1968-05-15 DE DE19681751351 patent/DE1751351A1/en active Pending
- 1968-05-15 CH CH716468A patent/CH476269A/en not_active IP Right Cessation
Also Published As
| Publication number | Publication date |
|---|---|
| FR1578051A (en) | 1969-08-14 |
| GB1169500A (en) | 1969-11-05 |
| CH476269A (en) | 1969-07-31 |
| US3477393A (en) | 1969-11-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE1751351A1 (en) | Device for combining streams of flowable food | |
| EP1657159B1 (en) | Method of filling a container with at least two liquid or pasty products and filling device for carrying out said method | |
| DE3614915C2 (en) | ||
| EP0971787B1 (en) | Dynamic mixer for dental impression pastes | |
| DE2001143A1 (en) | Method and device for filling containers with viscous substances | |
| DE2359981A1 (en) | NOZZLE DEVICE FOR FILLING CONTAINERS | |
| DE3623417C2 (en) | ||
| EP2186454A1 (en) | Coffee machine | |
| DE60201201T2 (en) | Dispensing device in machines for filling containers with powdered material | |
| EP0265597B1 (en) | Apparatus for the dosed filling of containers with liquid or viscous material | |
| DE19637098A1 (en) | Apparatus to mix and/or refine chocolate mass | |
| DE1554950A1 (en) | Method and device for manufacturing a plastic product, e.g. a confectionery product such as ice cream | |
| WO2000073151A1 (en) | Filler valve for filling flat pouch containers | |
| EP0635309B1 (en) | Double pusher centrifuge | |
| DE102012023271B4 (en) | mixing tank | |
| DE2418967A1 (en) | Eccentric worm pump has separate worm sections on common shaft - and additional inlet into chamber between different-output pump sections | |
| DE2219352C2 (en) | Continuously working ring mixer | |
| DE1632143C3 (en) | Nozzle head for sausage filling machines with several nozzles | |
| DE3426029C2 (en) | ||
| DE102009013080A1 (en) | Method for packaging portioned pasty product i.e. emulsion, involves portioning product in pasty condition, and homogenizing directly product in pasty condition before transferring product into packaging and after portioning product | |
| DE3120017C2 (en) | ||
| DE3618062A1 (en) | Device for mixing pasty or gel-like components | |
| DE202004020460U1 (en) | Filling device especially for food industry for filling of container with at least two liquid or paste products has shut-off device controlled so that only some of the first nozzles are opened at same time while rest are closed | |
| DE60109143T2 (en) | Variable tilt device for refining food | |
| DD264140A5 (en) | DEVICE FOR UNWRITING FISH RECINGS CLOSED AT YOUR GROUND |