DD251685A3

DD251685A3 - METHOD FOR MODIFYING HIGH-POLYMERS, ESPECIALLY FIBER-OPEN SYNTHETIC HIGH POLYMERS, AND FLUIDS AND MOLDINGS MANUFACTURED THEREFROM

Info

Publication number: DD251685A3
Application number: DD19083376A
Authority: DD
Inventors: Wolfgang Albrecht; Volker Groebe; Gerhard Hirsch; Paul Klug; Edith Maeder; Annerose Mally; Gerhard Mann; Johannes Morgenstern; Frank Wittig; Susanna L Mamedowa; Ewgeni W Woloschanowski; Wsewolod D Orjechow; Konstantin D Pismannik; Waleri J Kicelew; Waleri A Fomin; Alexandr P Cineokow
Original assignee: Akad Wissenschaften Ddr
Priority date: 1976-01-19
Filing date: 1976-01-19
Publication date: 1987-11-25

Abstract

Patentansprüche: 1. Verfahren zur Modifizierung von Hochpolymeren, vorzugsweise von Polyamid, Polyester oder Polyakrylnitril, oder daraus hergestellten Fasern, Fäden, Flächen- oder Formgebilden durch strahlenchemische Pfropfkopolymerisation, wobei das Hochpolymere mittels ionisierender Strahlen bestrahlt und vor, während oder nach der Bestrahlung mit einer polymerisierbaren Substanz kontaktiert wird, dadurch gekennzeichnet, dass ein Hochpolymeres mit einer vorzugsweise wässrigen Lösung eines Gemisches von Polyäthylenglykoldiester und /oder ungesättigter organischer Säure und/oder Veresterungskatalysator und einem Stabilisator kontaktiert wird, vorzugsweise eines bei der Polyäthylenglykolesterherstellung anfallenden Reaktionsgemisches bestehend aus 5 bis 98% Diester und 2 bis 95% Monoester und 0 bis 50% Polyäthylenglykol und 0 bis 90% ungesättigter organischer Säure und 0 bis 5% Veresterungskatalysator und einem Stabilisator und als ionisierenden Strahlen beschleunigte Elektronen mit einer Energie von 40 keV bis 3 MeV verwendet werden. 2. Verfahren nach Anspruch 1, dadurch gekennzeichnet, dass das im Reaktionsgemisch unverestert oder verestert enthaltene Polyäthylenglykol ein Polyäthylenglykol mit beliebigem Molekulargewicht von 200 bis 1000, ist. 3. Verfahren nach Anspruch 1 bis 2, dadurch gekennzeichnet, dass die im Reaktionsgemisch enthaltenen Mono- und/oder Diester Umsetzungsprodukte des Polyäthylenglykols mit ungesättigten organischen Säuren, wie z. B. Akrylsäure, Methakrylsäure, Krotonsäure, Itakonsäure bzw. mit den entsprechenden Säurechloriden bzw. mit Maleinsäureanhydrid sind.Claims 1. A process for modifying high polymers, preferably polyamide, polyester or polyacrylonitrile, or fibers, filaments, sheets or shapes made therefrom by radiation-chemical graft copolymerization, wherein the high polymer is irradiated by means of ionizing radiation and irradiated before, during or after irradiation polymerizable substance is contacted, characterized in that a high polymer is contacted with a preferably aqueous solution of a mixture of polyethylene glycol diester and / or unsaturated organic acid and / or esterification catalyst and a stabilizer, preferably a resulting in the production of polyethylene glycol ester reaction mixture consisting of 5 to 98% diester and 2 to 95% of monoester and 0 to 50% of polyethylene glycol and 0 to 90% of unsaturated organic acid and 0 to 5% of esterification catalyst and a stabilizer and accelerated as ionizing radiation Elek be used with an energy of 40 keV to 3 MeV. 2. The method according to claim 1, characterized in that the unesterified or esterified in the reaction mixture contained polyethylene glycol is a polyethylene glycol having any molecular weight from 200 to 1000, is. 3. The method according to claim 1 to 2, characterized in that the mono- and / or diesters contained in the reaction mixture reaction products of polyethylene glycol with unsaturated organic acids, such as. As acrylic acid, methacrylic acid, crotonic acid, itaconic acid or with the corresponding acid chlorides or with maleic anhydride.

Description

Die Erfindung betrifft ein Verfahren zur Modifizierung von Hochpolymeren, insbesondere von faserförmigen synthetischen Hochpolymeren, und daraus hergestellten Flächen- und Formgebilden durch strahlenchemische Pfropfkopolymerisation zur Erzielung permanenter antistatischer und weiterer Effekte.The invention relates to a process for the modification of high polymers, in particular of fibrous synthetic high polymers, and surface and moldings produced therefrom by radiation-chemical graft copolymerization to obtain permanent antistatic and further effects.

Es ist bekannt, daß synthetische Polykondensate wie Polykaprolaktam, Polyhexamethylenadipamid und Polyäthylenterephthalat durch Bestrahlen des Polymeren in engem Kontakt mit Polyäthylenglykol zur Erzielung antistatischer ^; Effekte strahlenchemisch modifiziert werden können. Nachteilig ist jedoch, daß die Wahrscheinlichkeit der Bindung der Polyäthylenglykolmoleküle an die Kettenmoleküle des Substrats durch eine strahlenchemische Pfropfreaktion relativ gering ist, so daß eine hinreichende Permanenz nur gegeben ist, wenn das Molekulargewicht des eingesetzten Polyäthylenglykols so groß ist, daß dessen Wasserlöslichkeit reduziert ist. Diese hochmolekularen Polyäthylenglykole haben andererseits den Nachteil, daß ihr Eindringvermögen in die zu modifizierende Substanz und ihre Wirksamkeit bez. der Erniedrigung des elektrischen Widerstandes geringer ist als bei Polyäthylenglykolen mit niedrigerem Molekulargewicht.It is known that synthetic polycondensates such as polycaprolactam, polyhexamethylene adipamide and polyethylene terephthalate are obtained by irradiating the polymer in close contact with polyethylene glycol to obtain antistatic ^; Effects can be modified by radiation chemistry. The disadvantage, however, is that the probability of binding of the polyethylene glycol molecules to the chain molecules of the substrate by a radiation-chemical grafting reaction is relatively low, so that a sufficient permanence is only given if the molecular weight of the polyethylene glycol used is so large that its water solubility is reduced. On the other hand, these high molecular weight polyethylene glycols have the disadvantage that their penetration into the substance to be modified and their effectiveness are. the lowering of the electrical resistance is lower than with lower molecular weight polyethylene glycols.

Weiterhin sind Verfahren zur Erhöhung der Farbstoffaffinität von Polyamid durch strahlenchemisches Pfropfen mit verschiedenen monomeren Polyalkylehglykolmono- oder -diestern von Akryl- und Methakrylsäure bekannt. Außerdem ist bekannt, daß die strahlenchemische Modifizierung von Polykondensationsprodukten mit derartigen polymerisationsfähigen Substanzen zur Erzielung antistatischer Effekte vorgeschlagen wurde.Furthermore, methods for increasing the dye affinity of polyamide by radiation grafting with various monomeric polyalkylehglykolmono- or diesters of acrylic and methacrylic acid are known. In addition, it is known that the radiation-chemical modification of polycondensation products with such polymerizable substances has been proposed for the purpose of achieving antistatic effects.

Nachteilig ist jedoch, daß bei der Umesterung von Methylakrylat bzw. Methylmethakrylat und Polyäthylenglykol sowie bei der azeotropen Veresterung von Polyäthylenglykol mit Akryl- oder Methakrylsäure die Ausbeute an aus dem Reaktionsgemisch abgetrennten Mono- oder Diester relativ gering ist bzw. bei der Umsetzung von Polyäthylenglykol mit Akryloyl- oder Methakryloylchlorid der Preis der Säurechloride relativ hoch liegt, so daß das Modifizierungsverfahren mit Polyalkylenglykolmono- oder-diakrylaten bzw. -methakrylaten unökonomisch wird.A disadvantage, however, is that in the transesterification of Methylakrylat or Methylmethakrylat and polyethylene glycol and in the azeotropic esterification of polyethylene glycol with acrylic or methacrylic acid, the yield of separated from the reaction mixture mono- or diester is relatively low or in the reaction of polyethylene glycol with acryloyl or methacryloyl chloride, the price of the acid chlorides is relatively high, so that the modification process with polyalkylene glycol mono- or diacrylates or methacrylates becomes uneconomical.

Weiter ist eine antistatische und hydrophile Ausrüstung von Polyesterfasern bekannt, wobei mit einer wäßrigen Lösung von Polyäthylenglykoldimethakrylat (Molekulargewicht des Polyäthylenglykols: 300 bis 800) und Natriumstyrolsulfonat (1: < 1) bzw. Natriumakrylat bzw. Natriummethakrylat getränkt und anschließend bestrahlt wird.Furthermore, an antistatic and hydrophilic finish of polyester fibers is known, being impregnated with an aqueous solution of polyethylene glycol dimethacrylate (molecular weight of polyethylene glycol: 300 to 800) and sodium styrenesulfonate (1: <1) or sodium acrylate or sodium methacrylate and then irradiated.

Auch ist die Antistatikausrüstung von Polyakrylnitrilfasern und -filmen durch Behandlung mit 0,2 bis 30% Polyäthylenglykoldimethakrylat und dessen Polymerisation durch Bestrahlung oder durch Erhitzen auf 70 bis 160⁰C beschrieben worden.Also, the antistatic finishing of Polyakrylnitrilfasern and films has been described by treatment with 0.2 to 30% Polyäthylenglykoldimethakrylat and its polymerization by irradiation or by heating at 70 to 160 ⁰ C.

Weiterhin ist bekannt, daß permanente antistatische Eigenschaften zusammen mit verbesserter thermischer Stabilität von Synthesefaserstoffen z.B. aus Polyamid, Polyester, Polyolefine u.a. durch Behandlung mit Mischungen aus 100Teilen Polysiloxan und 2 bis 100 Teilen Polyäthylenglykoldiakrylat und anschließende Bestrahlung mit Dosen >0,5Mrd erreichbarFurthermore, it is known that permanent antistatic properties together with improved thermal stability of synthetic fibers e.g. made of polyamide, polyester, polyolefins and the like achievable by treatment with mixtures of 100 parts of polysiloxane and 2 to 100 parts of polyethylene glycol diacrylate and subsequent irradiation with doses> 0.5 billion

Der Nachteil dieser Verfahren ist wieder in den hohen Kosten für die einzusetzenden Polyäthylenglykoldiakrylate und dimethakrylatezu sehen, da selbst bei optimierten Laborbedingungen und erst recht unter technischen Bedingungen die Veresterung nie 100%igzum Diesterführt, sondern ein mehroderweniger großer Anteil an Monoester neben nicht umgesetzten Ausgangssubstanzen auftreten, die abgetrennt werden müssen.The disadvantage of this process is again to be seen in the high costs for the polyethylene glycol diacrylates and dimethacrylates to be used, since even under optimized laboratory conditions and even more under technical conditions, the esterification never leads 100% to the diester, but rather a large proportion of monoesters occur in addition to unreacted starting substances. which must be disconnected.

Zweck der Erfindung ist es, mittels strahlenchemischer Modifizierung hochpolymerer Werkstoffe insbesondere antistatische Effekte zu erzielen, die permanent sind und die das Modifizierungsmittel verteuernden Aufwendungen für das Aufarbeiten des bei der Polyäthylenglykolesterherstellung anfallenden Reaktionsgemisches zwecks Isolierung definierter Reaktionsprodukte zu vermeiden und dadurch ökonomische Verfahrensparameter für die strahlenchemische Modifizierung zu erreichen.Purpose of the invention is to achieve by means of radiation-chemical modification of high polymer materials in particular antistatic effects that are permanent and to avoid the Modisierungsmittel more expensive expenses for the workup of accumulating the Polyäthylenglykolesterherstellung reaction mixture for the purpose of isolating defined reaction products and thereby economic process parameters for the radiation-chemical modification to reach.

Der Erfindung liegt die Aufgabe zugrunde, durch eine Veränderung der Modifizierungsstoffe permanent modifizierte Hochpolymere zu schaffen.The invention has for its object to provide by modifying the modifiers permanently modified high polymers.

Die Aufgabe wird erfindungsgemäß dadurch gelöst, daß hochpolymere Werkstoffe mit einer vorzugsweisen wäßrigen Lösung eines Gemisches aus Polyäthylenglykoldiester und/oder Polyäthylenglykolmonoester und/oder Polyäthylenglykol und/oder organischer ungesättigter Säure und/oder Veresterungskatalysator und einem Stabilisator, vorzugsweise eines bei der Polyäthylengiykolesterherstellung ohne Nachschaltung gesonderter Aufbereitungsstufen anfallenden Reaktionsgemisches bestehend aus 5 bis 98% Diester und 2 bis 95% Monoester und 0 bis 50% Polyäthylenglykol und 0 bis 90% ungesättigter organischer Säure und 0 bis 5% Veresterungskatalysator und Stabilisator kontaktiert wird. Daraus resultiert nicht nur ein besonderer ökonomischer Vorteil durch Wegfall mehrerer Arbeitsstufen zurTrennung des Reaktionsgemischesund Reinigung der einzelnen Reaktionsprodukte, sondern durch die gegenseitig vorteilhafte Beeinflussung der einzelnen Komponenten des Reaktionsgemisches bei der strahlenchemischen Pfropfkopolymerisation wird eine maßgebliche Erhöhung der Pfropfausbeute erreicht, so daß sich bei Anwendung geringerer Bestrahlungsdosen der angestrebte Umsatz der pfropf- und/oder vernetzbaren Substanz auf dem Substrat einstellt.The object is achieved in that high-polymer materials with a preferred aqueous solution of a mixture of polyethylene glycol diester and / or polyethylene glycol monoesters and / or polyethylene glycol and / or organic unsaturated acid and / or esterification catalyst and a stabilizer, preferably one in the Polyäthylengiykolesterherstellung without downstream of separate treatment stages resulting reaction mixture consisting of 5 to 98% diester and 2 to 95% monoester and 0 to 50% polyethylene glycol and 0 to 90% unsaturated organic acid and 0 to 5% esterification catalyst and stabilizer is contacted. This results in not only a particular economic advantage by eliminating several stages for separation of the reaction mixture and purification of the individual reaction products, but by mutually beneficial effect on the individual components of the reaction mixture in the radiation-chemical graft copolymerization, a significant increase in the graft yield is achieved, so that when using lower doses of radiation the desired conversion of the graftable and / or crosslinkable substance on the substrate sets.

Durch diese Modifizierung wird insbesondere eine Erhöhung der elektrischen Leitfähigkeit erreicht und dadurch der elektrostatischen Aufladung der betreffenden Produkte wirksam begegnet. Außerdem kommt es zu einer Verbesserung der Benetzbarkeit der modifizierten Materialien, die mit einer Erhöhung des Feuchtesatzes in Zusammenhang steht. Schließlich ist in einigen Fällen eine Verbesserung der Färbbarkeit und thermischen Stabilität festzustellen.By means of this modification, in particular an increase in the electrical conductivity is achieved, thereby effectively countering the electrostatic charging of the products concerned. In addition, there is an improvement in the wettability of the modified materials, which is associated with an increase in the moisture content. Finally, there is an improvement in dyeability and thermal stability in some cases.

Da das Modifizierungsmittel auf das Substrat aufgepfropft und/oder je nach Zusammensetzung mehr oder weniger stark vernetzt ist, sind die erreichten Modifizierungseffekte permanent.Since the modifier is grafted onto the substrate and / or more or less strongly crosslinked depending on the composition, the modification effects achieved are permanent.

Das Molekulargewicht der eingesetzten Polyäthylenglykole ist für die Erreichbarkeit der erfinderischen Effekte nicht kritisch; vorzugsweise werden Polyäthylenglykole mit einem Molekulargewicht von 200 bis 1 000 eingesetzt, aber auch Polyäthylenglykole mit niederem oder höherem Molekulargewicht sind erfindungsgemäß anwendbar.The molecular weight of the polyethylene glycols used is not critical to the accessibility of the inventive effects; Polyethylene glycols having a molecular weight of from 200 to 1,000 are preferably used, but also polyethylene glycols having a lower or higher molecular weight can be used according to the invention.

Als Polyäthylenglykolmono- und/oder -diester werden erfindungsgemäß Akrylate, Methakrylate, Itakonate oder Maleinate eingesetzt. Die Mono- und/oder Diester können dabei durch azeotrope Veresterung der Polyäthylenglykole mit der entsprechenden ungesättigten organischen Säure bzw. mit Maleinsäureanhydrid, durch Umsetzung der Polyäthyienglykole mit den entsprechenden Säurechloriden oder auch durch Umesterung der entsprechenden Methylakrylate erhalten worden sein.According to the invention, acrylates, methacrylates, itaconates or maleinates are used as polyethylene glycol monoesters and / or diesters. The mono- and / or diesters can be obtained by azeotropic esterification of the polyethylene glycols with the corresponding unsaturated organic acid or with maleic anhydride, by reacting the Polyäthyienglykole with the corresponding acid chlorides or by transesterification of the corresponding Methylakrylate.

Vorteilhaft ist es beispielsweise, bei der azeotropen Veresterung mit einem Überschuß an ungesättigter organischer Säure zu arbeiten, so daß in dem Reaktionsgemisch noch nicht umgesetzte-ungesättigte organische Säure enthalten ist, die einerseits durch Quellung des Substrates dessen Zugänglichkeit für Modifizierungskomponenten mit größerem Molekulargewicht verbessert und ihrerseits am Pfropfprozeß teilnimmt. Durch das Aufpfropfen von karboxylgruppenhaltigen Verbindungen auf das polymere Substrat werden zusätzlich weitere Eigenschaftsveränderungen erreicht, wie Erhöhung der Farbstoffaffinität, insbesondere zu kationaktiven Farbstoffen und Erhöhung der Feuchtesorption.It is advantageous, for example, to work in the azeotropic esterification with an excess of unsaturated organic acid, so that in the reaction mixture unreacted unsaturated organic acid is included, on the one hand by swelling of the substrate improves its accessibility for modifying components with a larger molecular weight and in turn participates in the grafting process. By grafting carboxyl-containing compounds onto the polymeric substrate, further property changes are additionally achieved, such as increasing the dye affinity, in particular to cation-active dyes and increasing the moisture absorption.

Wurden die Rekationsbedingungen bei der Herstellung des Polyäthylenglykolesters so gewählt, daß keine oder nur wenige überschüssige ungesättigte organische Säure im Reaktionsgemisch enthalten ist, so kann diesem Reaktionsgemisch nachträglich im erforderlichen Umfang ungesättigte organische Säure zugesetzt werden, wobei sich die Auswahl der Säure nicht auf die zur Veresterung verwendeten Säuren beschränken muß, sondern auch andere Säuren wie Vinylsulfon-p-Styrolsulfon oder Fumarsäure ausgewählt werden können. Der Gehalt an im Reaktionsgemisch enthaltener und/oder demselben nachträglich zugesetzter ungesättigter organischer Säure richtet sich nach den gewünschten Effekten: beispielsweise wird mit einem höheren Säureanteil gearbeitet, wenn das Erreichen eines Hydrophilieeffektes im Vordergrund steht, während mit höherem Polyäthylenglykolestergehalt gearbeitet wird, wenn es Vorzug weise auf die Erzielung antistatischer Eigenschaften ankommt.Were the Rekationsbedingungen in the production of polyethylene glycol ester chosen so that no or only a few excess unsaturated organic acid contained in the reaction mixture, this reaction mixture can be added subsequently to the extent necessary unsaturated organic acid, wherein the selection of the acid does not affect the esterification used acids, but other acids such as vinylsulfone p-styrenesulfone or fumaric acid can be selected. The content of contained in the reaction mixture and / or the same subsequently added unsaturated organic acid depends on the desired effects: for example, is worked with a higher acid content when the achievement of a hydrophilic effect is in the foreground, while working with higher Polyäthylenglykolestergehalt, if it is preferred arrives at the achievement of antistatic properties.

Durch einen nachträglichen Austausch der Η-Ionen der Karboxylgruppen gegen einwertige Metallionen wie Na⁺, K⁺, Li⁺ werden einerseits die Hydrophilie und andererseits die elektrische Leitfähigkeit maßgeblich gesteigert. Analoge Effekte wurden durch Behandlung mit NHd⁺ erreicht.Subsequent exchange of the Η ions of the carboxyl groups with monovalent metal ions such as Na ⁺ , K ⁺ , Li ⁺ increases the hydrophilicity on the one hand and the electrical conductivity on the other. Analogous effects were achieved by treatment with NHd ⁺ .

Durch den Austausch der Η-Ionen gegen Na-Ionen und erst recht gegen Ca-Ionen wird außerdem die Beständigkeit gegen Lochschmelzen erhöht.By exchanging the Η ions for Na ions and even more so for Ca ions, the resistance to hole melting is also increased.

In an sich bekannter Weise kann Schwefelsäure bei der Veresterung der Polyäthylenglykole als Veresterungskatalysator eingesetzt werden, der wegen des Wegfalls von Aufbereitungsstufen im Reaktionsgemisch enthalten ist. Dieser Schwefelsäureanteil wirkt sich keinesfalls nachteilig bei der Pfropf-Vernetzungsreaktion aus, sondern fördert im Gegenteil die Pfropfgeschwindigkeit und erhöht damit den Umsatz bei niedrigeren Bestrahlungsdosen. Die Schwefelsäure wird nach der strahlenchemischen Pfropfkopolymerisation bei der üblichen Spülbehandlung aus dem Substrat mit ausgewaschen. Außer Schwefelsäure können auch organische Sulfonsäuren wie p-Toluolsulfonsäure als Veresterungskatalysator angewendet werden. Auch diese Katalysatorreste können im Reaktionsgemisch verbleiben, da sie in speziellen Fällen an der Pfropfreaktion mit teilnehmen oder deren Ablauf positiv beinflussen und dadurch zur Verstärkung bzw. Erzielung neuer Effekte beitragen. Insbesondere wird hierbei die Färbbarkeit mit basischen Farbstoffen erhöht; auch die Benetzbarkeit, Hydrophilie und elektrische Leitfähigkeit kann im Falle der Versalzung derSulfonsäuregruppen mit Na⁺, K⁺, Li⁺, NH₄ ⁺ weiter angehoben werden ohne merkliche Effektbeeinträchtigung durch einen Ionenaustausch gegen Härtebildnerionen des Wassers.In a conventional manner sulfuric acid can be used in the esterification of polyethylene glycols as the esterification catalyst, which is included because of the elimination of treatment stages in the reaction mixture. This proportion of sulfuric acid is by no means detrimental in the graft-crosslinking reaction, but on the contrary promotes the grafting rate and thus increases the conversion at lower irradiation doses. The sulfuric acid is washed out of the substrate after the radiation-chemical graft copolymerization during the customary rinsing treatment. In addition to sulfuric acid and organic sulfonic acids such as p-toluenesulfonic acid can be used as the esterification catalyst. These catalyst residues can also remain in the reaction mixture since, in special cases, they participate in the grafting reaction or positively influence their course, thereby contributing to the reinforcement or achievement of new effects. In particular, this increases the dyeability with basic dyes; wettability, hydrophilicity and electrical conductivity can also be increased further in the case of salification of the sulfonic acid groups with Na ⁺ , K ⁺ , Li ⁺ , NH ₄ ⁺ without noticeable effect impairment due to ion exchange against hardness-forming ions of the water.

Die strahlenchemische Initiierung der Pfropf reaktion erfolgt auf Grund der Radikalbildung durch Bestrahlung des unbehandelten oder des mit dem Reaktionsgemisch behandelten Substrates mit ionisierenden Strahlen; vorteilhaft ist es, als ionisierende Strahlen Elektronenstrahlen mit Energien von 40keV bis 3MeV zu verwenden. Besonders zweckmäßig ist die Anwendung der Simultanmethode, d. h. die Bestrahlung des Substrates in engem Kontakt mit dem Modifizierungsmittel. In diesem Falle sind besonders günstige Bedingungen für eine gleichzeitige Pfropfung und Vernetzung des Modifizierungsmittels gegeben. Dies bewirkt, daß bereits bei relativ niedrigen Bestrahlungsdosen die aufgelagerten polymerisationsfähigen und/oder vernetzungsfähigen Komponenten des Reaktionsgemisches nahezu vollständig auf das Substrat aufgepfropft und/oder in vernetzten kopolymerisierter Form in dem Substrat eingelagert werden, so daß keine Wasserlöslichkeit mehr gegeben ist, was die Permanenz der erzielten Effekte begründet. Man kann das Gut aber auch erst bestrahlen, wobei solche Bedingungen zu wählen sind (niedrige Bestrahlungs- und Transport-VLagertemperatur, Inertgasatmosphäre), daß die primär gebildeten Radikale weitgehendfür die Pfropfreaktion erhalten bleiben und nicht durch unerwünschte Nebenreaktionen für den eigentlichen Prozeß verloren gehen.The radiation-chemical initiation of the grafting reaction is due to the radical formation by irradiation of the untreated or treated with the reaction mixture substrate with ionizing radiation; It is advantageous to use electron beams with energies of 40 keV to 3 MeV as ionizing beams. Particularly useful is the application of the simultaneous method, d. H. the irradiation of the substrate in close contact with the modifier. In this case, particularly favorable conditions for a simultaneous grafting and crosslinking of the modifier are given. This has the effect that, even at relatively low irradiation doses, the deposited polymerizable and / or crosslinkable components of the reaction mixture are almost completely grafted onto the substrate and / or incorporated in cross-linked copolymerized form in the substrate, so that water solubility is no longer present justified effects. However, it is also possible to irradiate the material first, with such conditions to be chosen (low irradiation and transport membrane temperature, inert gas atmosphere) that the radicals formed primarily remain largely intact for the grafting reaction and are not lost by undesired secondary reactions for the actual process.

Zweckmäßig ist es, das zu modifizierende Material mit einer wäßrigen Lösung des Reaktionsgemisches zu behandeln, wobei die Konzentration in der wäßrigen Lösung beliebig je nach der Höhe des gewünschten Pfropfgrades und der Wahl der übrigen Behandlungsparameter gewählt werden kann, vorzugsweise kommen aber wäßrige Lösungen mit 1 bis 20% Reaktionsgemisch-Gehalt zur Anwendung. Das Substrat kann mit der wäßrigen Lösung imprägniert werden (Tauchverfahren) oder letztere kann auf das Substrat aufgeklotzt oder aufgesprüht werden. Diese Behandlungen können bei Raumtemperatur erfolgen. Zur Verbesserung des Diffusionsverhaltens und damit Verkürzung der Kontaktierungszeit ist es in speziellen Fällen zweckmäßig, das Behandeln des Substrates mit dem Modifizierungsmittel bei erhöhter Temperatur — vorzugsweise im Bereich der Glasumwandlungstemperatur durchzuführen, die maximal mögliche Behandlungstemperatur wird durch das Polymerisationsverhalten des Reaktionsgemisches bestimmt.It is expedient to treat the material to be modified with an aqueous solution of the reaction mixture, wherein the concentration in the aqueous solution can be chosen arbitrarily depending on the level of the desired degree of grafting and the choice of the other treatment parameters, but preferably aqueous solutions with 1 to 20% reaction mixture content for use. The substrate can be impregnated with the aqueous solution (dipping method) or the latter can be padded or sprayed onto the substrate. These treatments can be done at room temperature. To improve the diffusion behavior and thus shorten the contacting time, it is expedient in special cases to carry out the treatment of the substrate with the modifying agent at elevated temperature, preferably in the range of the glass transition temperature; the maximum possible treatment temperature is determined by the polymerization behavior of the reaction mixture.

Günstige Diffusionsbedingungen für die Durchführung der strahlenchemischen Modifizierung von Synthesefaserstoffen sind außerdem bekanntlich im Stadium der Chemiefaserstoffherstellung, ζ. B. in gelfeuchtem Zustand von lösungsmittelersponnenen Faserstoffen gegeben. Weiterhin kann es vorteilhaft sein, dem Modifizierungsmittel Neutralsalze wie beispielsweise NaCI, KCI oder Na₂SO₄ zuzusetzen.Favorable diffusion conditions for carrying out the radiation chemical modification of synthetic fibers are also known to be in the stage of chemical pulp production, ζ. B. in gelfeuchtem state of solvent-spun pulp. Furthermore, it may be advantageous to add to the modifier neutral salts such as NaCl, KCl or Na ₂ SO ₄ .

Nach der Erfindung sollen die Eigenschaften von synthetischen Fasern, Fäden, Kabeln, Flächengebilden wie Vlies, Gewebe, Maschenware, Folie, Platten oder von Formgebilden verbessert werden. Dieser Modifizierung können alle Polymerisations-, Polykondensations- oder Polyadditionsprodukte unterworfen werden. Die erfinderische Lösung ist nicht auf einheitliche Polymere beschränkt, sondern auch Faserstoffmischungen können in den verschiedenen Aufmachungsformen modifiziert werden. Zu beachten ist dabei lediglich, daß die angewendete Bestrahlungsdosis für die Komponenten unter derjenigen Dosis liegt, die zu einem merklichen Abbau der strahlenempfindlichen Komponente der Polymeren führt.According to the invention, the properties of synthetic fibers, threads, cables, fabrics such as fleece, fabric, knitwear, film, sheets or molds are to be improved. This modification can be subjected to all polymerization, polycondensation or polyaddition products. The inventive solution is not limited to uniform polymers, but also fiber mixtures can be modified in the various forms of presentation. It should only be noted that the applied radiation dose for the components is below the dose which leads to a marked degradation of the radiation-sensitive component of the polymers.

Examples:

1. Aus einem Reaktionsgemisch, das durch azeotrope Veresterung von Polyäthylenglykol-400 mit Akrylsäure in Gegenwart von Schwefelsäure als Katalysator und Hydrochinon als Stabilisator im benzolischen Medium erhalten wurde, wird unter vermindertem Druck das Benzol ausgetrieben.1. From a reaction mixture obtained by azeotropic esterification of polyethylene glycol-400 with acrylic acid in the presence of sulfuric acid as the catalyst and hydroquinone as a stabilizer in the benzene medium, the benzene is expelled under reduced pressure.

Das verbleibende Produkt enthält 56,1 % Diester, 22,9% Monoester, 20,8% Polyäthylenglykol, 0,9% Schwefelsäure und den Stabilisator. Es wird eine 10gew.-%ige wäßrige Lösung dieses Reaktionsgemisches hergestellt und ein Polyamidseiden-Flachkettengewirke mit einer Flächenmasse von 70g/m² darin 3 min bei 45⁰C behandelt; nach dem Abquetschen auf einen Restfeuchtegehalt von 100% wird das Gewirke im gespannten Zustand durch die Bestrahlungszone eines 300keV-Elektronenbeschleunigers geführt und mit einer Dosis von 2,5IVIrd. bestrahlt. Anschließend wird das Material gründlich gespült und getrocknet. Durch diese Ausrüstung wird eine maßgebliche Verminderung des elektrischen Widerstandes erreicht und der Feuchtesatz, gemessen bei einer relativen Luftfeuchte von 65%, erhöht.The remaining product contains 56.1% diester, 22.9% monoester, 20.8% polyethylene glycol, 0.9% sulfuric acid and the stabilizer. It is prepared a 10 wt .-% aqueous solution of this reaction mixture and a polyamide silk Flachkettengewirke having a basis weight of 70g / m ² treated therein for 3 minutes at 45 ⁰ C; after being squeezed to a residual moisture content of 100%, the knitted fabric is passed through the irradiation zone of a 300 keV electron accelerator in a tensioned state and applied at a dose of 2.5 IUr. irradiated. Then the material is thoroughly rinsed and dried. Through this equipment, a significant reduction in electrical resistance is achieved and the moisture content, measured at a relative humidity of 65%, increased.

2. Aus einem Reaktionsgemisch, das durch azeotrope Veresterung von Polyäthylenglykol-400 mit Methakrylsäure in Gegenwart von p-Toluolsulfonsäure als Katalysator und Hydrochinon als Stabilisator in Benzol erhalten wurde, wird das Benzol unter vermindertem Druck abdestilliert. Das verbleibende Produkt besteht aus 51,6% Monoester, 23,9% Diester, 22,8% Polyäthylenglykol, 1,7% p-Toluolsulfonsäure und Stabilisator. Eine Polyesterfolie von 30μ,Γη Dicke behandelt man 30 min bei 75°C mit einer 15gew.-%igen wäßrigen Lösung dieses Reaktionsgemisches, läßt danach die überschüssige Lösung abtropfen und bestrahlt mit Elektronenstrahlen einer Energie von 2MeV bei Mehrfachumlenkung bis zu einer Dosis von 7,5Mrd. Abschließend wird gründlich gespült und getrocknet. Die modifizierte Polyesterfolie zeichnet sich durch erhöhte Oberflächenleitfähigkeit und verbesserte Benetzbarkeit aus.2. From a reaction mixture obtained by azeotropic esterification of polyethylene glycol-400 with methacrylic acid in the presence of p-toluenesulfonic acid as a catalyst and hydroquinone as a stabilizer in benzene, the benzene is distilled off under reduced pressure. The remaining product consists of 51.6% monoester, 23.9% diester, 22.8% polyethylene glycol, 1.7% p-toluenesulfonic acid and stabilizer. A polyester film of 30μ, Γη thickness is treated for 30 min at 75 ° C with a 15gew .-% aqueous solution of this reaction mixture, then allowed to drain the excess solution and irradiated with electron beams of an energy of 2MeV at multiple deflection up to a dose of 7, 5000000000. Finally, rinsed thoroughly and dried. The modified polyester film is characterized by increased surface conductivity and improved wettability.

3. Das Reaktionsgemisch, erhalten durch azeotrope Veresterung von Polyäthylenglykol 1000 mit Akrylsäure in Gegenwart von Schwefelsäure als Katalysator und Hydrochinon als Stabilisator im benzolischen Medium, wird bei Unterdruck von Benzol befreit; das verbleibende Produkt besteht aus 67,5% Monoester, 2,1 % Diester, 28,9% Polyäthylenglykol, 1,5% Schwefelsäure3. The reaction mixture obtained by azeotropic esterification of polyethylene glycol 1000 with acrylic acid in the presence of sulfuric acid as the catalyst and hydroquinone as a stabilizer in the benzene medium is freed from benzene under reduced pressure; the remaining product consists of 67.5% monoester, 2.1% diester, 28.9% polyethylene glycol, 1.5% sulfuric acid

und Stabilisator. Gelfeuchte Polyakrylnitrilkabel werden in einer Tränkvorrichtung mit einer 1 Ö%igen wäßrigen Lösung dieses Reaktionsgemisches bei Raumtemperatur 0,3s bei ständiger Bewegung der Flotte und des Materials behandelt, so daß entsprechend dem Diffusionskoeffizienten von 0,43 · 10~⁵cm²/s ein vollständiges Eindiffundieren des Reaktionsgemisches in die Elementarfäden erfolgen kann. Nach dem Behandeln wird auf einen Feuchtesatz von 150% abgequetscht und mit Elektronenstrahlen von 1 MeV bei einer Bestrahlungsdosis von 1 Mrd. bestrahlt, wobei gleichzeitig ein Aufpfropfen und Vernetzen stattfindet. Die nicht umgesetzten Modifizierungssubstanzen werden anschließend in einer Spülvorrichtung ausgewaschen, die Kabel getrocknet, gekräuselt und in Stapelfasern geschnitten. Durch diese Modifizierung wird eine Massezunahme von 7,8% erreicht. Die so modifizierten Fasern weisen permanente antistatische und hydrophile Eigenschaften sowie ein hohes Bauschvolumen infolge Nichtversteifung auf.and stabilizer. Gelfeuchte Polyakrylnitrilkabel are used in an impregnating device with a 1% aqueous solution east of this reaction mixture at room temperature for 0.3 s with continuous agitation of the liquor and the material treated so that corresponding to the diffusion coefficient of 0.43 · 10 ^-5 cm ² / s a complete Diffuse the reaction mixture into the filaments can be done. After treatment, the mixture is squeezed to a moisture content of 150% and irradiated with electron beams of 1 MeV at a radiation dose of 1 billion, at the same time a grafting and crosslinking takes place. The unreacted modifiers are then rinsed in a rinse, the cables dried, crimped and cut into staple fibers. By this modification, a mass increase of 7.8% is achieved. The fibers thus modified have permanent antistatic and hydrophilic properties as well as a high bulk density due to non-stiffening.

4. Das Reaktionsgemisch der azeotropen Veresterung von Polyäthylenglykol-400 mit Akrylsäure in Gegenwart von p-Toluolsulfbnsäure als Katalysator und Hydrochinon als Stabilisator im benzolischen Medium wird wie im Beispiel 1 von Benzol befreit. Das verbleibende Reaktionsgemisch enthält 22,0% Monoester, 53,9% Diester, 21,6% Polyäthylenglykol, 2,5% Toluolsulfonsäure und Stabilisator. Eine Polyamidfolie von 35μιη Dicke wird 15 min bei 50⁰C mit einer 10gew.-%igen wäßrigen Lösung dieses Reaktionsgemisches getränkt, durch Abtropfen von überschüssiger Tränkflotte befreit und mit beschleunigten Elektronen von 200keV mit 1,5Mrd bestrahlt. Die nicht umgesetzten Substanzen werden in einer Spülvorrichtung ausgewaschen und die Folie getrocknet. Die modifizierte Folie weist ausgezeichnete antistatische Eigenschaften auf.4. The reaction mixture of the azeotropic esterification of polyethylene glycol-400 with acrylic acid in the presence of p-Toluolsulfbnsäure as a catalyst and hydroquinone as a stabilizer in the benzene medium is freed as in Example 1 of benzene. The remaining reaction mixture contains 22.0% monoester, 53.9% diester, 21.6% polyethylene glycol, 2.5% toluenesulfonic acid and stabilizer. A polyamide film of 35μιη thickness is soaked for 15 min at 50 ⁰ C with a 10gew .-% aqueous solution of this reaction mixture, freed by draining excess impregnating liquor and irradiated with accelerated electrons of 200keV with 1.5 billion. The unreacted substances are washed out in a rinsing device and the film is dried. The modified film has excellent antistatic properties.

5. Aus einem Reaktionsgemisch, das durch azeotrope Veresterung von Polyäthylenglykol-400 mit einem Überschuß an Akrylsäure in Gegenwart von Schwefelsäure als Katalysator und Hydrochinon als Stabilisator in Benzol erhalten wurde, wird wie im Beispel 1 das Benzol abgetrennt. Das verbleibende Reaktionsprodukt enthält 21,0% Monoester, 52,3% Diester, 20,6% Polyäthylenglykol, 3,6% Akrylsäure, 2,5% p-Toluolsulfonsäure und den Stabilisator.5. From a reaction mixture obtained by azeotropic esterification of polyethylene glycol-400 with an excess of acrylic acid in the presence of sulfuric acid as a catalyst and hydroquinone as a stabilizer in benzene, the benzene is separated as in Example 1. The remaining reaction product contains 21.0% monoester, 52.3% diester, 20.6% polyethylene glycol, 3.6% acrylic acid, 2.5% p-toluenesulfonic acid and the stabilizer.

Ein Gewebe aus Polyamidseide mit einer Flächenmasse von 70g/m² wird 2 min bei 30°C mit einer 8gew.-%igen wäßrigen Lösung dieses Reaktionsgemisches behandelt, danach auf einen Restfeuchtegehalt von 70% abgequetscht und kontinuierlich im gespannten Zustand unter dem Scanner eines Elektronenbeschleunigers so vorbeigeführt, daß eine Bestrahlungsdosis von 1 Mrd. resultiert, anschließend gespült und in einer Soda-Lösung (0,1 kg Soda/kg Ware) im basischen Bereich (0,85kg Natriumhydroxid/kg Ware) bei 7O⁰C nachbehandelt. Auf diese Weise erhält man ein hydrophil und antistatisch ausgerüstetes Polyamidseidengewebe.A fabric of polyamide silk with a basis weight of 70 g / m ² is treated for 2 min at 30 ° C with a 8gew .-% aqueous solution of this reaction mixture, then squeezed to a residual moisture content of 70% and continuously in the tensioned state under the scanner of an electron accelerator passed so that a radiation dose of 1 billion results, then rinsed and post-treated in a soda solution (0.1 kg soda / kg of goods) in the basic range (0.85 kg sodium hydroxide / kg of product) at 7O ⁰ C. In this way a hydrophilic and antistatically treated polyamide silk fabric is obtained.

6. Das im Beispiel 1 beschriebene Reaktionsgemisch wird im Verhältnis 1:1 mit Akrylsäure gemischt und daraus eine 7,5% wäßrige Lösung hergestellt. Eine Stapelfasermischung, bestehend aus 60% Polyakrylnitrilfasern und 40% Polyamidfasern wird zum Erreichen antistatischer und hydrophiler Eigenschaften mit der genannten Pfropfflotte durch das Besprühen auf einer Siebtrommel behandelt, wobei durch Absaugen ein Feuchtegehalt von 100% eingestellt wird. Auf der Siebtrommel erfolgt durch das Bestrahlen des Materials mit2MeV-Elektronenstrahlen und damit das gleichzeitige Aufpfropfen der Substanzen. Bei einer Bestrahlungsdosis von 1 Mrd. wird ein Pfropfgrad von 5 bis 6% erhalten. Die nicht umgesetzten Substanzen werden durch Besprühen der Fasern auf einer Siebtrommel mit einer 1%igen Na₂CO₃-Lösung bei 7O⁰C ausgewaschen und gleichzeitig werden die COOH-Gruppen versalzt, wodurch zusätzlich zur Verminderung des elektrischen Widerstandes im Hinblick auf die Verbesserung des bekleidungshygienischen Verhaltens dieser Faserstoffmischung die Feuchteaufnahme erhöht wird. Nach dieser Behandlung werden die Fasern mit Wasser gespült, getrocknet und zu Garn und/oder Flächengebilde weiterverarbeitet.6. The reaction mixture described in Example 1 is mixed in a ratio of 1: 1 with acrylic acid and made therefrom a 7.5% aqueous solution. A staple fiber mixture consisting of 60% polyacrylonitrile fibers and 40% polyamide fibers is treated by spraying on a sieve drum to achieve antistatic and hydrophilic properties with said grafting liquor, with a moisture content of 100% being set by suction. The sieve drum is irradiated with 2MeV electron beams and concomitant grafting of the materials. At a radiation dose of 1 billion, a degree of grafting of 5 to 6% is obtained. The unreacted substances are washed by spraying the fibers on a sieve drum with a 1% Na ₂ CO ₃ solution at 7O ⁰ C and at the same time the COOH groups are salted, which in addition to reduce the electrical resistance in terms of improving the clothing hygiene behavior of this pulp mixture, the moisture absorption is increased. After this treatment, the fibers are rinsed with water, dried and further processed into yarn and / or fabrics.

7. Ein bei der Umsetzung von Polyäthylenglykol-400 und Akryloylchlorid in Gegenwart von Triäthylamin und Benzol erhaltene Reaktionsgemisch wird filtriert und das Benzol abdestilliert. Das verbleibende Produkt enthält 90,3% Monoester und 9,7% Diester. Ungereckte Polyesterkabel, die bereits eine teilweise Orientierung durch das Erspinnen aufweisen, werden in einer Tränkvorrichtung mit einer 20%igen wäßrigen Lösung bei einer Temperatur von 4O⁰C kontaktiert. Nach einer Behandlungszeit von 30s wird auf einen Feuchtegehalt von 90% abgequetscht und mit einer Dosis von 5 Mrd. bestrahlt, wobei gleichzeitig gepfropft und vernetzt wird, so daß man eine Massezunahme von 5% erhält. Die nicht umgesetzten Substanzen werden in einer Spülvorrichtung ausgewaschen, die Kabel gereckt, fixiert, gekräuselt und geschnitten. Die so modifizierten Fasern weisen antistatische Eigenschaften sowie ein hohes Bauschvolumen auf. Sie eignen sich besonders zur Mischverarbeitung mit Fasern aus natürlichen Polymeren, wobei durch die verbesserten färberischen Eigenschaften der modifizierten Polyesterfasern das Färben der Mischgarne bzw. daraus hergestellten Flächengebilden vereinfacht wird.7. A reaction mixture obtained in the reaction of polyethylene glycol-400 and acryloyl chloride in the presence of triethylamine and benzene is filtered and the benzene is distilled off. The remaining product contains 90.3% monoester and 9.7% diester. Unstretched polyester cables, which already have a partial orientation by spinning are contacted in an impregnator with a 20% aqueous solution at a temperature of 4O ⁰ C. After a treatment time of 30s, it is squeezed to a moisture content of 90% and irradiated with a dose of 5 billion, grafting and cross-linking at the same time, so that a mass increase of 5% is obtained. The unreacted substances are washed out in a rinsing device, the cables stretched, fixed, curled and cut. The fibers modified in this way have antistatic properties and a high bulk density. They are particularly suitable for mixing processing with fibers of natural polymers, wherein the dyeing of the blended yarns or fabrics produced therefrom is simplified by the improved dyeing properties of the modified polyester fibers.

8. Ein Reaktionsgemisch, das bei der Umsetzung von PÄG-400 mit Akryloylchlorid in Gegenwart von Triäthylamin und Benzol erhalten wurde, wird filtriert und von Benzol befreit. Das verbleibende Reaktionsgemisch enthält 82,1 % Diester und 17,9% Monoester. Ein Polyamidseidenflachkettengewirke mit einer Flächenmasse von 105 g/m² und einer Breite von 1,80 m wird bei 40⁰C mit einer Geschwindigkeit von 25 m/min durch eine Flotte geleitet, die aus einer 7,5gew.-%igen wäßrigen Lösung des o.g. Reaktionsgemisches besteht. Danach wird das Gewirke kontinuierlich auf einen Restfeuchtegehalt von 80% abgequetscht, durch die Bestrahlungszone eines Elektronenbeschleunigers (500 keV, 1 Mrd.) und durch eine Spülflotte geführt. Es resultiert ein modifiziertes Polyamidseiden-Flachkettengewirke mit einem spezifischen Flächenwiderstand ς_Α = 10⁹Ω; nach 50 Haushaltwäschen mit Wasser von 20°dH wurde noch keine Verschlechterung dt: Leitfähigkeit beobachtet. Außerdem wird das Feuchteaufnahmevermögen verbessert.8. A reaction mixture obtained in the reaction of PÄG-400 with acryloyl chloride in the presence of triethylamine and benzene is filtered and freed from benzene. The remaining reaction mixture contains 82.1% diester and 17.9% monoester. A polyamide silk flat warp knitted fabric having a basis weight of 105 g / m ² and a width of 1.80 m is passed at 40 ⁰ C at a speed of 25 m / min through a fleet consisting of a 7.5 wt .-% aqueous solution of og reaction mixture is. Thereafter, the knitted fabric is continuously squeezed to a residual moisture content of 80%, passed through the irradiation zone of an electron accelerator (500 keV, 1 billion) and through a rinsing liquor. The result is a modified polyamide silk Flachkettengewirke with a specific surface resistance ς _Α = 10 ⁹ Ω; after 50 household washes with water of 20 ° dH no deterioration was observed dt: conductivity. In addition, the moisture absorption capacity is improved.

9. Das Reaktionsgemisch wie im Beispiel 8 wird im Verhältnis 1:2 mit Akrylsäure gemischt und mit Wasser zu einer 10%igen Lösung verdünnt. Ein mechanisch verfestigtes Polyamidfaservlies wird in einer Argonschutzgasatmosphäre mit 2 Mrd. bestrahlt, unter Ausschluß von Sauerstoff bis zur Tränkvorrichtung transportiert und in der sauerstofffreien Pfropfflotte 15 min behandelt; anschließend wird das Faservlies auf einen Restfeuchtegehalt von 50% abgequetscht, gespült und durch Behandlung in einer Kaiziumazetatlösung zur Verbesserung der Schmelzwiderstandsfähigkeit mit Ca-Ionen versalzt.9. The reaction mixture as in Example 8 is mixed in the ratio 1: 2 with acrylic acid and diluted with water to a 10% solution. A mechanically solidified polyamide fiber fleece is irradiated in an argon protective gas atmosphere with 2 billion, transported to the impregnation device with the exclusion of oxygen and treated in the oxygen-free grafting fleet for 15 minutes; Subsequently, the nonwoven fabric is squeezed to a residual moisture content of 50%, rinsed and salted by treatment in a Kaiziumazetatlösung to improve the melt resistance with Ca ions.

Claims

A process for modifying high polymers, preferably polyamide, polyester or polyacrylonitrile, or fibers, filaments, sheets or shapes made therefrom by radiation-chemical graft copolymerization, wherein the high polymer is irradiated by means of ionizing radiation and before, during or after irradiation with a polymerizable substance is contacted, characterized in that a high polymer is contacted with a preferably aqueous solution of a mixture of polyethylene glycol diester and / or unsaturated organic acid and / or esterification catalyst and a stabilizer, preferably a resulting in the Polyäthylenglykolesterherstellung reaction mixture consisting of 5 to 98% diester and second to 95% monoester and 0 to 50% polyethylene glycol and 0 to 90% unsaturated organic acid and 0 to 5% esterification catalyst and a stabilizer and electrons accelerated as ionizing radiation with an E nergy of 40 keV to 3 MeV.

2. The method according to claim 1, characterized in that the unesterified or esterified in the reaction mixture contained polyethylene glycol is a polyethylene glycol having any molecular weight from 200 to 1,000, is.

3. The method according to claim 1 to 2, characterized in that the mono- and / or diesters contained in the reaction mixture reaction products of polyethylene glycol with unsaturated organic acids, such as. As acrylic acid, methacrylic acid, crotonic acid, itaconic acid or with the corresponding acid chlorides or with maleic anhydride.

4. The method according to claim 1 to 3, characterized in that the acid radical of the unsaturated organic acid contained in the reaction mixture has the same chemical structure as the acid radical of the Polyäthylenglykolmono- and / or diesters used.

5. The method according to claim 1 to 4, characterized in that the reaction mixture additionally unsaturated carbon or sulfonic acids, such as. As acrylic acid, methacrylic acid, crotonic acid, itaconic acid, vinyl sulfone, p-styrene sulfone, fumaric acid are added.

6. The method according to claim 1 to 5, characterized in that the esterification catalyst is sulfuric acid.

7. The method according to claim 1 to 5, characterized in that the esterification catalyst is an organic sulfonic acid such as. B. p-toluenesulfonic acid.

8. The method according to claim 1 to 7, characterized in that the acid groups of the grafted copolymers are subsequently reacted with metal ions.

9. The method according to claim 1 to 8, characterized in that the ionizing radiation accelerated electrons are used with an energy of 40 keV to 3 MeV.

10. The method according to claim 1 to 9, characterized in that the treatment of the substrate with an aqueous solution of the reaction mixture with any concentration, preferably with 1- to'20% solution.

11. The method according to claim 1 to 10, characterized in that pulp mixtures are modified.