DE102010038842A1

DE102010038842A1 - New aptamer that specifically binds to human tau protein or its fragment, useful e.g. in vitro for isolating, purifying and/or detecting tau protein, and to treat cerebral infarction, pick disease and/or progressive supranuclear palsy

Info

Publication number: DE102010038842A1
Application number: DE102010038842A
Authority: DE
Inventors: Regina Stoltenburg; Beate Strehlitz; Christine Reinemann
Original assignee: Helmholtz Zentrum fuer Umweltforschung GmbH UFZ
Current assignee: Helmholtz Zentrum fuer Umweltforschung GmbH UFZ
Priority date: 2010-08-03
Filing date: 2010-08-03
Publication date: 2012-02-09

Abstract

Aptamer that specifically binds to human tau protein or its fragment, is new. Independent claims are included for: (1) kit comprising the aptamer; (2) a method for the purification of human tau protein or its fragments comprising contacting a sample containing human tau protein or its fragments with the aptamer and separating the obtained complex of aptamer and bound tau protein or its fragments from the remaining sample; and (3) a method for detection of human tau protein or its fragments comprising contacting a sample to be tested with the aptamer and detecting a binding event between the aptamer and the human tau protein or its fragment. ACTIVITY : Cerebroprotective; Vasotropic; Neuroprotective; Nootropic; Antiparkinsonian. MECHANISM OF ACTION : None given.

Description

Bei neurodegenerativen Erkrankungen und insbesondere bei Morbus Alzheimer kommt es meist zu einer pathologischen Veränderung des Gehirns, lange bevor andere Krankheitssymptome auftreten. Biomarker, die solche präklinischen Phasen anzeigen und eine Differenzierung zwischen verschiedenen neurodegenerativen Krankheiten erlauben, sind daher für eine frühzeitige Diagnose und Therapie bedeutsam. Dadurch kann die Lebensqualität der Betroffenen möglichst lange erhalten werden und die Pflegekosten für das Gesundheitssystem können insgesamt verringern werden.In neurodegenerative diseases, and especially in Alzheimer's disease, there is usually a pathological change in the brain long before other symptoms of disease appear. Biomarkers that display such preclinical phases and allow differentiation between different neurodegenerative diseases are therefore important for early diagnosis and therapy. As a result, the quality of life of those affected can be maintained for as long as possible and overall care costs for the health system can be reduced.

Derzeit beruht die Diagnose bei Morbus Alzheimer auf Gedächtnis- und Verhaltenstests sowie bildgebenden Verfahren. Ein definitiver Nachweis der Erkrankung ist erst durch Autopsie nach dem Tod des Patienten möglich.The diagnosis of Alzheimer's disease is currently based on memory and behavioral tests as well as imaging techniques. A definitive proof of the disease is only possible by autopsy after death of the patient.

Wie K. Bracht in ”Indikatoren für Diagnose und Therapie”; Pharmazeutische Zeitung online Ausgabe 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0 ; zusammenfasst, sind in Studien bereits Liquor-Untersuchungen auf Amyloid-β42-Peptid (Aβ42) und Tau-Protein verfügbar. Dabei hat sich gezeigt, dass erhöhte Tau-Protein-Spiegel mit Alzheimer-Demenz assoziiert sind.As K. Bracht in "Indicators for Diagnosis and Therapy"; Pharmaceutical Newspaper online Issue 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0 ; In conclusion, CSF studies on amyloid β42 peptide (Aβ42) and tau protein are already available in studies. It has been shown that increased tau protein levels are associated with Alzheimer's dementia.

Tau-Protein bindet normalerweise an Mikrotubulin und stabilisiert dieses. Vermutlich stammen die bei Alzheimer erhöhten Tau-Proteinspiegel in Cerebrospinalflüssigkeit (CSF) aus sterbenden Neuronen. Einige Gruppen erforschen eine Alzheimer-spezifische Phosphorylierung des Moleküls. Tau-Protein wird bei Alzheimer-Patienten abnormal hyperphosphoryliert, wodurch das Gleichgewicht der Tau-Mikrotubulin-Bindung gestört wird. Es konnte gezeigt werden, dass humanes Tau-Protein mit bestimmten Phosphorylierungsmustern als Prädiktor für die Progression einer milden kognitiven Beeinträchtigung zur Alzheimer-Demenz verwendet werden können.Tau protein normally binds to microtubulin and stabilizes it. Presumably, Alzheimer's increased tau protein levels in cerebrospinal fluid (CSF) are derived from dying neurons. Some groups are investigating Alzheimer-specific phosphorylation of the molecule. Tau protein is abnormally hyperphosphorylated in Alzheimer's patients, thereby disrupting the balance of tau-microtubulin binding. It has been shown that human tau protein with certain phosphorylation patterns can be used as a predictor of the progression of mild cognitive impairment to Alzheimer's dementia.

Der Quotient Tau/Aβ42, gemessen in CSF, hat in Studien die derzeit beste prädiktive Aussagekraft für eine zukünftige Demenzerkrankung bei asymptomatischen Probanden.The quotient Tau / Aβ42, measured in CSF, has currently the best predictive value for future dementia in asymptomatic subjects.

Neben Morbus Alzheimer ist eine Veränderung im Tau-Proteinspiegel auch mit anderen Erkrankungen und pathologischen Zuständen assoziiert. So ist ein erhöhter oder ein veränderter Tau-Proteinspiegel auch bei Erkrankungen mit einem massiven akuten Neuronenzerfall, wie beispielsweise Hirninfarkten und Schlaganfall, beschrieben worden, wie auch bei chronischem Neuronenuntergang, während atropisch-degenerativer Prozesse und Creutzfeld-Jakob-Erkrankung (siehe auch Hort et al., ”Bedeutung der Gesamt-Tau und Phospho-Tau-Protein-Liquorspiegel in der Demenzdiagnostik”, Nervenarzt 2008, 79, 891–898 ). Daneben ist eine ganze Gruppe von neurodegenerativen Erkrankungen aufgrund des gemeinsamen Merkmals des erhöhten oder veränderten Tau-Proteinspiegels im Gehirn unter dem Begriff der Taupathien zusammengefasst (klassifiziert in MeSH, Version 2010, unter der Nr. DO24801). Zur Gruppe der Taupathien zählen insbesondere Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und progressive supranukleäre Blickparese.In addition to Alzheimer's disease, a change in tau protein levels is also associated with other diseases and pathological conditions. Thus, increased or altered tau protein levels have also been described in diseases with massive acute neuronal decay, such as brain infarcts and stroke, as well as in chronic neuronal descent, during atropic-degenerative processes, and Creutzfeldt-Jakob disease (see also US Pat Hort et al., "Importance of Total Tau and Phospho-Tau Protein Liquor Levels in Dementia Diagnosis," Neurologist 2008, 79, 891-898 ). In addition, a whole group of neurodegenerative diseases are grouped together under the term "tauopathies" because of the common feature of elevated or altered tau protein levels in the brain (classified in MeSH, version 2010, under No. DO24801). The group of the Taupathien count in particular Alzheimer's disease, corticobasal degeneration, Agryophilic grain disease, Pick's disease, Frontotemporal dementia, Parkinsonism of chromosome 17 (FTDP-17) and progressive supranuclear palsy.

Der Nachweis des Tau-Proteins erfolgt dabei bislang im Wesentlichen mittels spezifischer Antikörper. Dabei müssen die üblicherweise mit Antikörpern assoziierten Nachteile in Kauf genommen werden. Allgemein bekannte Nachteile von Antikörpern umfassen die Möglichkeit von Kreutzreaktivitäten, eine kostenintensive Herstellung, hohe Variation in der Herstellung und Nachteile, die allgemein mit der Größe von Antikörpern zusammenhängen. Es besteht somit ein Bedarf an Alternativen für den Nachweis von Tau-Protein.The detection of the tau protein is done so far essentially by means of specific antibodies. The disadvantages usually associated with antibodies must be accepted. Commonly known disadvantages of antibodies include the potential for cross-reactivity, costly production, high variation in production, and disadvantages generally associated with the size of antibodies. There is thus a need for alternatives for the detection of tau protein.

Aufgabe der vorliegenden Erfindung ist es, Alternativen bereitzustellen, bei denen ein oder mehrere Nachteile des Standes der Technik nicht mehr auftreten oder nur noch vermindert vorhanden sind.Object of the present invention is to provide alternatives in which one or more disadvantages of the prior art no longer occur or are only available in a reduced form.

Die Aufgabe wird gelöst durch Bereitstellung von Aptameren, die spezifisch an humanes Tau-Protein oder ein Fragment davon binden.The object is achieved by providing aptamers which bind specifically to human tau protein or a fragment thereof.

Bevorzugt zeichnet sich das erfindungsgemäße Aptamer dadurch aus, dass das Aptamer mindestens eine der folgenden Nukleinsäuresequenzen umfasst oder daraus besteht:

a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 27; oder
b) eine Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden.

Preferably, the aptamer according to the invention is characterized in that the aptamer comprises or consists of at least one of the following nucleic acid sequences:

a) a sequence having one of SEQ ID NOs 2 to 27; or
b) a sequence which is at least 80% identical to a sequence from a) over a sequence of at least 18 consecutive nucleotides.

Unter dem Begriff ”Aptamer” sind im Sinne dieser Erfindung Oligonukleotide zu verstehen, die spezifisch und mit hoher Affinität an ein Zielmolekül, Insbesondere humanes Tau-Protein oder ein Fragment davon, binden. Aptamere können sich unter definierten Bedingungen in eine spezifische dreidimensionale Struktur, beispielsweise so genannte Haarnadelstrukturen, falten. Vorzugsweise weist das erfindungsgemäße Aptamer wenigstens eine erste Haarnadel-Struktur umfassend einen Stamm und eine Schleife auf. Unter dem Begriff ”Haarnadelstruktur” oder ”Hairpin” ist im Sinne der vorliegenden Erfindung eine spezielle Form der Sekundärstruktur bei Nukleinsäuresequenzen, insbesondere Aptameren, zu verstehen, die sich aus zwei zueinander komplementären Sequenz-Abschnitten im so genannten Stamm (stem) und einem weiteren Sequenzabschnitt in der so genannten Schleife (loop) zusammensetzen, zu verstehen. Hierbei können im Stamm eine oder mehrere Basen einzelsträngige Bereiche so genannte Ausbuchtungen (Bulge) ausbilden. For the purposes of this invention, the term "aptamer" is to be understood as meaning oligonucleotides which bind specifically and with high affinity to a target molecule, in particular human tau protein or a fragment thereof. Aptamers can fold under defined conditions into a specific three-dimensional structure, for example so-called hairpin structures. Preferably, the aptamer according to the invention has at least one first hairpin structure comprising a stem and a loop. For the purposes of the present invention, the term "hairpin structure" or "hairpin" is to be understood as meaning a special form of secondary structure in the case of nucleic acid sequences, in particular aptamers, which consists of two mutually complementary sequence sections in the so-called stem and a further sequence section in the so-called loop, to understand. Here, one or more bases in the trunk can form single-stranded areas called bulges.

Das erfindungsgemäße Aptamer enthält oder besteht aus einer Sequenz von Nukleinsäurebausteinen, den Nukleotiden. Bevorzugt werden im erfindungsgemäßen Aptamer unmodifizierte und/oder modifizierte D- und/oder L-Nukleotide verwendet. ”C” steht vorliegend entsprechend dem üblichen, hier verwendeten Ein-Buchstaben-Code der Basen für Cytosin, entsprechend stehen ”A” für Adenin, ”G” für Guanin und ”T” für Thymin, ”U” für Uracil. Wenn im Folgenden nicht anders angegeben, umfasst der Begriff ”Nukleotid” die Begriffe ”Ribonukleotid” und ”Desoxyribonukleotid”. Entsprechend umfasst der Begriff ”2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifiziertes Nukleotid” 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide und Desoxyribonukleotide.The aptamer of the invention contains or consists of a sequence of nucleic acid units, the nucleotides. Unmodified and / or modified D and / or L nucleotides are preferably used in the aptamer according to the invention. In this case, "C" corresponds to the usual one-letter code of the bases for cytosine used here, accordingly "A" stands for adenine, "G" for guanine and "T" for thymine, "U" for uracil. Unless otherwise stated below, the term "nucleotide" includes the terms "ribonucleotide" and "deoxyribonucleotide". Accordingly, the term "2'-fluoro, 2'-methoxy and / or 2'-amino-modified nucleotide" 2'-fluoro, 2'-methoxy and / or 2'-amino-modified ribonucleotides and deoxyribonucleotides ,

Das erfindungsgemäße Aptamer weist bevorzugt eine Anzahl an Nukleotiden im Bereich von ≥ 18 Nukleotide bis ≤ 160 Nukleotide, vorzugsweise im Bereich von ≥ 40 Nukleotide bis ≤ 120 Nukleotide, auf. Besonders bevorzugt weist das erfindungsgemäße Aptamer eine Anzahl an Nukleotiden im Bereich von ≥ 44 Nukleotide bis ≤ 120 Nukleotide, vorzugsweise im Bereich von ≥ 50 Nukleotide bis ≤ 88 Nukleotide bevorzugt im Bereich von ≥ 60 bis ≤ 80 Nukleotide auf.The aptamer according to the invention preferably has a number of nucleotides in the range from ≥ 18 nucleotides to ≦ 160 nucleotides, preferably in the range from ≥ 40 nucleotides to ≦ 120 nucleotides. The aptamer according to the invention particularly preferably has a number of nucleotides in the range from ≥ 44 nucleotides to ≦ 120 nucleotides, preferably in the range from ≥ 50 nucleotides to ≦ 88 nucleotides, preferably in the range from ≥ 60 to ≦ 80 nucleotides.

Erfindungsgemässe Aptamere können eine DNA- oder eine RNA-Sequenz aufweisen. Es versteht sich, dass für den Fall, dass erfindungsgemässe Aptamere eine RNA-Sequenz aufweisen, in den angegebenen Sequenzmotiven und Sequenzen Thymidin durch Uridin ersetzt ist. Die erfindungsgemäss geeigneten RNA-Sequenzen entsprechen den erfindungsgemässen DNA Sequenzen, wobei T durch U ersetzt ist.Aptamers according to the invention may have a DNA or an RNA sequence. It is understood that in the case that aptamers according to the invention have an RNA sequence, thymidine is replaced by uridine in the sequence motifs and sequences indicated. The RNA sequences which are suitable according to the invention correspond to the DNA sequences according to the invention, T being replaced by U.

Vorzugsweise weisen die erfindungsgemäßen Aptamere eine DNA-Sequenz auf oder bestehen daraus. Aptamere auf DNA-Basis besitzen in vorteilhafter Weise eine erhöhte Stabilität.The aptamers according to the invention preferably have or consist of a DNA sequence. DNA-based aptamers advantageously have increased stability.

Weiterhin geeignet sind Aptamere, die eine Sequenz umfassend 2'-modifizierte Nukleotide, beispielsweise 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Nukleotide, aufweisen. Auch geeignet sind Aptamere, die 2'-modifizierte Ribonukleotide, beispielsweise 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide, aufweisen. Weiterhin können Aptamere Desoxyribonukleotide und 2'-modifizierte Ribonukleotide, beispielsweise 2'-Fluor-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Ribonukleotide aufweisen.Also suitable are aptamers which have a sequence comprising 2'-modified nucleotides, for example 2'-fluoro, 2'-methoxy and / or 2'-amino-modified nucleotides. Also suitable are aptamers which have 2'-modified ribonucleotides, for example 2'-fluoro, 2'-methoxy and / or 2'-amino-modified ribonucleotides. Furthermore, aptamers may have deoxyribonucleotides and 2'-modified ribonucleotides, for example 2'-fluoro, 2'-methoxy and / or 2'-amino-modified ribonucleotides.

Das erfindungsgemäße Aptamer kann Modifikationen aufweisen. Unter Modifikationen können z. B. die Alkylierung, insbesondere Methylierung, Arylierung oder Acetylierung von zumindest einem Nukleotid, den Einbau von Enantiomeren und/oder die Fusion von Aptameren mit einem oder mehreren Nukleotiden oder einer Nukleinsäuresequenz umfassen. Solche Modifikationen können beispielsweise 5'-PEG- und/oder 3'-CAP-Modifikationen umfassen. Alternativ oder zusätzlich kann das erfindungsgemäße Aptamer modifizierte Nukleotide aufweisen, vorzugsweise ausgewählt aus der Gruppe umfassend Locked-Nukleinsäuren, 2'-Fluoro-, 2'-Methoxy- und/oder 2'-Amino-modifizierte Nukleotide.The aptamer according to the invention may have modifications. Under modifications z. As the alkylation, in particular methylation, arylation or acetylation of at least one nucleotide, the incorporation of enantiomers and / or the fusion of aptamers with one or more nucleotides or a nucleic acid sequence. Such modifications may include, for example, 5'-PEG and / or 3'-CAP modifications. Alternatively or additionally, the aptamer according to the invention may have modified nucleotides, preferably selected from the group consisting of locked nucleic acids, 2'-fluoro, 2'-methoxy and / or 2'-amino-modified nucleotides.

Locked-Nukleinsäuren (LNA, Locked Nucleic Acid) entsprechen einem konformationsfixierten Analogon von RNA. Die Oligonukleotide der Locked-Nukleinsäuren enthalten ein oder mehrere bizyklische Ribonukleoside, bei denen die 2'OH-Gruppe mit dem C4-Kohlenstoffatom über eine Methylengruppe verbunden ist. Vorteilhafter Weise zeigen Locked-Nukleinsäuren im Vergleich zu nicht modifizierter RNA eine höhere Stabilität gegenüber Nukleasen sowie bessere Hybridisierungseigenschaften, wodurch eine Verbesserung der Affinität und/oder Spezifität der Bindung des Aptamers erzielt werden kann.Locked nucleic acids (LNA, Locked Nucleic Acid) correspond to a conformationally fixed analog of RNA. The oligonucleotides of the locked nucleic acids contain one or more bicyclic ribonucleosides in which the 2'OH group is linked to the C4 carbon atom via a methylene group. Advantageously, locked nucleic acids show higher stability towards nucleases as compared to unmodified RNA as well as better hybridization properties, whereby an improvement of the affinity and / or specificity of the binding of the aptamer can be achieved.

Eine weitere bevorzugte chemische Modifikation ist das 5'- oder 3'-Capping der Aptamersequenz. Die Modifikation des 3'-Endes oder 5'-Endes kann das Aptamer in vorteilhafter Weise vor einem schnellen Abbau durch Nukleasen, insbesondere in einem Organismus oder einer biologischen Probe schützen. Beispielsweise bietet die Einführung. eines 3'-3'-dT-Cap am 3'-Ende eines Aptameres Schutz gegenüber Exonukleasen.Another preferred chemical modification is the 5 'or 3' capping of the aptamer sequence. Modification of the 3'-end or 5'-end may advantageously protect the aptamer from rapid degradation by nucleases, particularly in an organism or biological sample. For example, the introduction offers. of a 3'-3'-dT cap at the 3'-end of an aptamer protection against exonucleases.

In anderen Ausführungsformen kann insbesondere das 5'-Ende des Aptamers pegyliert sein. Eine 5'-PEG-Modifikationen kann beispielsweise wenigstens eine Polyethylenglykol-Einheit umfassen, bevorzugt im Bereich von 1 bis 900 Polyethylenglykol-Einheiten, vorzugsweise im Bereich von 1 bis 450 Polyethylenglykol-Einheiten. Bevorzugt verwendbar sind lineare Polyethylenglykol(PEG)-Einheiten HO-(CH₂CH₂O)_n-H, wobei n eine ganze Zahl im Bereich von 1 bis 900, bevorzugt im Bereich von 1 bis 450 ist. In other embodiments, in particular, the 5'-end of the aptamer may be pegylated. For example, a 5'-PEG modification may comprise at least one polyethylene glycol unit, preferably in the range of 1 to 900 polyethylene glycol units, preferably in the range of 1 to 450 polyethylene glycol units. Preference is given to using linear polyethylene glycol (PEG) units HO- (CH ₂ CH ₂ O) _n -H, where n is an integer in the range from 1 to 900, preferably in the range from 1 to 450.

In einer anderen Ausführungsform der vorliegenden Erfindung können die erfindungsgemässen Aptamere als Phosphorothioat-DNA oder peptide nucleic acid (PNA) vorliegen. Durch diese Modifikationen können die Aptamere gegen Nukleinsäure-spaltende Enzyme stabilisiert werden. Die Stabilisierung berührt die Affinität der modifizierten DNA-Aptamere im Wesentlichen nicht, kann jedoch die Zersetzung der Aptamere in einem Organismus oder einer biologischen Probe durch abbauende Enzyme wie Nukleasen oder DNasen verzögern, vermindern oder sogar verhindern.In another embodiment of the present invention, the aptamers according to the invention may be present as phosphorothioate DNA or peptide nucleic acid (PNA). These modifications allow the aptamers to be stabilized against nucleic acid-cleaving enzymes. The stabilization substantially does not affect the affinity of the modified DNA aptamers, but may retard, diminish or even prevent the degradation of the aptamers in an organism or biological sample by degrading enzymes such as nucleases or DNases.

Der Vorteil einer chemischen Modifikation, einer Änderung des Phosphorzuckerrückgrates oder einer Verwendung von enzymatisch nicht erkennbaren veränderten Nukleotidbausteinen ist, dass die verwendeten Nukleinsäuren gegen einen enzymatischen Abbau, insbesondere in einem Organismus oder einer biologischen Probe, stabilisiert sind oder erwünschte pharmakologische Eigenschaften aufweisen. Bevorzugt berührt die Modifikation die Affinität der erfindungsgemäßen Aptamere nicht.The advantage of a chemical modification, a change in the Phosphorzuckerrückgrates or a use of enzymatically unrecognizable altered nucleotide units is that the nucleic acids used against enzymatic degradation, in particular in an organism or a biological sample, are stabilized or have desired pharmacological properties. The modification preferably does not affect the affinity of the aptamers according to the invention.

Die erfindungsgemäßen Aptamere können auch an ein Trägermolekül oder ein Reportermolekül konjugiert vorliegen. Unter Trägermolekülen können beispielsweise solche Moleküle verstanden werden, die an ein erfindungsgemäßes Aptamer konjugiert werden, um die Halbwertszeit des erfindungsgemäßen Aptamers in humanem Blut zu erhöhen, z. B. durch Erhöhung der Stabilität und/oder durch Verringerung der Ausscheidungsrate. Beispielhaft sei PEG als geeignetes Trägermolekül genannt. Unter Reportermolekülen werden Moleküle verstanden, die im Wesentlichen der Detektion der daran konjugierten erfindungsgemäßen Aptamere dienen. Beispiele für geeignete Reportermoleküle sind GFP oder Reste mit radioaktiven Verbindungen, insbesondere mit PET-fähigen Radionukliden, wie beispielsweise ¹⁸F, ¹¹C, ¹³N, ¹⁵O, ⁸²Rb oder ⁶⁸Ga. Weitere Beispiele für geeignete Träger- und/oder Reportermoleküle sind Biotin, Amino-Gruppen, Phosphat-Gruppen, Cholesterol, Farbstoffe wie beispielsweise Fluoreszenzfarbstoffe sowie elektrochemisch aktive Reportermoleküle. Darüberhinaus können die Aptamere mit zusätzlichen DNA-Sequenzen modifiziert werden, die als Spacermoleküle dienen oder zur Konstruktion spezieller Messassays, welche eine Hybridisierungs-/Dehybridisierungsreaktion einschließen, verwendet werden können.The aptamers according to the invention can also be conjugated to a carrier molecule or a reporter molecule. By way of example, carrier molecules can be understood to mean those molecules which are conjugated to an aptamer according to the invention in order to increase the half-life of the aptamer according to the invention in human blood, e.g. B. by increasing the stability and / or by reducing the excretion rate. As an example, PEG may be mentioned as a suitable carrier molecule. Reporter molecules are understood to mean molecules which essentially serve for the detection of the aptamers according to the invention conjugated thereto. Examples of suitable reporter molecules are GFP or residues with radioactive compounds, in particular with PET-capable radionuclides, such as ¹⁸ F, ¹¹ C, ¹³ N, ¹⁵ O, ⁸² Rb or ⁶⁸ Ga. Further examples of suitable carrier and / or reporter molecules are Biotin, amino groups, phosphate groups, cholesterol, dyes such as fluorescent dyes and electrochemically active reporter molecules. In addition, the aptamers can be modified with additional DNA sequences that serve as spacer molecules or can be used to construct specific assay assays involving a hybridization / dehybridization reaction.

Bevorzugt weist das erfindungsgemäße Aptamer mindestens eine der folgenden Nukleinsäuresequenzen auf oder besteht daraus:The aptamer according to the invention preferably has at least one of the following nucleic acid sequences or consists thereof:

a) a sequence having one of SEQ ID NOs 2 to 27; or
b) a sequence which is at least 80%, preferably at least 90%, at least 95%, at least 99% identical to a sequence from a) via a sequence of at least 18 consecutive nucleotides, preferably over the entire length of the sequence from a) ,

In einer bevorzugten Ausführungsform umfasst oder besteht das erfindungsgemäße Aptamer aus:

a) eine Sequenz mit einer der SEQ ID Nrs 2 bis 14, besonders bevorzugt SEQ ID Nrs 2, 10, 11, 12, 14; oder
b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, mindestens 95%, mindestens 99% identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt über die gesamte Länge der Sequenz aus a).

In a preferred embodiment, the aptamer of the invention comprises or consists of:

a) a sequence having one of SEQ ID Nos. 2 to 14, particularly preferably SEQ ID Nos. 2, 10, 11, 12, 14; or
b) a sequence which is at least 80%, preferably at least 90%, at least 95%, at least 99% identical to a sequence from a) via a sequence of at least 18 consecutive nucleotides, preferably over the entire length of the sequence from a) ,

In einer anderen bevorzugten Ausführungsform umfasst oder besteht das erfindungsgemäße Aptamer aus:

a) eine Sequenz mit einer der SEQ ID Nrs 15 bis 27, besonders bevorzugt mit einer der SEQ ID Nrs 15, 23, 24, 25, 27; oder
b) eine Sequenz, die zu mindestens 80%, bevorzugt mindestens 90%, besonders bevorzugt mindestens 95%, ganz besonders bevorzugt mindestens 99%, identisch ist mit einer Sequenz aus a) über eine Abfolge von mindestens 18 aufeinanderfolgenden Nukleotiden, bevorzugt über die gesamte Länge der Sequenz aus a).

In another preferred embodiment, the aptamer of the invention comprises or consists of:

a) a sequence having one of SEQ ID Nos. 15 to 27, particularly preferably having one of SEQ ID Nos. 15, 23, 24, 25, 27; or
b) a sequence which is at least 80%, preferably at least 90%, more preferably at least 95%, most preferably at least 99%, identical to a sequence from a) via a sequence of at least 18 consecutive nucleotides, preferably over the entire Length of the sequence from a).

Die Sequenzen mit der SEQ ID Nrs 2 bis 14 umfassen die spezifischen Sequenzen der internen Regionen der selektierten Aptamere. Die Sequenzen mit den SEQ ID Nrs 15 bis 27 umfassen die vollständigen Sequenzen der selektierten Aptamere, bestehend aus den internen Regionen (SEQ ID Nrs 2 bis 14) und den konstanten Bereichen, welche die internen Regionen am 5'-Ende bzw. am 3'-Ende flankieren. Diese konstanten Sequenzen stellen ebenso wie die internen Regionen strukturbildende Komponenten der Aptamere dar und dienten zusätzlich als Primerbindungsorte für die Amplifikation der Aptamere im SELEX-Prozess. Sie sind daher ein wesentlicher Teil aller hier aufgeführten Aptamere.The sequences of SEQ ID NOs 2 to 14 comprise the specific sequences of the internal regions of the selected aptamers. Sequences SEQ ID NOS: 15 to 27 comprise the complete sequences of the selected aptamers, consisting of the internal regions (SEQ ID NOs: 2 to 14) and the constant regions that define the internal regions at the 5 'end and the 3', respectively. Flank the end. These Constant sequences, like the internal regions, constitute structure-forming components of the aptamers and additionally served as primer binding sites for the amplification of the aptamers in the SELEX process. They are therefore an essential part of all aptamers listed here.

Unter einer Sequenz, die zu mindestens 80% identisch ist mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27, wird jede Sequenz verstanden, die eine zusammenhängende Nukleotidkette aufweist, die mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27 über eine Abfolge von 18 aufeinanderfolgenden Nukleotiden insoweit übereinstimmt, dass sich eine Sequenzidentität von mindestens 80% ergibt. Die Sequenzidentität kann beispielsweise mittels des blastn-Algorithmus bestimmt werden (zugänglich über http://blast.ncbi.nlm.nih.gov/Blast.cgi ). Bevorzugt weist die Sequenz nach b) eine Sequenzidentität auf von mindestens 90%, besonders bevorzugt mindestens 95%, ganz besonders bevorzugt mindestens 99%, mit einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27. Die Sequenzidentität liegt bevorzugt über eine Abfolge von 18 aufeinanderfolgenden Nukleotiden vor, besonders bevorzugt liegt die Sequenzidentität über die gesamte Länge einer Sequenz mit der SEQ ID Nr. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 und/oder 27 vor.Under a sequence that is at least 80% identical to a sequence with the SEQ ID No. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 and / or 27, is understood to mean any sequence having a contiguous nucleotide chain having a sequence of SEQ ID NOS: 2, 3, 4 , 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 and / or 27 via a Sequence of 18 consecutive nucleotides to the extent that results in a sequence identity of at least 80%. The sequence identity can be determined, for example, by means of the blastn algorithm (accessible via http://blast.ncbi.nlm.nih.gov/Blast.cgi ). The sequence according to b) preferably has a sequence identity of at least 90%, particularly preferably at least 95%, very particularly preferably at least 99%, with a sequence having SEQ ID Nos. 2, 3, 4, 5, 6, 7, 8 , 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 and / or 27. The sequence identity is preferably over a sequence of 18 sequential nucleotides, most preferably sequence identity over the entire length of a sequence having SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 , 17, 18, 19, 20, 21, 22, 23, 24, 25, 26 and / or 27.

Verfahren für die Selektion sowie für die Herstellung von Aptameren sind dem Fachmann bekannt. Für die Suche nach Aptameren, die spezifisch für humanes Tau-Protein oder ein Fragment davon sind, kann beispielsweise das SELEX-Verfahren (Systematic Evolution of Ligands by EXponential enrichment) angewendet werden. Hierbei wird ein Pool verschiedener Oligonukleotide mit dem definierten Zielmolekül kontaktiert, bindende Oligonukleotide werden selektiert und amplifiziert und in aufeinanderfolgenden Runden schrittweise im Pool angereichert. Hierzu wird im Einzelnen auf die folgenden Literaturstellen verwiesen: Tuerk & Gold, Science 249 (1990) 505–510, sowie Ellington & Szostak, Nature 346 (1990) 818–822 . Die so erhaltenen Oligonukleotide bzw. Aptamere eignen sich beispielsweise zur Detektion von humanem Tau-Protein oder von Fragmenten davon in einem Bindungsassay oder sie können in der Diagnose, Prophylaxe und/oder Therapie von Erkrankungen eingesetzt werden.Methods for the selection and for the production of aptamers are known in the art. For the search for aptamers which are specific for human tau protein or a fragment thereof, for example, the SELEX method (Systematic Evolution of Ligands by EXponential enrichment) can be used. Here, a pool of different oligonucleotides is contacted with the defined target molecule, binding oligonucleotides are selected and amplified and gradually enriched in successive rounds in the pool. Reference is made in detail to the following references: Tuerk & Gold, Science 249 (1990) 505-510, and Ellington & Szostak, Nature 346 (1990) 818-822 , The oligonucleotides or aptamers thus obtained are suitable, for example, for the detection of human tau protein or fragments thereof in a binding assay or they can be used in the diagnosis, prophylaxis and / or treatment of diseases.

Das erfindungsgemäße Aptamer bindet spezifisch an humanes Tau-Protein oder ein Fragment davon. Das Tau-Protein bindet an Mikrotubulinstrukturen, ist an der Regulation des Zytoskeletts beteiligt und wird durch das MAPT-Gen kodiert. Im menschlichen Zentralnervensystem kommen insgesamt 9 Isoformen des humanen Tau-Proteins vor:
Isoform PNS-tau: Diese Isoform umfasst die kanonische Sequenz, die sich aus dem MAPT-Gen ergibt. Diese Sequenz, mit Aminosäuren 2 bis 758, wird für die Zwecke der vorliegenden Erfindung bevorzugt unter dem Begriff ”humanes Tau-Protein” verstanden.
Isoform Fetal-tau: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 45–73, 74–102, 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-A: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 1–44: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLK → MLRALQQRKR; 45–73, 74–102, 103–104, 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-B: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 74–102, 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-C: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 125–375, 395–460 und 592–622 fehlen.
Isoform Tau-D: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 45–73, 74–102, 125–375 und 395–460 fehlen.
Isoform Tau-E: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 74–102, 125–375 und 395–460 fehlen.
Isoform Tau-F: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 125–375 und 395–460 fehlen.
Isoform Tau-G: Diese Isoform unterscheidet sich von PNS-tau dadurch, dass die Aminosäuren an den Positionen folgendermaßen verändert sind (die Positionen sind jeweils auf die Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren bezogen): 502-502: S → SATKQVQRRPPPAGPRSERThe aptamer according to the invention specifically binds to human tau protein or a fragment thereof. The tau protein binds to microtubule structures, is involved in the regulation of the cytoskeleton and is encoded by the MAPT gene. In the human central nervous system, a total of 9 isoforms of the human tau protein occur:
Isoform PNS-tau: This isoform comprises the canonical sequence resulting from the MAPT gene. For the purposes of the present invention, this sequence, with amino acids 2 to 758, is preferably understood by the term "human tau protein".
Isoform Fetal-tau: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (the positions are each related to the full-length sequence of the human tau protein of 758 amino acids): 45-73, 74-102 , 125-375, 395-460 and 592-622 are missing.
Isoform Tau-A: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (the positions are each related to the full-length sequence of the 758 amino acid human tau protein): 1-44: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLK → MLRALQQRKR ; 45-73, 74-102, 103-104, 125-375, 395-460 and 592-622 are missing.
Isoform Tau-B: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (positions are each related to the full-length sequence of the 758 amino acid human tau protein): 74-102, 125-375 , 395-460 and 592-622 are missing.
Isoform Tau-C: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (positions are each related to the full-length sequence of the human tau protein of 758 amino acids): 125-375, 395-460 and 592-622 are missing.
Isoform Tau-D: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (positions are each related to the full-length sequence of the 758 amino acid human tau protein): 45-73, 74-102 , 125-375 and 395-460 are missing.
Isoform Tau-E: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (positions are each related to the full-length sequence of the 758 amino acid human tau protein): 74-102, 125-375 and 395-460 are missing.
Isoform Tau-F: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (the positions are each related to the full-length sequence of the 758 amino acid human tau protein): 125-375 and 395-460 absence.
Isoform Tau-G: This isoform differs from PNS-tau in that the amino acids at the positions are altered as follows (the positions are each related to the full-length sequence of the 758 amino acid human tau protein): 502-502: S → SATKQVQRRPPPAGPRSER

Das erfindungsgemäße Aptamer kann bevorzugt an solche Isoformen des humanen Tau-Proteins binden, die im menschlichen Gehirn vorkommen, dies sind insbesondere Fetal-Tau, Tau-B, Tau-C, Tau-D, Tau-E und Tau-F.The aptamer according to the invention can preferentially bind to those isoforms of the human tau protein that are present in the human brain, these are in particular fetal-tau, tau-B, tau-C, tau-D, tau-E and tau-F.

Das erfindungsgemäße Aptamer bindet besonders bevorzugt spezifisch an ein Peptid des humanen Tau-Proteins mit der SEQ ID Nr. 1, welches die Aminosäuren 226 bis 240 umfasst oder daraus besteht, wobei die Positionen jeweils auf die Aminosäuresequenz der Isoform Tau-441 (= Tau-F, längste der 6 Tau-Isoformen, die im menschlichen Gehirn vorkommen) bezogen sind, oder an ein Fragment davon.The aptamer according to the invention particularly preferably binds specifically to a peptide of the human tau protein having SEQ ID No. 1 which comprises or consists of amino acids 226 to 240, the positions in each case being based on the amino acid sequence of the isoform Tau-441 (= tau). F, longest of the 6 tau isoforms found in the human brain), or a fragment thereof.

Unter einem Fragment des humanen Tau-Proteins wird jede Aminosäuresequenz verstanden, die mindestens 6, bevorzugt mindestens 10, Aminosäuren umfasst und identisch ist mit einer Sequenz aus einer der 9 Isoformen, bevozugt identisch mit einer Sequenz aus der Volllängensequenz des humanen Tau-Proteins mit 758 Aminosäuren, besonders bevorzugt identisch ist mit einer Sequenz aus der SEQ ID Nr. 1.By a fragment of the human tau protein is meant any amino acid sequence comprising at least 6, preferably at least 10, amino acids and identical to a sequence of one of the 9 isoforms, preferably identical to a sequence of the full length sequence of the human tau protein of 758 Amino acids, more preferably identical to a sequence of SEQ ID NO. 1.

Die Bindungsfähigkeit der selektierten Aptamere wird durch die Affinität (Sensitivität) der Bindung (ausgedrückt durch die Dissoziationskonstante K_D) beschrieben. In einer bevorzugten Ausführungsform der Erfindung weisen die erfindungsgemäßen Aptamere an humanem Tau-Protein, bevorzugt an dem Peptid mit der SEQ ID Nr. 1 oder einem Fragment davon, eine K_D von nicht mehr als 500 nM auf, vorzugsweise nicht mehr als 100 nM, besonders bevorzugt von 0.001 bis 500 nM, ganz besonders bevorzugt von 0.01 bis 100 nM.The binding ability of the selected aptamers is described by the affinity (sensitivity) of the binding (expressed by the dissociation constant K _D ). In a preferred embodiment of the invention, the aptamers according to the invention on human tau protein, preferably on the peptide with SEQ ID No. 1 or a fragment thereof, have a K _D of not more than 500 nM, preferably not more than 100 nM, particularly preferably from 0.001 to 500 nM, very particularly preferably from 0.01 to 100 nM.

Die Erfindung betrifft auch eine pharmazeutische Zusammensetzung, die mindestens eines der erfindungsgemäßen Aptamere umfasst, vorzugsweise zusammen mit mindestens einem pharmazeutisch akzeptablen, annehmbaren oder verträglichen Hilfsstoff und/oder Träger. Eine pharmazeutische Zusammensetzung im Sinne der Erfindung ist jedes Mittel, welches in der Diagnose und/oder Therapie von Patienten eingesetzt werden kann, die zumindest zeitweise eine Erkrankung, eine pathogene Modifikation des Gesamtzustandes bzw. des Zustandes einzelner Teile des Patientenorganismus zeigen.The invention also relates to a pharmaceutical composition comprising at least one of the aptamers of the invention, preferably together with at least one pharmaceutically acceptable, acceptable or acceptable excipient and / or carrier. A pharmaceutical composition within the meaning of the invention is any agent which can be used in the diagnosis and / or therapy of patients who at least temporarily exhibit a disease, a pathogenic modification of the overall state or condition of individual parts of the patient organism.

Die pharmazeutische Zusammensetzung kann das Aptamer als ein akzeptables Salz umfassen. Hierbei kann es sich beispielsweise um Salze anorganischer Säuren, wie z. B. der Phosphorsäure, oder um Salze organischer Säuren handeln. Die jeweilige Dosis bzw. der Dosisbereich für die Gabe der erfindungsgemäßen pharmazeutischen Zusammensetzung ist groß genug, um den gewünschten diagnostischen oder therapeutischen Effekt der Bindung an humanes Tau-Protein oder ein Fragment davon zu erreichen. Im Allgemeinen wird die Dosis mit dem Alter, der Konstitution und dem Geschlecht des Patienten variieren sowie die Schwere der Erkrankung berücksichtigen. Es versteht sich, dass die spezifische Dosis, Häufigkeit und Dauer der Verabreichung darüber hinaus von einer Vielzahl an Faktoren abhängen, wie z. B. der Bindungsfähigkeit der Aptamere, Ernährungsgewohnheiten des zu behandelnden Individuums, Art der Verabreichung, Ausscheidungsrate und Kombination mit anderen Medikamenten. Die individuelle Dosis kann sowohl in Bezug auf die primäre Erkrankung als auch in Bezug auf das Eintreten eventueller Komplikationen eingestellt werden. Die exakte Dosis ist durch einen Fachmann mit bekannten Mitteln und Methoden feststellbar.The pharmaceutical composition may comprise the aptamer as an acceptable salt. These may be, for example, salts of inorganic acids, such as. As the phosphoric acid, or salts of organic acids. The particular dose or dose range for the administration of the pharmaceutical composition of the invention is large enough to achieve the desired diagnostic or therapeutic effect of binding to human tau protein or a fragment thereof. In general, the dose will vary with the age, constitution and gender of the patient, as well as the severity of the disease. It should also be understood that the specific dose, frequency and duration of administration will depend on a variety of factors, such as: B. the binding ability of aptamers, dietary habits of the individual to be treated, route of administration, excretion rate and combination with other drugs. The individual dose can be adjusted both in relation to the primary illness and in relation to the occurrence of possible complications. The exact dose can be determined by a person skilled in the art by known means and methods.

In einer Ausführungsform der Erfindung werden die Aptamere in einer Dosis von 0.01 mg bis 1 g pro Kilogramm Körpergewicht und pro Tag verabreicht. Vorzugsweise werden jedoch Dosen von 20 bis 60 mg pro Kilogramm Körpergewicht und pro Tag verabreicht.In one embodiment of the invention, the aptamers are administered at a dose of from 0.01 mg to 1 g per kilogram of body weight per day. Preferably, however, doses of 20 to 60 mg per kilogram of body weight and per day are administered.

Zur Unterstützung der medizinischen Wirkung kann die pharmazeutische Zusammensetzung in einer bevorzugten Ausführungsform der Erfindung auch weitere Wirkstoffe umfassen, wie z. B. eines oder mehrere verschiedene Aptamere und/oder Antikörper.To support the medical effect, the pharmaceutical composition in a preferred embodiment of the invention may also comprise other active ingredients, such as. B. one or more different aptamers and / or antibodies.

Erfindungsgemäß ist das Aptamer und/oder die pharmazeutische Zusammensetzung zur diagnostischen oder therapeutischen Behandlung von Erkrankungen geeignet, die mit einer Veränderung im Tau-Proteinspiegel, bevorzugt in humanem Tau-Proteinspiegel, einhergeht. Erkrankungen im Sinne der vorliegenden Erfindung, die mit einem veränderten Tau-Proteinspiegel einhergehen, umfassen Erkrankungen mit einem massiven akuten Neuronenzerfall, wie beispielsweise Hirninfarkte und/oder Schlaganfall, Erkrankungen mit chronischem Neuronenuntergang, Erkrankungen mit atropisch-degenerativen Prozessen und Taupathien. Bevorzugte Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen sind Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.According to the invention, the aptamer and / or the pharmaceutical composition is suitable for the diagnostic or therapeutic treatment of diseases associated with a change in the tau protein level, preferably in human tau protein level. Diseases in the context of the present invention that are associated with an altered tau protein level include diseases with a massive acute neuronal decay, such as, for example, brain infarcts and / or strokes, diseases with chronic neuronal desease, diseases with atropic-degenerative processes, and taupathies. Preferred disorders associated with a change in tau protein levels are cerebral infarction, stroke, Creutzfeldt-Jakob disease, Taupathia, Alzheimer's Disease, Corticobasal Degeneration, Agryophilic Grain disease, Pick's disease, Frontotemporal dementia, Parkinsonism of chromosome 17 (FTDP-17) and / or progressive supranuclear palsy.

Die pharmazeutische Zusammensetzung der vorliegenden Erfindung kann oral, transmucosal, rektal, pulmonal, enteral und/oder parenteral angewendet werden. Bevorzugt ist eine direkte Injektion in den Körper. Die gewählte Art der Verabreichung richtet sich nach der Indikation, der zu verabreichenden Dosis, Individuums-spezifischen Parametern etc. Insbesondere ermöglichen die verschiedenen Arten der Verabreichung eine ortspezifische Therapie, die Nebenwirkungen minimiert und die Wirkstoffdosis verringert. Bevorzugte Injektionen sind die intradermale, subkutane, intramuskuläre oder intravenöse Injektion. Die Applikation kann z. B. mit Hilfe sogenannter Impfpistolen, die die erfindungsgemäßen Aptamere mittels Goldkugeln in die Haut einbringen, oder mittels Spritzen, die die erfindungsgemäßen Aptamere unter die Haut oder in den Muskel einbringen, geschehen. Es ist auch möglich, das Aptamer als Aerosol bereitzustellen, welches von dem Organismus, bevorzugt einem humanen Patienten, inhaliert wird.The pharmaceutical composition of the present invention may be administered orally, transmucosally, rectally, pulmonarily, enterally and / or parenterally. Preferred is a direct injection into the body. The chosen mode of administration will depend on the indication, dose to be administered, individual-specific parameters, etc. In particular, the different modes of administration will allow for site-specific therapy that minimizes side effects and reduces the drug dose. Preferred injections are the intradermal, subcutaneous, intramuscular or intravenous injection. The application can z. Example, with the help of so-called Impfpistolen which bring the aptamers of the invention by means of gold balls in the skin, or by means of syringes, which bring the aptamers of the invention under the skin or into the muscle happen. It is also possible to provide the aptamer as an aerosol which is inhaled by the organism, preferably a human patient.

Um die protektive oder therapeutische Wirkung der erfindungsgemäßen Aptamere zu erhöhen, können den daraus hergestellten pharmazeutischen Zusammensetzungen pharmazeutisch verträgliche Hilfsstoffe, wie z. B. Adjuvantien, zugesetzt werden. im Sinne der Erfindung ist jede Substanz, die mit den erfindungsgemäßen Aptameren eine Wirkung ermöglicht, verstärkt oder modifiziert, ein Adjuvants. Bekannte Adjuvantien sind beispielsweise Aluminiumverbindungen, wie z. B. Aluminiumhydroxid oder Aluminiumphosphat, Saponine, wie z. B. QS 21, Muramyldipeptid oder Muramyltripeptid, Proteine, wie z. B. Gammainterferon oder TNF, MF 59, Phosphatdibylcholin, Squalen oder Polyole. Des Weiteren kann DNA, die eine immunstimulatorische Eigenschaft hat, oder die ein Protein mit Adjuvants-Effekt kodiert, wie z. B. ein Cytokin, parallel oder in einem Konstrukt appliziert werden.In order to increase the protective or therapeutic effect of the aptamers according to the invention, the pharmaceutical compositions prepared therefrom pharmaceutically acceptable excipients, such as. As adjuvants are added. For the purposes of the invention, any substance which allows, amplifies or modifies an effect with the aptamers according to the invention is an adjuvant. Known adjuvants are, for example, aluminum compounds, such as. As aluminum hydroxide or aluminum phosphate, saponins, such as. As QS 21, muramyl dipeptide or muramyl tripeptide, proteins such. Gamma interferon or TNF, MF 59, phosphate dibylcholine, squalene or polyols. Furthermore, DNA which has an immunostimulatory property or which encodes a protein with adjuvant effect, such as e.g. As a cytokine, be applied in parallel or in a construct.

Das pharmazeutische Mittel kann als Tablette, Kapsel, Pulver, Lösung, Dispersion oder Suspension vorliegen. Die Darreichungsformen des pharmazeutischen Mittels werden mit den üblichen festen oder flüssigen Trägerstoffen und/oder Verdünnungsmitteln und den üblicherweise eingesetzten Hilfsstoffen entsprechend der gewünschten Applikationsart in einer geeigneten Dosierung und in an sich bekannter Weise hergestellt.The pharmaceutical agent may be in the form of a tablet, capsule, powder, solution, dispersion or suspension. The dosage forms of the pharmaceutical agent are prepared with the usual solid or liquid carriers and / or diluents and the commonly used excipients according to the desired mode of administration in a suitable dosage and in a conventional manner.

Ein weiterer Gegenstand der Erfindung betrifft die Verwendung der erfindungsgemäßen Aptamere zur Diagnose oder Therapie von Erkrankungen, die mit einer Veränderung in humanem Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.Another object of the invention relates to the use of the aptamers according to the invention for the diagnosis or treatment of diseases associated with a change in human tau protein levels, in particular cerebral infarction, stroke, Creutzfeld-Jakob disease, Taupathien, Alzheimer's disease, corticobasal degeneration, Agryophilic Grain disease, Pick's disease, Frontotemporal dementia, Parkinsonism of chromosome 17 (FTDP-17) and / or progressive supranuclear palsy.

Noch ein weiterer Gegenstand der Erfindung betrifft die Verwendung dieser Aptamere zur Herstellung eines Medikaments zur Diagnose oder Therapie von Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese.Yet another object of the invention is the use of these aptamers for the manufacture of a medicament for the diagnosis or therapy of diseases associated with a change in tau protein levels, in particular cerebral infarction, stroke, Creutzfeldt-Jakob disease, tauopathies, Alzheimer's disease, corticobasal Degeneration, Agryophilic Grain Disease, Pick's Disease, Frontotemporal Dementia, Parkinsonism of chromosome 17 (FTDP-17) and / or progressive supranuclear palsy.

Unter dem Begriff ”Diagnose” wird, für die Zwecke der vorliegenden Erfindung, jedes planmäßige Vorgehen verstanden, welches die Erhebung von Befunden, Phänomenen oder Symptomen und/oder deren Klassifizierung zu einer Kategorie bzw. deren Interpretation umfasst. Insbesondere erfasst der Begriff ”Diagnose” die Erhebung und/oder Zuordnung von Befunden, Phänomenen oder Symptomen zu einem Krankheitsbegriff oder einer spezifischen Erkrankung.For the purposes of the present invention, the term "diagnosis" is understood to mean any planned procedure which comprises the collection of findings, phenomena or symptoms and / or their classification into a category or its interpretation. In particular, the term "diagnosis" covers the collection and / or assignment of findings, phenomena or symptoms to a disease concept or a specific disease.

So wie hierin verwendet, bezeichnet der Begriff ”Therapie” die Umkehrung, Linderung oder Hemmung des Fortschreitens einer Erkrankung, Störung oder eines Zustands oder eines oder mehrerer Symptome einer solchen Erkrankung, Störung oder eines solchen Zustands, auf welche dieser Begriff zutrifft. So wie hierin verwendet, kann ”Therapie” sich auch darauf beziehen, dass die Wahrscheinlichkeit oder Häufigkeit, mit der eine Erkrankung, Störung oder ein Zustand bei einem Säuger im Vergleich zu einer unbehandelten Kontrollpopulation oder im Vergleich zum gleichen Säuger vor der Behandlung auftritt, verringert wird. So wie hierin verwendet, kann ”Therapie” sich beispielsweise auch auf die Prävention einer Erkrankung, Störung oder eines Zustands beziehen und kann auch die Verzögerung oder Verhütung des Beginns einer Erkrankung, Störung oder eines Zustands oder die Verzögerung oder Verhütung der mit einer Erkrankung, Störung oder eines Zustands verbundenen Symptome umfassen. So wie hierin verwendet, kann ”Therapie” sich auch darauf beziehen, dass die Schwere einer Erkrankung, Störung oder eines Zustands oder von Symptomen, die mit einer solchen Erkrankung, Störung oder eines solchen Zustands verbunden sind, verringert wird, ehe der Säuger von der Erkrankung, Störung oder dem Zustand befallen wird. Eine solche Prävention oder Verringerung der Schwere einer Erkrankung, Störung oder eines Zustands vor dem Befallensein betrifft die Verabreichung der Zusammensetzung der vorliegenden Erfindung – wie hierin beschrieben – an ein Individuum, das zum Zeitpunkt der Verabreichung nicht von der Erkrankung, Störung oder dem Zustand befallen ist. So wie hierin verwendet, kann ”Therapie” sich auch darauf beziehen, dass das Wiederauftreten einer Erkrankung, Störung oder eines Zustands oder eines oder mehrerer mit einer solchen Erkrankung, Störung oder einem solchen Zustands verbundenen Symptome verhindert wird. So wie hierin verwendet, bezieht sich der Begriff ”therapeutisch” auf den Akt des Behandelns im Sinne der obigen Definition von ”Therapie”.As used herein, the term "therapy" refers to the inversion, alleviation or inhibition of the progression of a disease, disorder or condition or one or more symptoms of such disease, disorder or condition to which that term applies. As used herein, "therapy" may also refer to reducing the likelihood or frequency with which a disease, disorder, or condition occurs in a mammal compared to an untreated control population or compared to the same mammal prior to treatment becomes. For example, as used herein, "therapy" may also refer to the prevention of a disease, disorder or condition and may also delay or prevent the onset of a disease, disorder or condition, or the delay or prevention of disease, disorder or condition-related symptoms. As used herein, "therapy" may also refer to the Severity of a disease, disorder or condition or symptoms associated with such disease, disorder or condition, prior to the mammal being afflicted by the disease, disorder or condition. Such prevention or reduction in the severity of a disease, disorder, or condition prior to infestation relates to the administration of the composition of the present invention as described herein to an individual who is unaffected by the disease, disorder, or condition at the time of administration , As used herein, "therapy" may also refer to preventing the recurrence of a disease, disorder or condition, or one or more symptoms associated with such disease, disorder or condition. As used herein, the term "therapeutic" refers to the act of treating as defined above for "therapy."

Die vorliegende Erfindung bezieht sich auch auf ein Verfahren zur Diagnose oder Therapie von Erkrankungen, die mit einer Veränderung im Tau-Proteinspiegel einhergehen, insbesondere von Hirninfarkt, Schlaganfall, Creutzfeld-Jakob-Erkrankung, Taupathien, Morbus Alzheimer, kortikobasale Degeneration, Agryophilic grain disease, Morbus Pick, Frontotemporale Demenz, Parkinsonismus des Chromosoms 17 (FTDP-17) und/oder progressive supranukleäre Blickparese, wobei einem Patienten, der einer solchen Diagnose oder Therapie bedarf, eine wirksame Dosis des erfindungsgemäßen Aptamers oder der erfindungsgemäßen pharmazeutischen Zusammensetzung verabreicht wird.The present invention also relates to a method for diagnosing or treating diseases associated with a change in tau protein levels, in particular cerebral infarction, stroke, Creutzfeldt-Jakob disease, Taupathia, Alzheimer's Disease, Corticobasal Degeneration, Agryophilic Grain Disease, Pick's Disease, Frontotemporal Dementia, Parkinsonism of chromosome 17 (FTDP-17), and / or progressive supranuclear palsy, wherein a patient in need of such a diagnosis or therapy is administered an effective dose of the aptamer or pharmaceutical composition of the present invention.

Gemäß vorliegender Erfindung wird das erfindungsgemäße Aptamer bzw. die erfindungsgemäße pharmazeutische Zusammensetzung vorzugsweise in einer wirksamen Dosis verabreicht. Eine ”wirksame Dosis” ist die Dosis, die bei Verabreichung an einen Patienten eine messbare therapeutische Wirkung im Hinblick auf die fragliche Krankheit bewirkt.According to the present invention, the aptamer or the pharmaceutical composition according to the invention is preferably administered in an effective dose. An "effective dose" is that dose which, when administered to a patient, causes a measurable therapeutic effect with respect to the disease in question.

Die Erfindung bezieht sich ferner auf ein Verfahren zur Aufreinigung von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass eine Probe, die humanes Tau-Protein oder ein Fragment davon enthält, mit mindestens einem erfindungsgemäßen Aptamer kontaktiert wird, und der Komplex aus Aptamer und humanem Tau-Protein oder einem Fragment davon von der restlichen Probe abgetrennt wird. Ggf kann in einem weiteren, optionalen Schritt der Komplex in das humane Tau-Protein oder das gebundene Fragment davon und das erfindungsgemäße Aptamer gespalten werden, so dass Aptamer und humanes Tau-Protein (bzw. das Fragment davon) voneinander separiert werden können.The invention further relates to a method of purifying human tau protein or fragments thereof, characterized in that a sample containing human tau protein or a fragment thereof is contacted with at least one aptamer according to the invention, and the complex of aptamer and human tau protein or a fragment thereof is separated from the remainder of the sample. If appropriate, in a further, optional step the complex can be cleaved into the human tau protein or the bound fragment thereof and the aptamer according to the invention, so that aptamer and human tau protein (or the fragment thereof) can be separated from one another.

Eine Probe im Sinne der Erfindung ist ein bereitgestelltes oder durch Probenentnahme erhaltenes biologisches oder chemisches Material oder ein Teil bzw. eine kleine Menge eines solchen Materials, von dem angenommen wird, dass es humanes Tau-Protein oder ein Fragment davon umfasst, oder dessen Beschaffenheit chemisch, biologisch, klinisch oder ähnlich geprüft werden soll auf das Vorhandensein von humanem Tau-Protein oder einem Fragment davon. Eine Probe können insbesondere alle biologischen Materialien sein, die von Individuen isoliert worden sind, beispielsweise biologische Gewebe und Flüssigkeiten, zu denen u. a. Blut, Haut, Plasma, Serum, Lymphe, Urin, Gehirnflüssigkeit, CSF, Tränen, Abstriche, Gewebeproben, Organe und Tumore zählen. Vorliegend sind in Proben auch Bestandteile von Zellkulturen eingeschlossen. Die Probenentnahme erfolgt beispielsweise derart, dass die entnommene Teilmenge einem repräsentativen Durchschnitt der gesamten Menge entspricht. Die durch Untersuchung der Probe ermittelten Merkmale dienen der Beurteilung der durch die Probe erfassten Menge, die wiederum Rückschlüsse auf die Gesamtmenge, beispielsweise das Blut bzw. die Lymphe in einem Organismus, zulässt. Für die Untersuchung können die Proben vorbehandelt, wie z. B. durch Mischen, Zugabe von Enzymen oder Markern, oder aufgereinigt werden.A sample in the sense of the invention is a biological or chemical material provided or obtained by sampling, or a part or a small amount of such a material, which is assumed to comprise human tau protein or a fragment thereof, or its chemical nature , biologically, clinically or the like, for the presence of human tau protein or a fragment thereof. Specifically, a sample can be any biological material isolated from individuals, such as biological tissues and fluids, which may include, but are not limited to: a. Count blood, skin, plasma, serum, lymph, urine, brain fluid, CSF, tears, smears, tissue samples, organs and tumors. In the present case, components of cell cultures are also included in samples. The sampling takes place, for example, in such a way that the extracted subset corresponds to a representative average of the total amount. The characteristics determined by examination of the sample are used to assess the amount detected by the sample, which in turn allows conclusions to be drawn about the total amount, for example the blood or the lymph in an organism. For the examination, the samples can be pretreated, such. B. by mixing, addition of enzymes or markers, or purified.

Die Probe wird mit mindestens einem der erfindungsgemäßen Aptamere kontaktiert. Unter einer Kontaktierung im Sinne der Erfindung kann beispielsweise eine Inkubation der Probe und der darin enthaltenen Verbindungen mit einem erfindungsgemäßen Aptamer verstanden werden. Dabei ist es möglich die Zugänglichkeit von Verbindungen in der Probe z. B. durch chemische Lösungen und/oder physikalische Methoden, wie z. B. Erhitzen, zu verbessern.The sample is contacted with at least one of the aptamers according to the invention. For the purposes of the invention, a contacting may, for example, be understood as an incubation of the sample and the compounds contained therein with an aptamer according to the invention. It is possible the accessibility of compounds in the sample z. B. by chemical solutions and / or physical methods such. B. heating, to improve.

Nach einer Inkubationszeit werden die spezifischen Produkte, d. h. die Komplexe aus Aptamer und humanem Tau-Protein oder einem Fragment davon, von der restlichen Probenlösung abgetrennt. Geeignete Methoden sind dem Fachmann bekannt, wie z. B. Dialyse, Ultrafiltration, Gelfiltration, Fällung, Chromatographie, magnetische Trennung oder einfach Waschschritte. Der Komplex kann dabei immobilisiert vorliegen.After an incubation period, the specific products, i. H. the complexes of aptamer and human tau protein or a fragment thereof, separated from the remaining sample solution. Suitable methods are known in the art, such as. Dialysis, ultrafiltration, gel filtration, precipitation, chromatography, magnetic separation or simply washing steps. The complex can be immobilized.

Durch Veränderungen der für die Aptamerbindung erforderlichen definierten Bedingungen kann in einem weiteren, optionalen Schritt der Komplex getrennt werden. Hierzu können physiko-chemische Einwirkungen, wie z. B. eine Variation von Salzkonzentration oder pH oder eine hitzebedingte Denaturierung, angewendet werden. Abschließend ist eine weitere Reinigung der Verbindung möglich, wobei das Aptamer zuvor abgebaut werden kann, z. B. durch saure (thermische) Hydrolyse oder DNasen. Sofern das Aptamer immobilisiert ist, kann die aufgereinigte Verbindung eluiert werden, wie z. B. von einer Säule, die anschließend regeneriert und wiederverwendet wird.By changing the defined conditions required for the aptamer bond, the complex can be separated in a further, optional step. For this purpose, physico-chemical agents, such. A variation of salt concentration or pH or heat denaturation. Finally, a further purification of the compound is possible, wherein the aptamer can be degraded beforehand, z. By acidic (thermal) hydrolysis or DNases. Unless the aptamer is immobilized is, the purified compound can be eluted, such. From a column, which is subsequently regenerated and reused.

Erfindungsgemäß können die Aptamere auch an einer festen Phase immobilisiert vorliegen, vorzugsweise über ein Spacer-Molekül, das beispielsweise eine Linker-Nukleinsäure umfassen kann. Geeignete Methoden der Immobilisierung sind dem Fachmann bekannt, die sowohl mit einer kovalenten Kopplung als auch einer nicht-kovalenten Kopplung mittels geeigneter Affinitätspaare, wie z. B. Biotin/Streptavidin, einhergehen können. Die feste Phase können beispielsweise Platten, Streifen, Membranen, Filme, Gele oder Perlen sein. Geeignete Trägermaterialien sind anorganische und organische Polymere. Hierzu zählen Kunststoffe, vorzugsweise auf Basis von Polystyrol. Des weiteren sind Biopolymere, vorzugsweise Cellulose, Dextran, Agar, Agarose und Sephadex, die funktionalisiert sein können, insbesondere als Nitrocellulose oder Cyanbromid-Sephadex, Polymere im erfindungsgemäßen Verfahren. Aptamere können an Magnetic Beads gebunden werden, die z. B. Carboxy-terminierte, Amino-terminierte, Tosyl-aktivierte oder Epoxy-aktivierte Seitenketten tragen. Des Weiteren ist eine Kopplung von Magnetic Beads an die Desoxyribose der Aptamere möglich. Die Beispiele für Polymere sind nicht limitierend und andere Moleküle denkbar. Bevorzugte Kombinationen von geometrischer Form und Material sind Gele aus Biopolymeren, insbesondere Agarose, und Gelmatrices aus Dextran und Sephadex, die – beispielsweise in Säulen verpackt – Hohlräume definierter Porengröße ausbilden.According to the invention, the aptamers may also be immobilized on a solid phase, preferably via a spacer molecule, which may comprise, for example, a linker nucleic acid. Suitable methods of immobilization are known in the art, with both a covalent coupling and a non-covalent coupling by means of suitable affinity pairs, such as. B. biotin / streptavidin. The solid phase may be, for example, plates, strips, membranes, films, gels or beads. Suitable carrier materials are inorganic and organic polymers. These include plastics, preferably based on polystyrene. Furthermore, biopolymers, preferably cellulose, dextran, agar, agarose and Sephadex, which may be functionalized, in particular as nitrocellulose or cyanogen bromide Sephadex, polymers in the process according to the invention. Aptamers can be bound to magnetic beads, the z. B. carboxy-terminated, amino-terminated, tosyl-activated or epoxy-activated side chains. Furthermore, a coupling of magnetic beads to the deoxyribose of aptamers is possible. The examples of polymers are not limiting and other molecules are conceivable. Preferred combinations of geometric shape and material are gels of biopolymers, in particular agarose, and gel matrices of dextran and Sephadex, which form - for example, packed in columns - cavities defined pore size.

Die Erfindung betrifft auch ein Verfahren zum Nachweis von humanem Tau-Protein oder Fragmenten davon, dadurch gekennzeichnet, dass die zu untersuchende Probe mit mindestens einem erfindungsgemäßen Aptamer inkubiert und ein Bindungsereignis zwischen dem Aptamer und humanem Tau-Protein oder einem Fragment davon nachgewiesen wird.The invention also relates to a method for the detection of human tau protein or fragments thereof, characterized in that the sample to be examined is incubated with at least one aptamer according to the invention and a binding event between the aptamer and human tau protein or a fragment thereof is detected.

Die Probe und das Aptamer werden gemäß der vorherigen Lehre dieser Erfindung gewonnen, vorbereitet, wie z. B. immobilisiert, und inkubiert, im Ergebnis dessen das Aptamer und ein in der Probe vorhandenes Tau-Protein oder ein Fragment davon einen Komplex bilden. Das Bindungsereignis kann beispielsweise elektrochemisch, optisch, mikrogravimetrisch, kalorimetrisch oder piezoelektrisch nachgewiesen werden. Bei einem markierungsfreien Nachweis kann das Aptamer beispielsweise auf einer Oberfläche fixiert werden und die Änderung der Schichtdicke nach Anlagerung der Tau-Proteine oder der Fragmente davon mit einer der genannten Methoden bestimmt werden, wie z. B. optisch über eine Änderung des Evaneszenz-Feldes. Meist ist die Komplexierung nicht direkt detektierbar und wird vorzugsweise in einer Indikatorreaktion nach einer direkten oder indirekten Kopplung eines Komplexpartners mit einer gut nachweisbaren Markierungssubstanz sichtbar gemacht. Das bedeutet, entweder ist das verwendete Aptamer oder das Tau-Protein bzw. das Fragment davon mit einer Markierung versehen. Bevorzugt ist das Aptamer markiert.The sample and the aptamer are recovered according to the previous teaching of this invention, prepared, e.g. Immobilized and incubated, as a result of which the aptamer and a tau protein present in the sample or a fragment thereof form a complex. The binding event can be detected, for example, electrochemically, optically, microgravimetrically, calorimetrically or piezoelectrically. In the case of label-free detection, the aptamer can be fixed, for example, on a surface, and the change in the layer thickness after addition of the tau proteins or the fragments thereof can be determined by one of the methods mentioned, such as, for example, B. optically via a change in the evanescent field. In most cases, the complexation is not directly detectable and is preferably visualized in an indicator reaction after direct or indirect coupling of a complex partner with a well-detectable label. This means that either the aptamer used or the tau protein or the fragment thereof is provided with a label. Preferably, the aptamer is labeled.

In einer Ausgestaltung des Verfahrens der Erfindung kann die Markierung durch Lumineszenz, UV/VIS-Farbgebung, enzymatisch, elektrochemisch oder radioaktiv erfolgen. Lumineszenz betrifft die Emission von Licht. Im erfindungsgemäßen Verfahren finden vorzugsweise die Photolumineszenz, die Chemilumineszenz und die Biolumineszenz zum Nachweis der Markierung Anwendung. Bei der Photolumineszenz oder Fluoreszenz erfolgt die Anregung durch Absorption von Photonen. Bevorzugte Fluorophore sind Bisbenzimidazole, die kovalent an Aptamere oder Nachweisreagenzien auf DNA-Basis gekoppelt werden, Fluorescein, Acridinorange, Cy5, Cy3 oder Propidiumiodid. Die Auswertung geschieht visuell oder mit entsprechenden Messgeräten, z. B. im Fluoreszenzmikroskop oder Fluorimeter, oder durch Durchflusscytometrie, z. B. im Cytofluorimeter. Chemilumineszenz beschreibt die Emission sichtbaren Lichts als Folge einer chemischen Reaktion. Eine bevorzugte chemische Markierung zur Chemilumineszenz ist Luminol, das nach Oxidation, wie z. B. mit H₂O₂, eine intensive blaue Chemilumineszenz zeigt. Biolumineszenz beinhaltet die Emission sichtbaren Lichts als Folge einer durch das Enzym Luciferase katalysierten Redoxreaktion.In one embodiment of the method of the invention, the labeling can be effected by luminescence, UV / VIS coloring, enzymatically, electrochemically or radioactively. Luminescence refers to the emission of light. In the method according to the invention, photoluminescence, chemiluminescence and bioluminescence are preferably used for detection of the label. In photoluminescence or fluorescence excitation occurs by absorption of photons. Preferred fluorophores are bisbenzimidazoles covalently coupled to aptamers or DNA-based detection reagents, fluorescein, acridine orange, Cy5, Cy3 or propidium iodide. The evaluation is done visually or with appropriate measuring devices, eg. B. fluorescence or fluorimeter, or by flow cytometry, z. B. in the cytofluorimeter. Chemiluminescence describes the emission of visible light as a result of a chemical reaction. A preferred chemical label for chemiluminescence is luminol, which after oxidation, such. B. with H ₂ O ₂ , an intense blue chemiluminescence shows. Bioluminescence involves the emission of visible light as a result of a redox reaction catalyzed by the enzyme luciferase.

Darüber hinaus kann der Nachweis mit weiteren Enzymen als Markierungssubstanzen geführt werden, die Substrate zu farbigen Produkten umsetzen, vorzugsweise Peroxidase, Chloramphenicol Acetyltransferase (CAT), GFP (sog. ”green fluorescent protein”), Glutathion-S-Transferase (GST), Luciferase, β-Galactosidase oder Alkalische Phosphatase. Beispielsweise wird das farblose Substrat X-Gal durch die Aktivität der β-Galactosidase zu einem blauen Produkt umgesetzt, dessen Farbgebung visuell erfasst werden kann. Die Alkalische Phosphatase (AP) setzt 5-Brom-4-Chlor-3-Indolylphosphat (BCIP oder X-Phosphat) und Nitroblau-Tetrazoliumsalz (NBT) farbig um. Die Farbstoffe fallen dabei in unmittelbarer Nähe der AP-Moleküle aus und färben die Umgebung der gebundenen Verbindungen dunkelviolett an. Die Peroxidase katalysiert z. B. die Oxidation von ABTS (2,2'-Azino-bis-[3-ethylbenzthiazolin-6-sulfonsäure]) in Gegenwart von H₂O₂. Aufgrund der Enzymstabilität und einer Vielzahl an möglichen Substraten ist die Meerrettich-Peroxidase bevorzugt.In addition, the detection can be performed with other enzymes as labeling substances that convert substrates into colored products, preferably peroxidase, chloramphenicol acetyltransferase (CAT), GFP (so-called "green fluorescent protein"), glutathione-S-transferase (GST), luciferase , β-galactosidase or alkaline phosphatase. For example, the colorless substrate X-Gal is converted by the activity of β-galactosidase to a blue product whose color can be visually detected. The alkaline phosphatase (AP) converts 5-bromo-4-chloro-3-indolyl phosphate (BCIP or X-phosphate) and nitroblue tetrazolium salt (NBT) in color. The dyes precipitate in the immediate vicinity of the AP molecules and color the environment of the bound compounds dark purple. The peroxidase catalyzes z. B. the oxidation of ABTS (2,2'-azino-bis [3-ethylbenzthiazoline-6-sulfonic acid]) in the presence of H ₂ O ₂ . Horseradish peroxidase is preferred because of its enzyme stability and a variety of possible substrates.

In Enzymelektroden wirken immobilisierte Enzyme als Rezeptor und ein elektrochemisches Messsystem fungiert als Transduktor. Im Sinne der vorliegenden Erfindung können die Enzyme sowohl auf Aptameren oder Nachweisreagenzien für die Inkubationskomplexe, oder auf einem externen Träger immobilisiert sein. Die Enzyme liefern durch Bildung oder Abbau elektrodenaktiver Substrate ein direktes chemisches Signal, das vom Transduktor in ein elektrisches Signal umgewandelt wird. Die Substrate befinden sich konträr zu den immobilisierten Enzymen an einem externen Träger, oder sind kovalent an Aptamere der vorliegenden Erfindung oder Nachweisreagenzien der Komplexe gekoppelt. Bevorzugte Systeme basieren auf spezifischen Oxidasen, wie z. B. der Glucoseoxidase, wobei Coenzyme über Redoxmediatoren die Verknüpfung mit elektrochemischen oder optischen Sensorelementen gewährleisten. In enzyme electrodes immobilized enzymes act as a receptor and an electrochemical measurement system acts as a transductor. For the purposes of the present invention, the enzymes may be immobilized on both aptamers or detection reagents for the incubation complexes, or on an external support. The enzymes produce a direct chemical signal through the formation or degradation of electrode-active substrates, which is converted by the transducer into an electrical signal. The substrates are in contrast to the immobilized enzymes on an external support, or are covalently coupled to aptamers of the present invention or detection reagents of the complexes. Preferred systems are based on specific oxidases, such. As the glucose oxidase, wherein coenzymes via redox mediators ensure the linkage with electrochemical or optical sensor elements.

Alternativ kann der Nachweis auch radioaktiv mit radioaktiven Isotopen erfolgen, vorzugsweise ³H, ¹⁴C, ³²P, ³³P, ³⁵S oder ¹²⁵I, besonders bevorzugt ³²P, ³³P oder ¹²⁵I. Bei der Sintillationszählung wird z. B. ein Molekülcocktail durch radioaktive β-Strahlung angeregt. Die beim Übergang in den Grundzustand als Licht freigesetzte Energie wird durch einen Photoelektronenvervielfacher verstärkt und gezählt.Alternatively, the detection can be carried out radioactively with radioactive isotopes, preferably ³ H, ¹⁴ C, ³² P, ³³ P, ³⁵ S or ¹²⁵ I, particularly preferably ³² P, ³³ P or ¹²⁵ I. In the Sintillationszählung z. B. a molecule cocktail excited by radioactive β-radiation. The energy released as light upon transition to the ground state is amplified and counted by a photomultiplier tube.

Die Aptamere können auch mit Digoxigenin oder Biotin markiert sein, die beispielsweise durch Antikörper oder Streptavidin gebunden werden, die wiederum eine Markierung tragen können, wie z. B. ein Enzymkonjugat. Ist das Aptamer an ein Enzym gekoppelt, spricht man vom ELONA (enzyme-linked oligonucleotide assay). Die vorherige kovalente Verknüpfung (Konjugation) eines Aptamers mit einem Enzym kann auf verschiedene bekannte Arten erfolgen. Der Nachweis der Aptamer-Bindung kann auch radioaktiv in einem dem RIA (radioactive immunoassay) entsprechenden Assay mit radioaktiven Isotopen, vorzugsweise mit ¹²⁵I, oder durch Fluoreszenz in einem dem FIA (Fluoroimmunoassay) entsprechenden Assay mit Fluorophoren, vorzugsweise mit Fluorescein oder FITC, erfolgen.The aptamers may also be labeled with digoxigenin or biotin, which are bound for example by antibodies or streptavidin, which in turn may carry a label, such as. B. an enzyme conjugate. If the aptamer is coupled to an enzyme, this is called ELONA (enzyme-linked oligonucleotide assay). The prior covalent attachment (conjugation) of an aptamer with an enzyme can be accomplished in several known ways. Detection of aptamer binding may also be done radioactively in an RIA (radioactive immunoassay) -suited radioactive isotope assay, preferably ¹²⁵ I, or by fluorescence in a FIA (fluoroimmunoassay) assay with fluorophores, preferably fluorescein or FITC ,

Alle genannten Methoden schließen intensive Waschschritte ein, um ungebundene und/oder unspezifisch gebundene Aptamere und/oder Nachweisreagenzien abzutrennen. Die Durchführung sämtlicher Nachweisverfahren ist dem Fachmann bekannt. Der direkte Nachweis der Markierung ist im vorliegenden Verfahren der Erfindung bevorzugt, insbesondere der direkte Nachweis durch Fluoreszenz.All of these methods involve intensive washing steps to separate unbound and / or unspecifically bound aptamers and / or detection reagents. The implementation of all detection methods is known to the person skilled in the art. Direct detection of the label is preferred in the present method of the invention, especially direct detection by fluorescence.

In einer weiteren Ausgestaltung des Verfahrens wird der Nachweis in-situ durchgeführt. Diese Umsetzung erfordert einen geeigneten Inkubationsraum, auf dem der Nachweis einfach durchgeführt und sichtbar gemacht werden kann. Hierzu wird vorteilhaft ein fester Träger verwendet, der es ermöglicht, Probe, Aptamere und ggf. Nachweisreagenzien der Komplexe zu fixieren. Die Aptamere können sowohl vor oder nach der Probe auf den festen Träger aufgebracht werden. Methoden der Immobilisierung vorgenannter Aptamere sind dem Fachmann bekannt und werden vorzugsweise nicht in-situ, sondern während oder im Anschluss an die Produktion des festen Trägers durchgeführt. Für den Nachweis kommen beispielsweise ein visueller Farbnachweis oder ein elektrochemischer Nachweis in Frage. Im Farbnachweis können die Aptamere markiert sein, so dass direkt im Anschluss an die Inkubation ein Ablesen und Auswerten realisiert werden kann.In a further embodiment of the method, the detection is carried out in situ. This reaction requires a suitable incubation space on which the detection can be easily performed and visualized. For this purpose, a solid support is advantageously used, which makes it possible to fix sample, aptamers and, if necessary, detection reagents of the complexes. The aptamers can be applied to the solid support either before or after the sample. Methods of immobilization of the aforementioned aptamers are known to the person skilled in the art and are preferably carried out not in situ but during or after the production of the solid support. For example, a visual color detection or an electrochemical detection can be used for the detection. The aptamers can be marked in the color proof, so that a reading and evaluation can be realized directly after the incubation.

Die Erfindung betrifft auch die Verwendung der erfindungsgemäßen Aptamere zur Aufreinigung und/oder zum Nachweis von humanem Tau-Protein oder Fragmenten davon. Das erfindungsgemäße Aptamer ist insbesondere zur Affinitätsreinigung und/oder Affinitätschromatographie geeignet. Das erfindungsgemäße Aptamer kann auch als Rezeptorelement für Biosensoren, in der klinischen Analytik, Umweltanalytik und/oder Prozessüberwachung der pharmazeutischen und chemischen Industrie vorteilhaft eingesetzt werden.The invention also relates to the use of the aptamers according to the invention for purifying and / or detecting human tau protein or fragments thereof. The aptamer according to the invention is particularly suitable for affinity purification and / or affinity chromatography. The aptamer according to the invention can also be used advantageously as a receptor element for biosensors, in clinical analysis, environmental analysis and / or process monitoring of the pharmaceutical and chemical industries.

Die Erfindung lehrt des Weiteren einen Kit, der mindestens eines der erfindungsgemäßen Aptamere umfasst. Neben dem erfindungsgemäßen Aptamer kann der Kit weitere aktive Stoffe und/oder Hilfsstoffe enthalten. Der Kit kann gegebenenfalls Verbrauchsmaterialien wie z. B. Behälter, Reaktionsgefäße und/oder Küvetten enthalten, die für die Lagerung und/oder die Nachweisreaktion geeignet sind.The invention further teaches a kit comprising at least one of the aptamers of the invention. In addition to the aptamer according to the invention, the kit may contain further active substances and / or auxiliaries. The kit may be suitable for consumables such. As containers, reaction vessels and / or cuvettes are suitable for storage and / or the detection reaction.

Im Rahmen der vorliegenden Erfindung wurden also erstmalig Aptamere bereitgestellt, die an humanes Tau-Protein bzw. Fragmente davon binden. Bei den erfindungsgemäßen Aptameren handelt es sich um Aptamere, deren Sequenzen bisher nicht beschrieben sind. Die Aptamere zeichnen sich durch eine hohe Affinität und eine ausgeprägte Spezifität für humanes Tau-Protein aus. Diese Eigenschaften bilden die Grundlage für eine zuverlässige Erkennung, womit das Fehlen von Kreuzreaktivitäten eingeschlossen ist, und einen reproduzierbaren Nachweis von humanem Tau-Protein oder Fragmenten davon. Die Affinität und Spezifität der erfindungsgemäßen Aptamere ist damit grundsätzlich mit denen von Antikörpern vergleichbar oder sogar besser. Die erfindungsgemäß zur Verfügung gestellten Aptamere können kostengünstig in-vitro hergestellt werden. Im Vergleich zur Antikörpertechnologie beispielsweise werden keine Versuchstiere für Immunisierungszwecke benötigt. Die Aptamere auf DNA-Basis besitzen auch eine hohe Stabilität und sind nicht zuletzt aufgrund ihrer geringen Größe gut zu handhaben.In the context of the present invention, therefore, aptamers have been provided for the first time which bind to human tau protein or fragments thereof. The aptamers according to the invention are aptamers whose sequences have hitherto not been described. The aptamers are characterized by a high affinity and a pronounced specificity for human tau protein. These properties provide the basis for reliable detection, including the lack of cross-reactivity, and reproducible detection of human tau protein or fragments thereof. The affinity and specificity of the aptamers according to the invention is therefore basically comparable or even better than those of antibodies. The aptamers provided according to the invention can be produced inexpensively in vitro. For example, in comparison to antibody technology, no experimental animals are used for immunization purposes needed. The DNA-based aptamers also have high stability and are easy to handle, not least because of their small size.

Die erfindungsgemäßen Aptamere können einzeln oder in Mischungen enthaltend mehrere verschiedene erfindungsgemäße Aptamere verwendet werden.The aptamers according to the invention can be used individually or in mixtures containing a plurality of different aptamers according to the invention.

Die erfindungsgemäßen Aptamere können auch in Kombination mit anderen Substanzen verwendet werden, die spezifisch an Zielstrukturen binden können, wie z. B. andere Aptamere oder Antikörper. Solche Kombinationen können in Assays zum Nachweis von Zielstrukturen zum Einsatz kommen, beispielsweise in Form von sogenannten ”sandwich”-Assays bei denen ein spezifischer Binder dazu dient die Zielstruktur zu isolieren und der zweite Binder zum Nachweis von isolierten Zielstrukturen verwendet wird. Solche Assays können beispielsweise als ELISA, ELONA, RIA oder Streifen-Assays ausgebildet sein, wobei das erfindungsgemäße Aptamer gegebenenfalls an einem festen Träger immobilisiert vorliegen kann.The aptamers according to the invention can also be used in combination with other substances which can specifically bind to target structures, such as. B. other aptamers or antibodies. Such combinations can be used in assays to detect target structures, for example in the form of so-called "sandwich" assays, where a specific binder serves to isolate the target structure and the second binder is used to detect isolated target structures. Such assays may, for example, be in the form of ELISA, ELONA, RIA or strip assays, the aptamer of the invention optionally being immobilized on a solid support.

Die erfindungsgemäßen Aptamere können insbesondere in der Differentialdiagnostik der oben genannten Erkrankungen, bevorzugt in der Differentialdiagnostik der Creutzfeldt-Jakob-Erkrankung und/oder Alzheimer eingesetzt werden. Bei der Creutzfeldt-Jakob-Erkrankung wurde beobachtet, dass im Liquor das Gesamt-Tau-Protein höher ist als das Phospho-Tau. Bei Alzheimer wurde ein erhöhter Tau-Protein-Spiegel und erniedrigter Aβ42-Spiegel in CSF gefunden. Der Quotient Tau/Aβ42 kündigt schon bei asymptomatischen Probanden eine zukünftige Demenz-Erkrankung an.The aptamers according to the invention can be used in particular in the differential diagnosis of the abovementioned diseases, preferably in the differential diagnosis of Creutzfeldt-Jakob disease and / or Alzheimer's disease. In Creutzfeldt-Jakob disease, it has been observed that in CSF the total tau protein is higher than the phospho-tau. In Alzheimer's disease, increased tau protein levels and decreased levels of Aβ42 were found in CSF. The quotient Tau / Aβ42 already indicates asymptomatic subjects a future dementia disease.

Die erfindungsgemäßen Aptamere können auch gemeinsam mit Antikörpern eingesetzt werden. Beispielsweise zur Differentialdiagnostik, wobei für verschiedene Formen/Fragmente der nachzuweisenden Zielstrukturen entweder Aptamere oder Antikörper verwendet werden. Ebenso können erfindungsgemäße Aptamere und Antikörper in Sandwich-Assays kombiniert werden. Dann sind ein Aptamer und ein Antikörper in der Lage, gleichzeitig an ein Zielmolekül (Tau Protein oder Fragment) zu binden. Beispielsweise dient das (immobilisierte) Aptamer dazu, das Zielmolekül zu binden, und der Antikörper trägt eine Markierung, so dass nach seiner Bindung an das Zielmolekül ein Signal erzeugt wird. Ebenso ist es möglich, den Antikörper zur Zielmolekül-Bindung und das Aptamer für den Nachweis zu nutzen.The aptamers according to the invention can also be used together with antibodies. For example, for differential diagnosis, wherein for different forms / fragments of the target structures to be detected either aptamers or antibodies are used. Likewise, aptamers and antibodies according to the invention can be combined in sandwich assays. Then an aptamer and an antibody are able to simultaneously bind to a target molecule (tau protein or fragment). For example, the (immobilized) aptamer serves to bind the target molecule and the antibody carries a label to generate a signal upon its binding to the target molecule. It is also possible to use the antibody for target molecule binding and the aptamer for the detection.

Im Folgenden wird die Erfindung anhand von Ausführungsbeispielen näher erläutert.In the following the invention will be explained in more detail by means of exemplary embodiments.

Figuren:Characters:

1. zeigt schematisch den Aufbau der verwendeten synthetischen single stranded (ss) DNA-Bibliothek. 1 , shows schematically the structure of the synthetic single stranded (ss) DNA library used.

2. zeigt den SELEX-Verlauf zur Selektion von DNA-Aptameren, spezifisch für das Tau-Peptid Tau226-240. Darstellung der Menge an targetgebundener ssDNA, eluiert von den entsprechenden Tau-modifizierten Streptavidin-Magnetic Beads im Target-Selektionsschritt jeder SELEX-Runde. Außerdem wurde ein Negativ-Selektionsschritt in jeder Runde durchgeführt und zusätzlich ein Subtraktionsschritt in Runde 10, 11 und 12. 2 , shows the SELEX course for the selection of DNA aptamers, specific for the tau peptide Tau226-240. Preparation of the amount of target-bound ssDNA eluted from the corresponding tau-modified streptavidin magnetic beads in the target selection step of each SELEX round. In addition, a negative selection step was performed every round, and additionally a subtraction step in rounds 10, 11, and 12.

3. zeigt vergleichende Bindungsversuche mit ausgewählten Aptamer-Klonen. 3 , shows comparative binding experiments with selected aptamer clones.

4. zeigt die Sättigungskurve von Aptamer-Klon #5/60. 4 , shows the saturation curve of aptamer clone # 5/60.

Ausführungsbeispiele:EXAMPLES

Die Tau-spezifischen Aptamere wurden unter Anwendung des FluMag-SELEX-Prozesses, einer in vitro Selektions- und Amplifikationsmethode, selektiert. Der FluMag-SELEX-Prozess ist ein fluoreszenzkontrollierter Selektionsprozess zur Gewinnung von ssDNA Aptameren für ein spezifisches Target. Die Targetmoleküle werden dabei auf Magnetic Beads, verfügbar mit verschieden funktionalisierten Oberflächen, immobilisiert. Der FluMag-SELEX-Prozesses ist beschrieben in Stoltenburg et al., ”FluMag-SELEX as an advantageous method for DNA aptamer selection”, Anal Bioanal Chem. 2005; 383(1): 83–91 .The tau-specific aptamers were selected using the FluMag SELEX process, an in vitro selection and amplification method. The FluMag SELEX process is a fluorescence-driven selection process for obtaining ssDNA aptamers for a specific target. The target molecules are immobilized on magnetic beads, available with differently functionalized surfaces. The FluMag SELEX process is described in Stoltenburg et al., "FluMag-SELEX as an advantageous method for DNA aptamer selection", Anal Bioanal Chem. 2005; 383 (1): 83-91 ,

Ausgangspunkt des FluMag-SELEX-Prozesses ist im vorliegenden Fall eine synthetische ssDNA-Bibliothek, deren Aufbau in 1 dargestellt ist und deren Oligonukleotide jeweils eine Länge von 76 nt besitzen. Diese sind außerdem durch eine innere Region von 40 nt mit variabler Nukleotidabfolge charakterisiert, welche von zwei unterschiedlich definierten, konstanten Sequenzen (Primerbindungsorte) flankiert wird. Die ssDNA-Bibliothek stellt somit einen komplexen Pool von ca. 10¹⁵ verschiedenen Oligonukleotiden dar, der in der ersten SELEX-Runde direkt zum Einsatz kommt, und aus dem über weitere, aufeinanderfolgende SELEX-Runden diejenigen Oligonukleotide (Aptamere) selektiert und angereichert werden, die besonders gut an das vorgegebene Zielmolekül (z. B. Tau-Peptid) binden.The starting point of the FluMag-SELEX process in the present case is a synthetic ssDNA library whose structure in 1 is shown and their oligonucleotides each have a length of 76 nt. These are further characterized by a 40 nt internal region of variable nucleotide sequence flanked by two differently defined, constant sequences (primer binding sites). The ssDNA library thus represents a complex pool of approximately 10 ¹⁵ different oligonucleotides, which in The first SELEX round is used directly, and from which, over further, consecutive SELEX rounds, those oligonucleotides (aptamers) are selected and enriched which bind particularly well to the given target molecule (eg tau peptide).

Eine SELEX-Runde besteht im Wesentlichen aus 5 Schritten. Zu Beginn einer Runde werden die Oligonukleotide in Bindungspuffer (100 mM NaCl, 20 mM Tris/HCl, pH 7.6, 2 mM MgCl₂, 5 mM KCl, 1 mM CaCl₂, 0,02% Tween20) zunächst thermisch equilibriert (90°C 8 min, Eis 10 min, RT 3–6 min). Anschließend werden die Oligonukleotide sofort in einer Bindungsreaktion (Target-Selektionsschritt) zusammen mit dem Target, immobilisiert auf Magnetic Beads, inkubiert (21°C, 30 min, schütteln). Alle Oligonukleotide, welche nicht an das Target gebunden haben, werden dann in mehreren Waschschritten (Bindungspuffer) entfernt. Durch die Nutzung von Magnetic Beads zur Targetimmobilisierung sind eine effiziente Trennung der entstandenen Bindungskomplexe von den ungebundenen Oligonukleotiden sowie stringente Waschbedingungen möglich. Danach erfolgt die Elution der an das Target gebundenen Oligonukleotide durch eine Hitzebehandlung (in Bindungspuffer, 80°C, 2 × 7 min). Der nächste Schritt umfaßt die Amplifikation der gesamten eluierten ssDNA mittels PCR. Dabei werden durch die Wahl 5'-modifizierter Primer einerseits eine Fluorescein-Markierung an den relevanten DNA-Strang angefügt und andererseits der Gegenstrang durch einen HEGL-Spacer + zusätzliche Nukleotide (dA₂₀) verlängert. Diese Einführung eines Längenunterschiedes zwischen beiden DNA-Strängen während der PCR ermöglicht im Anschluß eine Reinigung der relevanten, nunmehr Fluorescein-markierten ssDNA aus den dsDNA-PCR-Produkten über eine denaturierende PAGE. Auf diese Weise wird ein neuer, nun bereits selektierter Oligonukleotid-Pool generiert, welcher in der nächsten SELEX-Runde mit frischen Target-modifizierten Magnetic Beads zur Bindung gebracht wird. Die Fluorescein-Markierung der Oligonukleotide ermöglicht ab der 2. SELEX-Runde die Quantifizierung der ssDNA in den einzelnen Schritten jeder Runde. Durch das Einführen zusätzlicher Schritte in eine SELEX-Runde kann zusätzlich Einfluß auf die Spezifität der zu selektierenden Aptamere genommen werden. Ein Negativ-Selektionsschritt kann der eigentlichen Bindungsreaktion vorgeschaltet werden. D. h. der Oligonukleotid-Pool wird beispielsweise mit unmodifizierten Magnetic Beads oder mit solchen, die dem Target verwandte Moleküle tragen, an die die Aptamere nicht binden sollen, inkubiert (21°C, 30 min, schütteln), um diejenigen (unerwünschten) Oligonukleotide herauszusortieren, die an Oberflächen oder Moleküle binden, die nicht das Target sind. Alle hierbei nicht-bindenden Oligonukleotide werden dann direkt in die eigentliche Bindungsreaktion mit dem Selektionstarget gegeben. Darüberhinaus kann ein Subtraktionsschritt nach der Elution Target-gebundener Oligonukleotide eingefügt werden. D. h. der selektierte Oligonukleotid-Pool einer SELEX-Runde wird nochmals mit entsprechenden Magnetic Beads (siehe Negativ-Selektionsschritt) inkubiert (21°C, 30 min, schütteln), um alle unerwünscht-bindenden Oligonukleotide zu entfernen. Die hierbei nicht-bindenden Oligonukleotide werden anschließend für die nächste SELEX-Runde aufgearbeitet (Amplifikation, Reinigung).A SELEX round basically consists of 5 steps. At the beginning of a round, the oligonucleotides in binding buffer (100 mM NaCl, 20 mM Tris / HCl, pH 7.6, 2 mM MgCl ₂ , 5 mM KCl, 1 mM CaCl ₂ , 0.02% Tween20) are first thermally equilibrated (90 ° C 8 min, ice 10 min, RT 3-6 min). Subsequently, the oligonucleotides are immediately incubated in a binding reaction (target selection step) together with the target, immobilized on magnetic beads (21 ° C, 30 min, shake). All oligonucleotides which have not bound to the target are then removed in several washing steps (binding buffer). The use of magnetic beads for target immobilization allows efficient separation of the resulting binding complexes from the unbound oligonucleotides as well as stringent washing conditions. Thereafter, the elution of the oligonucleotides bound to the target by a heat treatment (in binding buffer, 80 ° C, 2 × 7 min). The next step involves amplification of the total eluted ssDNA by PCR. In this case, the choice of 5'-modified primer on the one hand a fluorescein label attached to the relevant DNA strand and on the other hand, the complementary strand by an HEGL spacer + additional nucleotides (dA ₂₀ ) extended. This introduction of a difference in length between the two DNA strands during the PCR makes it possible subsequently to purify the relevant, now fluorescein-labeled, ssDNA from the dsDNA PCR products by means of a denaturing PAGE. In this way, a new, now already selected oligonucleotide pool is generated, which is brought in the next SELEX round with fresh target-modified magnetic beads for binding. The fluorescein labeling of the oligonucleotides enables the quantification of the ssDNA in the individual steps of each round from the second SELEX round. By introducing additional steps into a SELEX round, it is additionally possible to influence the specificity of the aptamers to be selected. A negative selection step can be preceded by the actual binding reaction. Ie. For example, the oligonucleotide pool is incubated with unmodified magnetic beads or those carrying target related molecules to which the aptamers should not bind (21 ° C, 30 min, shake) to screen out those (unwanted) oligonucleotides that bind to surfaces or molecules that are not the target. All non-binding oligonucleotides are then added directly to the actual binding reaction with the selection target. Moreover, a subtraction step may be inserted after elution of target-bound oligonucleotides. Ie. The selected oligonucleotide pool of a SELEX round is again incubated with appropriate magnetic beads (see negative selection step) (21 ° C, 30 min, shake) to remove all unwanted-binding oligonucleotides. The non-binding oligonucleotides are then worked up for the next SELEX round (amplification, purification).

Im vorliegenden Fall, der Selektion Tau-Peptid-spezifischer Aptamere, kamen zwei Varianten eines Tau-Peptids als Target zum Einsatz: Tau226-240 (SEQ ID No. 1) und die doppeltphosphorylierte Variante Tau226–240(2P). Die Peptide entsprechen der Aminosäureposition 226–240 des humanen Tau-Proteins Isoform Tau-441 (Tau-F). Bei der phosphorylierten Variante wurde Threonin an Position 231 und Serin an Position 235 phosphoryliert. Beide Peptide bestehen aus 15 As und wurden am N-Terminus mit Biotin über einen Aminohexansäure-Spacer gekoppelt. Dies ermöglichte die Immobilisierung der Peptide an Streptavidin-Magnetic Beads (Tau226-StrepBeads bzw. Tau226(2P)-StrepBeads). Die Runden 1–7 wurden unter Verwendung von Tau226(2P)-StrepBeads (je 1 × 10⁸ Beads) durchgeführt, in den Runden 8–13 kamen Tau226-StrepBeads (je 1 × 10⁸ Beads) zur Anwendung. Darüberhinaus wurden spezielle Beads im Neagtiv-Selektionsschritt bzw. Subtraktionsschritt eingesetzt, um unspezifisch bindende Oligonukleotide zu entfernen.In the present case, the selection of tau-peptide-specific aptamers, two variants of a tau-peptide were used as target: Tau226-240 (SEQ ID No. 1) and the doubly phosphorylated variant Tau226-240 (2P). The peptides correspond to amino acid position 226-240 of the human tau protein isoform Tau-441 (Tau-F). In the phosphorylated variant, threonine was phosphorylated at position 231 and serine at position 235. Both peptides consist of 15 As and were coupled at the N-terminus with biotin via an aminohexanoic acid spacer. This allowed the immobilization of the peptides to streptavidin-magnetic beads (Tau226-StrepBeads or Tau226 (2P) -StrepBeads). Rounds 1-7 were performed using Tau226 (2P) StrepBeads (1 x 10 ⁸ beads each), in rounds 8-13 Tau226 StrepBeads (1 x 10 ⁸ beads each) were used. In addition, special beads were used in the Neagtiv selection step or subtraction step to remove nonspecifically binding oligonucleotides.

In jeder SELEX-Runde wurden zunächst ein Negativ-Selektionsschritt und anschließend der eigentliche Target-Selektionsschritt durchgeführt. Die an die jeweils verwendeten Magnetic Beads gebundenen Oligonukleotide wurden nach mehreren Waschschritten durch eine Hitzebehandlung der Bindungskomplexe wieder von den Magnetic Beads eluiert und ab der 2. SELEX-Runde quantifiziert (Fluoreszenzmessung). Die Menge der eluierten Oligonukleotide aus jeder SELEX-Runde diente als Kriterium zur Bewertung des Selektionsverlaufes und ist in einem Säulendiagramm in 2 dargestellt.In each SELEX round, first a negative selection step and then the actual target selection step were carried out. The oligonucleotides bound to the respectively used magnetic beads were eluted again from the magnetic beads after several washing steps by a heat treatment of the binding complexes and quantified from the second SELEX round (fluorescence measurement). The amount of eluted oligonucleotides from each SELEX round served as a criterion for evaluating the course of selection and is shown in a bar graph in FIG 2 shown.

In den ersten sechs Runden wurde der SELEX-Prozess auf die doppeltphosphorylierte Peptidvariante Tau226–240(2P), immobilisiert auf Streptavidin-Magnetic Beads, als Zielmolekül für die Aptamerselektion ausgerichtet. Im Negativ-Selektionsschritt wurden die unmodifizierten Beads verwendet. Dadurch konnte eine Anreicherung unspezifisch bindender Oligonukleotide verhindert werden. Die Ergebnisse zeigten aber auch, dass keine Oligonukleotide für das doppeltphosphorylierte Peptid Tau226–240(2P) angereichert werden konnten. Daraufhin wurden zur Kontrolle in Runde 7 die unmodifizierten Beads im Negativ-Selektionsschritt durch die Tau226-StrepBeads (unphosphorylierte Peptidvariante Tau226-240) ersetzt. Eine signifikante Menge ssDNA band an die Tau226-StrepBeads (Balken in Runde 7 im Säulendiagramm 2). Damit zeigte sich, dass in den 6 SELEX-Runden überraschenderweise ein Oligonukleotid-Pool selektiert wurde, der an das unphosphorylierte Tau-Peptid binden kann, nicht jedoch an die phosphorylierte Variante. Wahrscheinlich waren gleichzeitig auch unphosphorylierte Varianten der Zielmoleküle, wenn auch in sehr geringer Menge, vorhanden. Überraschenderweise haben sich hierfür spezifisch bindende Oligonukleotide im Selektionsverlauf durchgesetzt. Nachdem dies erkannt worden war, wurde ab Runde 8 ein Targetwechsel vollzogen und der SELEX-Prozess auf die Selektion von Aptameren für das unphosphorylierte Tau-Peptid Tau226-240 ausgerichtet. In den folgenden sechs Runden konnte der Oligonukleotid-Pool weiter spezifiziert werden (siehe 2). Ab Runde 10 wurden im Negativ-Selektionsschritt weitere Beads mit unspezifischen Oberflächen verwendet. Zusätzlich wurde in den Runden 10, 11 und 12 ein Subtraktionsschritt, ebenfalls mit diesen unspezifischen Beads, eingeführt. Beide Maßnahmen dienten der Entfernung solcher Oligonukleotide aus dem selektierten Pool, die unspezifische Bindungen aufweisen. Nach der 13. SELEX-Runde wurde der SELEX-Prozess beendet und der selektierte Oligonukleotid-Pool anschließend kloniert. Insgesamt wurden 47 individuelle Aptamer-Klone charakterisiert. Nach Sequenzierung und Sequenzanalyse konnten diese 47 Aptamere aufgrund von Sequenzhomologien in 8 Gruppen eingeteilt werden, siehe Tabelle 1. Herausragend war die Gruppe 1. Sie enthielt mit 29 Aptamer-Klonen die meisten Vertreter. Die anderen Gruppen enthielten 3–6 Vertreter oder stellten Einzelklone dar. Eine gruppenübergreifende Konsensussequenz konnte nicht identifiziert werden. In der Gruppe 2 wurden alle Aptamer-Klone zusammengefasst, die intern vollständige bzw. teilweise Wiederholungen der 3'-Primerbindungsregion enthalten. Da die Primerbindungsregionen in allen Aptameren methodisch-bedingt vorhanden sind, könnten die Aptamere der Gruppe 2 möglicherweise PCR-Artefakte darstellen.In the first six rounds, the SELEX process was targeted to the double-phosphorylated peptide variant Tau226-240 (2P) immobilized on streptavidin-magnetic beads as a target for aptamer selection. In the negative selection step, the unmodified beads were used. As a result, an enrichment of nonspecifically binding oligonucleotides could be prevented. However, the results also showed that no oligonucleotides could be enriched for the double-phosphorylated peptide Tau226-240 (2P). Thereupon, for control in round 7, the unmodified beads in the negative selection step were replaced by the Tau226 StrepBeads (unphosphorylated peptide variant Tau226-240). A significant amount of ssDNA tied to the Tau226 StrepBeads (bars in round 7 in the bar chart 2 ). This showed that in the 6 SELEX rounds surprisingly an oligonucleotide pool was selected which can bind to the unphosphorylated tau peptide, but not to the phosphorylated variant. At the same time there were probably also unphosphorylated variants of the target molecules, albeit in very small quantities. Surprisingly, specifically binding oligonucleotides have prevailed in the selection process. After this was detected, a target change was made from round 8 and the SELEX process was directed to the selection of aptamers for the unphosphorylated tau peptide Tau226-240. In the following six rounds, the oligonucleotide pool could be further specified (see 2 ). From round 10, additional beads with nonspecific surfaces were used in the negative selection step. In addition, in rounds 10, 11 and 12, a subtraction step was introduced, also with these nonspecific beads. Both measures served the removal of such oligonucleotides from the selected pool, which have non-specific binding. After the 13th SELEX round, the SELEX process was terminated and the selected oligonucleotide pool subsequently cloned. A total of 47 individual aptamer clones were characterized. After sequencing and sequence analysis, these 47 aptamers could be grouped into 8 groups based on sequence homologies, see Table 1. Outstanding was Group 1. It contained the most representatives with 29 aptamer clones. The other groups contained 3-6 members or were single clones. A cross-group consensus sequence could not be identified. In group 2, all aptamer clones were pooled internally containing full or partial repeats of the 3 'primer binding region. Because the primer binding regions are methodically-related in all aptamers, the group 2 aptamers could potentially be PCR artifacts.

Bindungsstudien mit individuellen AptamerenBinding studies with individual aptamers

Erste vergleichende Bindungsstudien mit einzelnen Aptamer-Klonen wurden entsprechend den SELEX-Bedingungen durchgeführt. In einer Bindungsreaktion wurden Tau226-StrepBeads (je 1 × 10⁷) und Fluorescein-markierte ssDNA eines Aptamer-Klones (13–16 pmol, nach thermischer Equilibrierung) zusammengegeben und inkubiert (21°C, 30 min, schütteln; Bindungspuffer). Anschließend erfolgten mehrere Waschschritte, um alle ungebundenen Aptamere zu entfernen. Die Target-gebundenen Aptamere wurden durch eine Hitzebehandlung (in Bindungspuffer, 80°C, 2 × 7 min) wieder von den Tau226-StrepBeads eluiert. Durch die Fluoresceinmarkierung der ssDNA konnten die Aptamere im Eluat gemessen und über eine Eichkurve quantifiziert werden. Die Ergebnisse sind in einem Säulendiagramm in 3 dargestellt.First comparative binding studies with single aptamer clones were performed according to the SELEX conditions. In a binding reaction Tau226 StrepBeads (1 x 10 ⁷ each) and fluorescein-labeled ssDNA of an aptamer clone (13-16 pmol, after thermal equilibration) were combined and incubated (21 ° C, 30 min, shake, binding buffer). Subsequently, several washes were made to remove all unbound aptamers. The target-bound aptamers were eluted again from the Tau226 StrepBeads by heat treatment (in binding buffer, 80 ° C, 2 x 7 min). By fluorescein labeling of the ssDNA, the aptamers could be measured in the eluate and quantified by a calibration curve. The results are in a bar chart in 3 shown.

Für die vergleichenden Bindungsstudien wurde je ein Vertreter der 8 Aptamer-Gruppen eingesetzt, außerdem der selektierte Aptamer-Pool und die unselektierte ssDNA-Bibliothek. Der selektierte Aptamer-Pool zeigte erwartungsgemäß das höchste Bindungsvermögen, während das Bindungsverhalten der einzelnen Aptamer-Klone sehr unterschiedlich ausfiel. Die Klone #1/2 (Gr. 2), #11/44 (Gr. 3) und #11/42 (Gr. 7) zeigten ein geringes Bindungsvermögen. Die Klone #11/34 (Cr. 1) und #3/21 (Cr. 6) waren in ihrem Bindungsvermögen etwa vergleichbar mit der unselektierten ssDNA-Bibliothek. Ein besseres Bindungsvermögen zeigten die Klone #3/22 (Cr. 4), #1/5 (Gr. 5) und insbesondere #5/60 (Gr. 8).A representative of the 8 aptamer groups was used for the comparative binding studies, as well as the selected aptamer pool and the unselected ssDNA library. As expected, the selected aptamer pool showed the highest binding capacity, while the binding behavior of the individual aptamer clones was very different. Clones # 1/2 (size 2), # 11/44 (size 3) and # 11/42 (size 7) showed low binding capacity. Clones # 11/34 (Cr.1) and # 3/21 (Cr.6) were approximately comparable in their binding capacity to the unselected ssDNA library. Better binding was demonstrated by clones # 3/22 (Cr.4), # 1/5 (size 5) and especially # 5/60 (size 8).

Vom Aptamer-Klon #5/60, als bester Binder gemäß der bisherigen Bindungstudien, wurde eine Sättigungskurve aufgenommen und der K_D-Wert als ein Maß für die Affinität des Aptamers zu seinem Target bestimmt, siehe 4. In mehreren Bindungsansätzen wurde die Aptamer-DNA in aufsteigender Konzentration (in einem Bereich von 5–200 pmol/ml) mit Tau226-StrepBeads (konstante Beadzahl von 1 × 10⁷) zur Bindung zusammengegeben. Die Versuchsbedingungen entsprachen denen der oben beschriebenen vergleichenden Bindungsstudien. Über eine Nichtlineare Regressionsanalyse der Bindungsdaten konnte ein K_D-Wert von 76 nM (±9,6 nM) für das Aptamer #5/60 ermittelt werden.From the aptamer clone # 5/60, as the best binder according to previous binding studies, a saturation curve was recorded and the K _D value was determined as a measure of the affinity of the aptamer for its target, see 4 , In several binding assays, the aptamer DNA was combined in ascending concentration (in the range of 5-200 pmol / ml) with Tau226 StrepBeads (constant bead number of 1 x 10 ⁷ ) for binding. The experimental conditions corresponded to those of the comparative binding studies described above. A nonlinear regression analysis of the binding data revealed a K _D value of 76 nM (± 9.6 nM) for the aptamer # 5/60.

Es folgt ein Sequenzprotokoll nach WIPO St. 25.This is followed by a sequence protocol according to WIPO St. 25. Dieses kann von der amtlichen Veröffentlichungsplattform des DPMA heruntergeladen werden.This can be downloaded from the official publication platform of the DPMA.

ZITATE ENTHALTEN IN DER BESCHREIBUNG QUOTES INCLUDE IN THE DESCRIPTION

Diese Liste der vom Anmelder aufgeführten Dokumente wurde automatisiert erzeugt und ist ausschließlich zur besseren Information des Lesers aufgenommen. Die Liste ist nicht Bestandteil der deutschen Patent- bzw. Gebrauchsmusteranmeldung. Das DPMA übernimmt keinerlei Haftung für etwaige Fehler oder Auslassungen.This list of the documents listed by the applicant has been generated automatically and is included solely for the better information of the reader. The list is not part of the German patent or utility model application. The DPMA assumes no liability for any errors or omissions.

Zitierte Nicht-PatentliteraturCited non-patent literature

K. Bracht in "Indicators for Diagnosis and Therapy"; Pharmaceutical Newspaper online Issue 12/2009; http://www.pharmazeutische-zeitung.de/index.php?id=29346&type=0 [0003]
Hort et al., "Significance of Total Tau and Phospho-Tau Protein Liquor Levels in Dementia Diagnosis", Nervenarzt 2008, 79, 891-898 [0006]
http://blast.ncbi.nlm.nih.gov/Blast.cgi [0028]
Tuerk & Gold, Science 249 (1990) 505-510, and Ellington & Szostak, Nature 346 (1990) 818-822 [0029]
Stoltenburg et al., "FluMag-SELEX as an advantageous method for DNA aptamer selection", Anal Bioanal Chem. 2005; 383 (1): 83-91 [0076]

Claims

Aptamer which specifically binds to human tau protein or a fragment thereof.

Aptamer according to claim 1, characterized in that the aptamer comprises or consists of at least one of the following nucleic acid sequences: a) a sequence having one of SEQ ID NOs 2 to 27; or b) a sequence which is at least 80% identical to a sequence from a) over a sequence of at least 18 consecutive nucleotides.

Aptamer according to claim 2, characterized in that the sequence in a) is selected from SEQ ID Nos. 2 to 14.

Aptamer according to one of claims 2 or 3, characterized in that the sequence in a) is selected from SEQ ID Nos. 2, 10, 11, 12 and / or 14.

Aptamer according to claim 2, characterized in that the sequence in a) is selected from SEQ ID Nos. 15 to 27.

Aptamer according to one of the preceding claims, characterized in that it is a DNA aptamer.

Aptamer according to one of the preceding claims, characterized in that the nucleic acid of the aptamer is conjugated to a carrier molecule and / or a reporter molecule and / or contains additional nucleotide sequences.

Aptamer according to any one of the preceding claims, characterized in that the aptamer of human tau protein of SEQ ID NO: 1 has a K _D of not more than 500 nM.

Pharmaceutical composition, characterized in that the pharmaceutical composition contains an aptamer according to any one of claims 1 to 8 and at least one pharmaceutically acceptable excipient.

Kit comprising an aptamer according to one of claims 1 to 8.

Aptamer according to any one of claims 1 to 8, a pharmaceutical composition according to claim 9 or a kit according to claim 10 for use in the diagnosis and / or therapy of diseases associated with a change in tau protein level, in particular cerebral infarction, stroke, cerebral Jakob's Disease, Taupathia, Alzheimer's Disease, Corticobasal Degeneration, Agryophilic Grain Disease, Pick's Disease, Frontotemporal Dementia, Parkinsonism of Chromosome 17 (FTDP-17), and / or progressive supranuclear palsy.

Use of an aptamer according to any one of claims 1 to 8 or a pharmaceutical composition according to claim 9 for the preparation of a medicament, preferably for the manufacture of a medicament for the diagnosis of diseases associated with a change in tau protein level, in particular cerebral infarction, stroke, creutzfeld Jacob's Disease, Taupathia, Alzheimer's Disease, Corticobasal Degeneration, Agryophilic Grain Disease, Pick's Disease, Frontotemporal Dementia, Parkinsonism of Chromosome 17 (FTDP-17), and / or progressive supranuclear palsy.

Use of an aptamer according to any one of claims 1 to 8 in vitro for the isolation, purification and / or detection of tau protein or fragments thereof.

A process for purifying human tau protein or fragments thereof, characterized in that a sample containing human tau protein or a fragment thereof is contacted with at least one aptamer according to any one of claims 1 to 8 and the obtained complex of aptamer and bound Tau protein or the fragment thereof is separated from the remaining sample.

A method for the detection of human tau protein or fragments thereof, characterized in that the sample to be examined with at least one aptamer according to one of claims 1 to 8 contacted and a binding event is detected between the aptamer and human tau protein or a fragment thereof.