CN1920037A - Transposon gene of rice - Google Patents

Abstract

The present invention relates to a nonautonomous transposon gene, autonomous transposon gene and transposase gene of rice (Oryza sativa); and a method to transpose the transposon gene; and transformed plants by the transposition. The inventors examined nucleotide sequence of rice genomes and discovered nonautonomous transposon genes, autonomous transposon genes and transposase genes and confirmed the transposition of a transposon in the rice cultivars transduced these genes.

Description

Rice transposon gene

The application is to be on November 6th, 2002 applying date, and application number is 02822088.9, and denomination of invention is divided an application for the Chinese invention patent application of " rice transposon gene ".

Technical field

The present invention relates to paddy rice (Oryza sativa) nonautonomy transposon (nonautonomoustransposon) gene, autonomy transposon (autonomous transposon) gene, and transposase gene, also relate to the method that makes transposon gene generation swivel base simultaneously and pass through swivel base and plant transformed.

Background technology

Gene disruption (gene disruption) is always as the genomic instrument of analyzing rice (Oryza sativa).In order to reach the purpose of destroying rice genome, already used method has: by will be wherein with transposase gene (enzyme of catalysis swivel base) as activation factor paddy rice strain of transduceing and the paddy rice strain that wherein imports separation factor match, thereby the method for activation separation factor; Use the method for T-DNA; And the method for use retrotransponsons etc.But, the analysis of paddy rice spontaneous mutation is shown that be not used to discovery activates transposon (cell engineering is augmented volume, the 14th phase of plant cell engineering, " Plant Genome Research guide " in February, 2000, Shujun press) all the time.

On the other hand, the genome sequencing plan is determining to comprise the nucleotide sequence of many plants of paddy rice, and its result is constantly replenished database.Simultaneously, vegeto-animal transposon gene, movable gene have unique nucleotide sequence to a certain extent, and its information makes the more extensive studies of carrying out at transposon become possibility.But, up to the present still have many explanations not to be confirmed.In addition; nucleotide sequence (the Tetsuya Nakazaki etc. of a transposon gene of inferring in by gamma-radiation inductive rice mutant, have been found; " swivel base increment sequence polymorphism inserts small-particle gene (slender-granule gene) the slg site that can suddenly change "; the 100th symposial meeting in August of Japan breeding association, October calendar year 2001).

The problem to be solved in the present invention

The inventor finds that under study for action the transposon gene of rice genome nucleotide sequence has a characteristic inverted repeats.By possible transposon nucleotide sequence is used different experimental techniques, the inventor confirms that this nucleotides sequence classifies a transposon gene (nonautonomy transposon) as.

In addition, the inventor has also found the autonomy transposon gene on the basis of nonautonomy transposon gene.The inventor has also found transposase gene simultaneously, and described gene can make described transposon gene generation swivel base.

The method of dealing with problems

The inventor is begun by No. 1 karyomit(e), and (LTR) detects to the long terminal repeat in the rice genome sequence, and it is registered one by one into database.The inventor notices in registration number is the clone of AP002843 a LTR (seeing Table 1), this sequence is furtherd investigate the back discovery two transposon gene characteristic inverted repeats are arranged in the downstream of closing on LTR, lay respectively at the 144459th～144473 bit base and the 144874th～144888 bit base (seeing Fig. 1, SEQID NO:6).The inventor confirms, being positioned at two inverted repeats intermediary nucleotide sequences (SEQ ID NO:1) is a nonautonomy transposon gene, can make it that remarkable swivel base takes place by for example anther cultural manual handling commonly used, will be explained with embodiment hereinafter.

Table 1

The AP002843 oryza sativa genomic dna, No. 1 karyomit(e), PA

Registration number AP002843 NCBI SRS genome-net

Organism paddy rice NCBI SRS

26 days January calendar year 2001 of site AP002843 148762bp DNA PLN

Feature locations/qualifier

Source 1...148752

/ karyomit(e)=" 1 "

/ clone=" P0407B12 "

/ Cultivar=" Nipponbare "

/ organism=" paddy rice "

/ order-checking molecule=" DNA "

LTR 139482...139690

/ note=" 5 ' end LTR "

CDS 139739...144052

/ gene=" P0407B12.28 "

/ note=" may cause inactivation " owing to CDS reading frame error code

/ note=" pseudogene, with Oryza longistaminata, may

Be gag/ polyprotein U72725 "

/ vacation

LTR 144047...144255

/ note=" 3 ' end LTR "

The CDS associating (144653...144692,145148...145311)

/ codon _ initial=1

/ gene=" P0407B12.29 "

/ note=" albumen of supposition "

/ albumen _ numbering=" BAB17191.1 "

/ translation=" MRRSHGGGGRKRSVPSSSHPEKKA

IDRIKREDAGRRAGRVSLVQPLAAFPATDGGG

GGGLARLLRWW”

Next, the inventor uses the Blast research tool, and nonautonomy transposon gene (SEQ IDNO:1) has been carried out homology search (search dna homology).Most of Search Results all is this transposon gene (SEQ ID NO:1) itself, but has also obtained two sequences that are contemplated to transposon gene in addition simultaneously, and its registration number is respectively AP004236 and AP003968.The nucleotide sequence of AP004236 and AP003968 is compared, and the inventor finds that the both is positioned on No. 6 karyomit(e), and is the sequence of same overlapping region.

Therefore, homology between the 1st～253 bit base of nonautonomy transposon gene (SEQ ID NO:1) and the 89360th～89612 bit base of AP004236 is 252/253 (99%), and the homology between the 94524th～94700 bit base of the 254th～430 bit base of nonautonomy transposon gene (SEQ ID NO:1) and AP004236 is 177/177 (100%).They all are the sequences of high conservative.

It is the inverted repeats of 15 bp that nonautonomy transposon gene (SEQ ID NO:1,430 bp) and transposon (SEQID NO:2,5341 bp) all have length, and all with TTA and TAA as identification with insert the site.

Opening code-reading frame (ORF) Search Results that SEQ ID NO:2 (5341 bp) is carried out shows that two reading frame ORF I that infer and ORF II are arranged.

What upper part of Fig. 9 showed is the transposon gene structure that comprises SEQ ID NO:2.Nonautonomy transposon gene (SEQ ID NO:1,430 bp) is positioned at the 1st～253 bit base and the 5165th～5341 bit base, and ORF I is positioned at the 1526th～1914 bit base and the 1939th～2663 bit base, and ORF II is positioned at the 3190th～4557 bit base.

In addition, in order to obtain and to comprise the similar gene of SEQ ID NO:2 gene, the inventor uses the Blast research tool, SEQ ID NO:2 has been carried out homology search (search dna homology), its result is except that SEQ ID NO:2 itself, and also having registration number is two sequences of AP004753 (No. 2 karyomit(e)) and AP003714 (No. 6 karyomit(e)).These two clones have identical nucleotide sequence (SEQ ID NO:3), and are positioned at (several copies) on the different karyomit(e).Because this nucleotide sequence is present in long-grained nonglutinous rice (indica) (mutation of a kind of paddy rice) equally, this gene is inevitable to have conservative property by japonica rice (japonica) to a plurality of mutation of long-grained nonglutinous rice.SEQ ID NO:3 (5166 bp) is the same with SEQ ID NO:2 to have an inverted repeats, equally also with TAA (3 bp) as identification with insert the site.

SEQ ID NO:3 is carried out opening code-reading frame (ORF) search obtained ORF I and ORF II, both two kinds of albumen of may encoding.What lower part of Fig. 9 showed is the transposon gene structure that comprises SEQ ID NO:3 (5341 bp).Nonautonomy transposon gene (SEQ ID NO:1,430 bp) is positioned at the 1st～170 bit base and the 5092nd～5166 bit base, but lacks the homologous nucleotide sequence of nonautonomy transposon gene (SEQ ID NO:1,430 bp) in the middle of both.ORF I is positioned at the 1630th～2652 bit base, and ORF II is positioned at the 2959th～4407 bit base.

The nucleotide sequence of the SEQ ID NO:3 that comparison japonica rice (AP004753 and AP003714) and long-grained nonglutinous rice are comprised, discovery homology between the two is greater than 90%, and it the results are shown in Figure 10.In addition, the inventor has also detected the mutation rate of nonautonomy transposon gene (SEQ ID NO:1,430 bp) in long-grained nonglutinous rice, its result as shown in figure 11 sequence homology greater than 95%.

The inventor does not still understand the ORF I function of SEQ ID NO:2 and SEQ ID NO:3 at present.

In order to understand the ORF II transposase (enzyme of catalysis swivel base) of whether encoding, whether the inventor has identical conservative region with known transposase gene to the ORFII amino acid sequence coded is checked.The ORF II amino acid sequence coded of SEQ ID NO:2 and SEQ ID NO:3 is marked as SEQ ID NO:4 and 5 respectively.Comparison (alignment) between these two ORF II amino acid sequence coded (SEQID NO:4 and 5) is shown in Figure 12, and both homologys are greater than 75% (77%).These two aminoacid sequences all have DXG/AF/F motif and YREK motif (Q.H.Le, K.Turcotte and T.Bureau, Genetics 158:1081-1088 (2001)), therefore can draw the conclusion that it all belongs to IS transposase family.

Homology between SEQ ID NO:2 and 3 the ORF II nucleotide sequence is equally greater than 75% (79.3%).

Therefore, the present invention is a rice transposon gene, and it is made up of a kind of nucleotide sequence, and the homology between this nucleotide sequence and the SEQ ID NO:1 is at least 95%.Be at least the function that 95% DNA is considered to have the nonautonomy transposon with SEQ ID NO:1 homology, handle to make it that swivel base takes place with anther culture or chemical reagent.The present invention also is a rice transposon gene, wherein is inserted with enhanser or promotor.

In addition, the present invention is a rice transposon gene, and the homology between its nucleotide sequence and SEQ ID NO:2 or 3 is at least 90%.Be at least the function that 90% DNA is considered to have the autonomy transposon with the homology of SEQ ID NO:2 or 3, handle to make it that swivel base takes place with anther culture or chemical reagent.

The present invention also is a paddy rice transposase gene, and the homology between the 3190th～4557 bit base of its DNA and SEQ ID NO:2 or the 2959th～4407 bit base of SEQ ID NO:3 is position 75% at least.Be considered to have the function that can make transposon generation swivel base with above-mentioned nucleotide sequence homology more than or equal to 75% DNA.

The present invention also is a transposase gene, and its encoded protein matter is made up of the aminoacid sequence of SEQ ID NO:4 or 5 or the aminoacid sequence of the generation one of above-mentioned aminoacid sequence or several amino acid whose disappearances, replacement or interpolation.This transposase can be a rice transposon gene, and the homology between its aminoacid sequence and SEQ ID NO:4 or 5 is at least 75%.

In addition, the present invention also is this proteinic transposase gene of coding.The present invention also comprises the plasmid that contains above-mentioned arbitrary transposon gene.The present invention comprises the plasmid that contains promotor and arbitrary above-mentioned transposase gene equally.Can use double carriers such as Ti-plasmids and pBI-121 plasmid for reaching this purpose.The promotor that is suitable among the present invention comprises cauliflower mosaic virus 35s promotor, heat-shocked promotor, chemotaxis (chemotaxis) promotor and other promotors.The method not restriction of the present invention to integrating promotor and said gene group, engineered general method is promptly applicable.

The present invention includes transduction and go into the transformant (transformant) of above-mentioned transposon gene.Plant is preferred host, especially paddy rice, barley, wheat or corn.By using engineered general method, we can insert these genomes above-mentioned plasmid and transform these plants.

The present invention also comprises the transformant of transduce promotor and above-mentioned transposase gene.Also transducible other transposon genes of words if necessary.Above-mentioned promotor all is applicable to the present invention.Plant is preferred host, especially barley, wheat or corn.By using engineered general method, we can insert the said gene group above-mentioned plasmid and transform these plants.

Content of the present invention also comprises the method that makes arbitrary above-mentioned transposon gene generation swivel base, comprises arbitrary above-mentioned transformant is carried out anther culture or chemical reagent processing.

The present invention also comprises by arbitrary aforesaid method makes above-mentioned transposon gene generation swivel base, and with its plant transformed or seed.Paddy rice or its adjacent kind as barley, wheat or corn are preferred plant.

The present invention also comprises the method for determining transposon gene integration zone, comprise with arbitrary aforesaid method and make arbitrary above-mentioned transposon gene generation swivel base, by obtaining plant extract DNA, be used in the restriction endonuclease that does not have restriction enzyme site in the transposon gene and digest above-mentioned DNA, connect the dna fragmentation that obtains, the above-mentioned dna fragmentation of pcr amplification, and the nucleotide sequence of definite above-mentioned PCR product.Above-mentioned PCR the primer is the oligonucleotide that comprises from 5 ' 10 continuous bases of holding of SEQ ID NO:1, and preferred version is 10～20 continuous bases, and more preferably scheme is 10～15 bases; And comprise from SEQ ID NO:1 3 ' end 10 continuous bases oligonucleotide, preferred version is 10～20 continuous bases, more preferably scheme is 10～15 bases; Or comprise oligonucleotide with the sequence of above-mentioned sequence complementary Nucleotide.Since comprise from SEQ ID NO:1 5 ' end 10～15 continuous bases oligonucleotide with comprise from SEQ ID NO:1 3 ' end 10～15 continuous bases oligonucleotide overlap each other, if therefore this oligonucleotide is less than 15 continuous bases, we can use single primer.That is to say that we can use the oligonucleotide that comprises from 10～15 continuous bases of 5 ' end of SEQ ID NO:1, or comprise oligonucleotide with 10～15 continuous bases of its complementary as the PCR primer.By this method, determine that the integration site of transposon gene can be found ruined genome.

Description of drawings

Fig. 1 is the part (SEQ ID NO:6) of the genome nucleotide sequence of AP002843 for registration number.Transposon gene characteristic inverted repeats is positioned at the 144459th～144473 and the 144874th～144888 bit base, and then after the LTR.

Fig. 2 is the agarose gel electrophoresis result (embodiment 2) who comprises DNA zone (registration number AP002843) the PCR product of four kinds of paddy rice mutation climax leaves transposon DNA.Having inserted should the zone near bar carrying means one transposon gene (430 bp) of Nihonbare 850bp.And Koshihikari, all near 420bp, then show does not have transposon gene to insert to the band of Hitomebore and Yamahoushi.

Fig. 3 is the agarose gel electrophoresis result (Comparative Examples 1) who comprises DNA zone (registration number AP002843) the PCR product of the interior transposon DNA of the different callus (callus) of Nihonbare seed.

Fig. 4 is the agarose gel electrophoresis result (embodiment 3) who comprises DNA zone (registration number AP002843) the PCR product of transposon DNA in the different callus of Nihonbare flower pesticide.Near 420bp bar carrying means disappearance transposon gene.

Fig. 5 is the agarose gel electrophoresis result (embodiment 4) of transposon DNA in the different callus of Nihonbare flower pesticide.The 1st swimming lane is the Nihonbare contrast, and the 2nd～10 swimming lane is by anther callus regenerated plant.With the probe in detecting DNA band that comprises part transposon nucleotide sequence.Compare with the Nihonbare contrast, the 2nd and the 6th swimming lane shows positive band (representing with arrow).

Fig. 6 is the photo of the transformant phenotype found in the regeneration paddy rice among the embodiment 4.The leaf of this paddy rice is short and curling.

Fig. 7 is the agarose gel electrophoresis result (embodiment 5) who comprises the DNA zone PCR product of transposon DNA in the different callus of Nihonbare seed.The numeral of upper limb shows the concentration of U-18496.Near this fragment deletion transposon gene (430bp) of bar carrying means 300bp.

Fig. 8 is 4 clones' a base sequence, and these 4 clones all lack transposon gene (430bp).

Fig. 9 is the transposon gene structure that comprises the nucleotide sequence of SEQ ID NO:2 and 3.

Figure 10 is japonica rice (AP004753 and AP003714) and long-grained nonglutinous rice (support 6962 (the Scaffold6962)) nucleotide sequence homology in SEQ ID NO:3 zone.

Figure 11 is long-grained nonglutinous rice transposon gene (SEQ ID NO:1, mutation rate 430bp).

Figure 12 is the comparison between the ORF II amino acid sequence coded of SEQ ID NO:2 and 3.Homology between the two is greater than 75% (77.8%, homologous amino acid is used the * mark in the drawings), and the both has DXG/AF/F motif and YREK motif.The lines of top are the aminoacid sequence (corresponding to the ORF II of SEQ ID NO:2) of SEQ ID NO:4, and the lines of below are the aminoacid sequence (corresponding to the ORF II of SEQ ID NO:3) of SEQ ID NO:5.

Figure 13-left side figure is the agarose gel electrophoresis result (embodiment 6) who comprises DNA zone (registration number AP004236) the PCR product of transposon DNA in the different callus of Nihonbare flower pesticide.Disappearance at the bar carrying means transposon gene at 1.2Kbp place.Figure 13-right side figure is the agarose gel electrophoresis result (Comparative Examples 2) who comprises from the DNA zone (registration number AP004236) of transposon DNA in the different callus of Nihonbare seed.

The agarose gel electrophoresis result (embodiment 7) of Figure 14 for showing that autonomy transposon gene in different paddy rice mutation (SEQ ID NO:2 is in the upper limb demonstration of photo) exists or lacks.There is autonomy transposon gene (SEQ ID NO:2) in DNA bar carrying means shown in the arrow in Nihonbare (the 1st swimming lane) and Koshihikari (the 2nd swimming lane), then this DNA band lacks in Taichung No.65 (the 3rd swimming lane) and Kasarasu (the 4th swimming lane).

Figure 15 goes into the gel electrophoresis result (embodiment 8) of the Taichung No.65 anther callus DNA of Nihonbare autonomy transposon gene (SEQ ID NO:2) for transduction.DNA bar carrying means shown in the arrow lacks autonomy transposon gene (SEQ ID NO:2) in original Taichung No.65 (the 2nd swimming lane), but has this gene in the Taichung No.65 (the 3rd～6 swimming lane) of autonomy transposon gene (SEQ ID NO:2) that transduces.

Figure 16 goes into the gel electrophoresis result of the Taichung No.65 anther callus nonautonomy transposon gene DNA zone PCR product of Nihonbare autonomy transposon gene (SEQ ID NO:2, embodiment 8) for comprising transduction.Disappearance at the observed DNA stripe size prompting of L06 gene locus nonautonomy transposon gene.

Figure 17 is the nucleotide sequence of prompting at the dna fragmentation of L02 gene locus disappearance nonautonomy transposon gene.Lacked the nucleotide sequence of nonautonomy transposon gene (SEQ ID NO:1) in this site.

Figure 18 is the nucleotide sequence of prompting at the dna fragmentation of L06 gene locus disappearance nonautonomy transposon gene.Lacked the nucleotide sequence of nonautonomy transposon gene (SEQ ID NO:1) in this site.

Embodiment

At first, the present invention is paddy rice nonautonomy transposon gene (SEQ ID NO:1), and this DNA size is 430bp.This transposon gene has size to be the inverted terminal repeat sequence of 15bp, and the symmetrical structure (CT) that size is 215bp.

Next the present invention also comprises two kinds of transposon genes (SEQ ID NO:2 and 3), and the both is the autonomy transposon gene, the transposase of encoding respectively (SEQ ID NO:4 and 5).

The characteristics of autonomy transposon gene have movable characteristics, and can induce the swivel base of nonautonomy transposon gene for himself coding transposase.And the nonautonomy transposon gene lacks transposase, does not have movable characteristics, and need carry out swivel base under the assistance of autonomy transposon gene.The relatively topology discovery of autonomy transposon gene and nonautonomy transposon gene, except that the DNA zone of disappearance, both nucleotide sequences have homology and high conservative.

Carry the plant of transposon of the present invention, or with transposon plant transformed of the present invention, or the plant of carrying transposase gene of the present invention, or can handle or anther culture be induced and activated by radiation exposure, chemical reagent, thereby make transposon generation swivel base of the present invention with transposase gene plant transformed of the present invention.Owing to can make the activation of transposon height with aforesaid method, therefore can easyly make artificial transposon generation swivel base.

Chemical-agent technique is seed, leaf, root, and the stem of axillalry bud of handling plant such as paddy rice with chemical reagent; Or handle its callus.For example the method for handling these plants with U-18496 or 5-azadeoxycytidine is generally plant transplanting in solid that contains the above-mentioned chemical reagent of 0.01mM～5mM or liquid nutrient medium, and preferred concentration is 0.05mM～2mM.In this article, callus dedifferentes the plant organ that has broken up for by culturing plants organ such as root, leaf or stem etc. in the suitable culture medium that adds suitable concn plant hormone or cytokinin, and a cell mass that forms.This cell mass does not break up, and has totipotency in differentiation.Totipotency refers to that this cell mass can be regenerated as new organ such as bud or root etc.For example a slice leaf can produce up to a hundred clones by the callus mediation.

Anther culture is a kind of generation double haploid (doubled haploid) cultured method.Take off flower pesticide from paddy rice stamen top, and cultivate adding based on the plant hormone parahormone and be aided with in the substratum of hormones such as multiploid induction chemical substance such as colchicine.Because haploid cell can become double somatocyte easily, therefore can obtain double somatocyte by flower pesticide simply, promptly carry the double somatocyte of a cover gene.Organize spontaneously by anther cultural rice callus chromosome number is doubled, thereby in cultivating over a long time, obtain the double haploid cultivation.Can obtain homozygote seed or mutant plant by callus culture.We are the main substratum that adds the cytokinin parahormone that uses in regeneration is cultivated.

Suffer that owing to having inserted the transposon gene that swivel base takes place the destructive transposon gene can detect with probe, its preparation method is for designing a cover primer with two suitable in transposon gene different IPs nucleotide sequences, and pcr amplification obtains probe.The relation that detects between rice transformation mutant and its gene makes us can illustrate the function of this gene.

Confirm simply that with transposon tagging system (transposon tagging system) a ruined gene is a challenging task.The definite integration site of transposon can be directly determined in existing many methods such as transposon demonstration etc.But the working method of these methods is often all very complicated.The inventor has set up a kind of simple method with inverse PCR.In this method, be a very important committed step at transposon gene indoor design PCR primer.By extracting DNA in the plant, with suitable digestion with restriction enzyme DNA (we use Alu I in this example), this restriction endonuclease must not have restriction enzyme site in transposon gene inside, makes DNA that intramolecularly take place with ligase enzyme again and connects to form ring molecule.As template, design one cover primer carries out PCR with obtaining cyclic DNA, and originally these two primers point to the other side's reverse direction mutually, but then point to the other side mutually in the ring-shaped DNA molecule after connection.The primer that is used for inverse PCR can be the oligonucleotide that comprises at least from 5 ' 10 continuous bases of holding of SEQID NO:1, and comprise the oligonucleotide of 10 continuous bases from the 3 ' end of SEQID NO:1, the interior region (5 ' end of SEQ ID NO:1 and 3 ' 15 the continuous bases of holding) of preferred version at least for selecting inverted terminal repeat sequence; Or comprise and nucleotide sequence complementary oligonucleotide.To obtaining PCR product check order can clear and definite transposon gene integration site.To use nonautonomy transposon (SEQ ID NO:1) is example, enhanser or promotor is integrated into the nonautonomy transposon can induces enhanser or promotor with the nonautonomy transposon swivel base to take place.Exactly, the genome that inserts enhanser or promotor is transduceed into paddy rice or other plant; Or cultivate its flower pesticide; Or it is handled with chemical reagent; Or inducing its genome generation swivel base, we can prove by other genomic activity expressions of swivel base genome flank, and obtain many mutant with function.

In above-mentioned example, we can use cauliflower mosaic virus 35s promotor as promotor, and a series of quadruplet enhansers zone in the 35s promotor is as enhanser (being positioned at-90～-440 zones of sequence).Except that the genome inverted repeats interior region that carries SEQ ID NO:1, limit without any other for the integration site of enhanser.Equally, remove the genome inverted repeats interior region carry SEQ IDNO:1, and do not have beyond methionine(Met) exists in its integration site downstream zone, for the integration site of promotor also without any other restrictions.If do not influence the transposon swivel base, the preferred integration site of enhanser and promotor all be SEQ IDNO:1 250 near.We can use the restriction enzyme digestion sites that SEQ ID NO:1 genome is cut into two sections nucleotide fragments, or use the cloning site of PCR preparation to integrate enhanser and promotor.

The invention effect

Because people do not understand paddy gene for a long time, so the present invention has proved the mobility transposon gene of paddy rice for the first time.In addition, but the inventor also by having confirmed that such as simple method such as anther culture the nonautonomy transposon gene is a swivel base.That is to say that we successfully provide a kind of novel method that makes the nonautonomy transposon gene that artificial swivel base take place.

Among the cited hereinafter embodiment, we have proved by can make nonautonomy transposon gene disappearance such as manual methods such as anther culture.In addition, we have also directly confirmed the site that the nonautonomy transposon gene inserts.Because we have found to realize the transposon gene of artificial swivel base, we have successfully set up the rice transposon tag system for the first time.

The present invention has also further confirmed the transposon gene (SEQ ID NO:2 and 3) of paddy rice, and the transposase gene that comprises in the genome.The inventor goes into the rice transposon gene of autonomy transposon gene swivel base can take place by confirmed transduction such as simple method such as anther culture or drug treating.That is to say to the invention provides the simple manual method that transforms these plants that the method for taking this can be gone into paddy rice or other plant with autonomy transposon gene or the artificial transduction of transposase gene.

Autonomy transposon gene of the present invention can be used as the random mutagenesis agent, and sets up the transposon tagging system in paddy rice and other plants.The present invention can be used for preparing the plant variety that swivel base takes place tens of kinds of transposons at random.Because plant is minimum at the probability of the spontaneous swivel base of self-sow process speciogenesis, therefore can in the seed callus that anther callus that plant tissue culture obtained or U-18496 are handled, induce the generation of swivel base effectively.Effectively the plant generation swivel base beyond the inducing paddy rice equally also is feasible, only needs get final product by certain method for transformation transduction autonomy transposon.The analysis of the mutant plant that obtains can be finished by genetic analysis or cdna reverse analysis.

Genetic analysis is the method that a kind of separation causes the reason gene that mutant undergos mutation.If transposon gene of the present invention is relevant with certain mutant phenotype, it is separated that this phenotypic reason gene can pass through label (transposon).

For example, if wish to seek the rice varieties of salt tolerant, the salt tolerance of the paddy rice that can form by the cultivating seeds that detects the transposon tagging system, thus find required rice varieties.

The cdna reverse analysis is a kind of by the method for separating the mutant that loses certain gene function among the wild-type host group.If with certain required gene of transposon tagging mark, then the phenotype of this gene-correlation should be suddenlyd change.By different mutant DNA isolation, and set up the label genomic library.We can obtain such transposon tagging system by public storage center.By screening transposon tagging system, we can be with PCR with required gene-transposon as an overall separation.

The latest developments of genome project make preparation one cover become possibility with the corresponding mutant of whole rice genome and with the corresponding transposon insertion site database of different mutants.The user can order required seed by searching for this database.

Hereinafter listed examples can describe the present invention in detail, but its original meaning is not for limiting use range of the present invention.

Embodiment 1:

Cultivar Nihonbare (Kikuchi etc. (1998) Plant Biotechnology 15:45-48) by a kind of paddy rice extracts DNA.For the DNA district, center that increases between two inverted terminal repeat sequences at transposon DNA two ends, we use the oligonucleotide of the sequence that comprises SEQ ID NO:7 as the PCR primer.The PCR reactive system is GeneAmp9600 system (ABI Co.).Each reaction system (100 μ l) is by 200ng DNA, 2.5 unit TaKaRa Ex Taq enzymes (TakaraCo.), 10 μ l, 10 * Ex Taq damping fluid, and 8 μ l dNTP mixtures (every kind of dNTP is 2.5mM), and the 200pmol primer is formed.Each PCR circulation comprises 94 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ were extended 12 minutes.35 circulations altogether.After reaction finishes, with 1%SeaKemGTG sepharose (FMC Co.) DNA isolation.The about 450bp of dna fragmentation of amplification goes into the pCRII-TOPO plasmid by cloning test kit (In Vitrogen) with TA behind the gel recovery dna fragmentation with its subclone.(ABI Co.) checks order to all clones with the 310DNA sequenator.Determined nucleotide sequence is named as SEQ ID NO:1, is made up of 430bp.

Embodiment 2:

By 4 kinds of rice cultivar Nihonbare, Koshihikari, the leaf of Hitombore and Yamahoushi extracts DNA.In order to comprise the DNA zone of transposon gene (registration number AP002843) with pcr amplification, we use the oligonucleotide of the sequence that comprises SEQ ID NO:8 and 9 as the PCR primer.Each reaction system (100 μ l) is by 200ng DNA, and the 2.5 AmpliTaq Gold of unit enzymes (ABI Co.), 10 μ l, 10 * GeneAmp PCR damping fluid (contains 15mM MgCl ₂), 10 μ lGeneAmp mixtures (every kind of dNTP is 2mM), and the 200pmol primer is formed.Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ were extended 1 minute.35 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) DNA isolation.Fig. 2 is the agarose gel electrophoresis result.Only near the band of Nihonbare (the 2nd swimming lane) last visible 850bp.Near the 850bp band points out this dna fragmentation to comprise the SEQ ID NO:1 transposon gene (430bp) described in the embodiment 1.At Koshihikari, find not comprise the DNA band of transposon gene among Hitomebore and the Yamahoushi simultaneously, size is 420bp.In these paddy rice mutation, the gene that comprises SEQ ID NO:1 only exists the effect of this gene of prompting may be transposable element in Nihonbare.

Comparative Examples 1:

Handle the Nihonbare seed with 3% chlorine bleach liquor and made its sterilization in 15～30 minutes, be inoculated in after the aqua sterilisa rinsing in the petri diss (Iwaki Co.) of the 90mm * 20mm of built-in 20ml～30ml substratum, 9 seeds of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to contain 4g CHU (N6) BasalSalt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (Sigma Co.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g take off acetyl gellan gum (gelrite) solid medium (Wako) and form.At the 10th day of inducing culture, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of seed, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (SigmaCo.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

After cultivating for two weeks, extract DNA by seed callus.In order to comprise the DNA zone of transposon DNA by pcr amplification, we with the oligonucleotide of the sequence of mentioning among the embodiment 2 that comprises SEQ ID NO:8 and 9 as the PCR primer.Each reaction system (100 μ l) is by 200ngDNA, the 2.5 AmpliTaq Gold of unit enzymes (ABI Co.), and 10 μ l, 10 * GeneAmp PCR damping fluid (contains 15mM MgCl ₂), 10 μ l GeneAmp mixtures (every kind of dNTP is 2mM), and the 200pmol primer is formed.Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ were extended 1 minute.35 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) DNA isolation.Fig. 3 is the agarose gel electrophoresis result.Only find a near band 850bp.Near this 850bp band points out this dna fragmentation to comprise transposon gene.The dna fragmentation expection size of disappearance transposon gene is 420bp, does not but find in electrophoresis.The probability of finding near the DNA band of size 420bp is 0/64 callus (0%).Therefore, this result's proof transposon gene in seed callus is Immobile.

Embodiment 3:

The grain ear of Nihonbare under the i.e. harvesting, 10 ℃ of deepfreezes 10 days, was sterilized 1 minute with 1% chlorine bleach liquor, and used rinsed with sterile water before appearance.Flower pesticide is taken by taking, be inoculated in 35 * 10mm petri diss (CORNING Co.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4gCHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

After cultivating for two weeks, extract DNA by anther callus.In order to comprise the DNA zone of transposon DNA by pcr amplification, we with the oligonucleotide of the sequence of mentioning among the embodiment 2 that comprises SEQ ID NO:8 and 9 as the PCR primer.Each reaction system (100 μ l) is by 200ngDNA, and the 2.5 AmpliTaq Gold of unit enzymes (ABI Co.), 10 μ l, 10 * GeneAmp PCR damping fluid (contains 15mM MgCl ₂), 10 μ l GeneAmp mixtures (every kind of dNTP is 2mM), and the 200pmol primer is formed.Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ were extended 1 minute.35 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) DNA isolation.Fig. 4 is the agarose gel electrophoresis result.As shown in Figure 4, two DNA bands that lay respectively at 850bp and 420bp are arranged.Near the 850bp band points out this dna fragmentation to comprise transposon gene.Near the 420bp band is pointed out this dna fragmentation disappearance transposon gene.The probability of finding near the DNA band of size 420bp is 11/64 callus (17.2%).

Size is pointed out this fragment deletion transposon gene for the DNA band about 420bp in the present embodiment, and be the PCR product of anther callus, the dna fragmentation that is increased is (big or small for about 420bp, N=5) by reclaiming on the gel, and with TA clone test kit (In Vitrogen) with its subclone to the pCRII-TOPO plasmid.With the 310DNA sequenator these 5 clones are checked order.The comparison of these nucleotide sequences has proved the disappearance (data do not show in this article) of transposon gene in these 5 clones.Therefore, the inventor has confirmed the disappearance of transposon gene on the nucleotide sequence level.

In Comparative Examples 1, the transposon gene of cotyledon dish (seed) cell cultures is Immobile, but in the present embodiment, the transposon gene of flower pesticide cell culture is movable on very big probability.

Embodiment 4:

The grain ear of Nihonbare under the i.e. harvesting, 10 ℃ of deepfreezes 10 days, was sterilized 1 minute with 1% chlorine bleach liquor, and used rinsed with sterile water before appearance.Flower pesticide is taken by taking, be inoculated in 35 * 10mm petri diss (CORNING Co.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).The anther callus of grown cultures after two weeks is implanted in 90 * 20mm petri diss of built-in 20～30ml substratum 30 ℃, the following cultivation 24 hours of regenerating of illumination.Our employed substratum is to comprise 4.3g MS Basal Salt Mixture (Gibcobrl Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), and 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

Extract DNA with the CTBA method by 9 anther callus regeneration seedling.With the DNA that restriction enzyme Hind III digestion is extracted, 0.8%LO3 agarose (Takara Co.) gel electrophoresis is transferred on the nylon membrane (HybondN+) (AmershamCo.) by the alkali blotting with DNA again.Southern hybridization is the luminous DNA detection test kit of DIG (Roche Co.) with test kit.What be used to prepare probe is PCR DIG probe synthetic agent box (Roche Co.).In order to comprise the DNA zone, inside of transposon DNA by pcr amplification, we with the oligonucleotide of the sequence of mentioning among the embodiment 2 that comprises SEQ ID NO:10 and 11 (both is positioned at the inside of SEQ ID NO:1 (transposon gene)) as the PCR primer.Fig. 5 is the agarose gel electrophoresis result.As shown in Figure 5, compare, found two new bands (shown in the arrow) at the 2nd and the 6th swimming lane with the Nihonbare contrast.This two rules carrying means transposon gene has inserted these seedling, and destroyed subsequently.

On the basis of present embodiment, transposon gene inserts new this fact of gene locus and has obtained confirmation.In addition, also found the example (its genes involved is not found as yet) of a morphology sudden change as shown in Figure 6 in the regeneration paddy rice, this sudden change example may point out the morphology genes involved owing to the insertion of transposon gene is destroyed.

Embodiment 5:

Handle the Nihonbare seed with 3% chlorine bleach liquor and made its sterilization in 15～30 minutes, be inoculated in after the aqua sterilisa rinsing in the petri diss (IwakiCo.) of 90 * 20mm of built-in 20～30ml substratum, 9 seeds of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (SigmaCo.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

After a couple of days, begin to form callus in the rice paddy seed cotyledon dish, and became oyster white gradually at the 10th day that cultivates, length reaches 5mm.This 5mm is long, milky callus is implanted into respectively in the growth medium that has added 0mM, 0.01mM, 0.03mM, 0.05mM, 0.1mM or 0.3mM5-U-18496 (Sigma Co.), and under 30 ℃, illumination grown cultures 24 hours.Our employed substratum is to comprise 4g CHU (N6) Basal SaltMixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (Sigma Co.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

After in growth medium, cultivating for two weeks, extract seed callus DNA with the pocket test kit of Dneasy plant (QIAGEN).In order to comprise the DNA zone of transposon DNA by pcr amplification, we are with comprising the oligonucleotide of SEQ ID NO:12 and 13 as the PCR primer.

We prepare the PCR reaction mixture with HotStarTaq Master Mix test kit (QIAGEN).

Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ were extended 1 minute.45 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) DNA isolation.

In the substratum that has added 0.03mM～0.3mM U-18496, cultivate among the callus DNA that obtains, can be observed two bands (Fig. 7) that lay respectively at 730bp and 300bp.Near the 730bp band points out this DNA to comprise a transposon gene.Near the 300bp band then points out this DNA not comprise transposon gene (430bp).

With the dna fragmentation of 300bp by reclaiming on the gel, and with TA clone test kit (InVitrogen) with its subclone to the pCRII-TOPO plasmid.(ABI Co.) checks order to 4 clones of obtain with the 310DNA sequenator.Fig. 8 is that the multiple ratio of these 4 clone's nucleotide sequences is right.In these 4 clones, all do not find the transposon gene sequence.

Present embodiment shows, a kind of demethylation reagent U-18496 even can induce the swivel base of transposon gene of the present invention in seed callus.On this result's basis, we can expect can obtain hundreds of the clones by this transposon gene swivel base with a seed.

Embodiment 6:

The grain ear of Nihonbare under the i.e. harvesting, 10 ℃ of deepfreezes 10 days, was sterilized 1 minute with 1% chlorine bleach liquor, and used rinsed with sterile water before appearance.Flower pesticide is taken by taking, be inoculated in 35 * 10mm petri diss (CORNING Co.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).The anther callus of grown cultures after two weeks is implanted in 90 * 20mm petri diss of built-in 20～30ml substratum 30 ℃, the following cultivation 24 hours of regenerating of illumination.Our employed substratum is to comprise 4.3g MS Basal Salt Mixture (Gibcobrl Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), the amino fast quinoline solution (Sigma Co.) of 10ml 6-benzyl, 2ml α-Nai Yisuan solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

After in growth medium, cultivating for two weeks, extract anther callus DNA (Kikuchi etc. (1998) Plant Biotechnology 15:45-48).In order to comprise the DNA zone of transposon DNA by pcr amplification, we use the oligonucleotide of the sequence that comprises SEQ ID NO:14 (the 88933rd～88962 bit base of AP004236) and SEQ ID NO:15 (the 95545th～95574 bit base of AP004236) as the PCR primer.Each reaction system (100 μ l) is by 200ng DNA, the 2.5 TaKaRa LA Taq of unit enzymes (Takara Co.), 10 μ l, 10 * LAPCR damping fluid II, 6 μ l 25mM MgCl ₂, 8 μ l dNTP mixtures (every kind of dNTP is 2.5mM), and the 100pmol primer is formed.

Each PCR circulation comprised 94 ℃ of sex change 30 seconds and 68 ℃ of extensions 12 minutes.35 circulations altogether.After reaction finishes, with 0.8%LO3 sepharose (Takara Co.) DNA isolation.Being positioned near the band of 6.6kbp points out this DNA band to comprise transposon gene of the present invention (5341bp).Because the size of transposon gene of the present invention is about 5.4kbp, so near the band that we can estimate to be positioned at the 1.2kbp lacks this transposon gene.Obtain one in the present embodiment and be positioned near the DNA band (Figure 13) of 1.2kbp.More than these results show that the transposon gene of anther callus is movable.The probability of finding near the DNA band of size 1.2kbp is 3/64 callus (4.7%).The MITE that present embodiment proof paddy rice is carried SEQ ID NO:2 is movable in anther callus.

Comparative Examples 2:

The seed of the Cultivar Nihonbare of paddy rice handled with 3% chlorine bleach liquor made its sterilization in 15～30 minutes, be inoculated in after the aqua sterilisa rinsing in the petri diss (Iwaki Co.) of 90 * 20mm of built-in 20～30ml substratum, 9 seeds of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (Sigma Co.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).At the 10th day of inducing culture, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of seed, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal SaltMixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (Sigma Co.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).Extract DNA (Kukuchi etc. (1998) Plant Biotechnology 15:45-48) by seed callus after in growth medium, cultivating for two weeks.In order to comprise the DNA zone of transposon DNA by pcr amplification, we use the oligonucleotide of the sequence that comprises SEQ IDNO:14 and 15 as the PCR primer.Each reaction system (100 μ l) is by 200ng DNA, the 2.5 TaKaRa LA Taq of unit enzymes (Takara Co.), 10 μ l, 10 * LAPCR damping fluid II, 6 μ l 25mM MgCl ₂, 8 μ l dNTP mixtures (every kind of dNTP is 2.5mM), and the 100pmol primer is formed.Each PCR circulation comprised 94 ℃ of sex change 30 seconds and 68 ℃ of extensions 12 minutes.35 circulations altogether.After reaction finishes, with 0.8%LO3 sepharose (TakaraCo.) DNA isolation.In all seed callus samples, all can find near a DNA band that is positioned at the 6.6kbp, but not be positioned near the band (Figure 13) the 1.2kbp.This results suggest transposon gene in seed callus is Immobile.The probability of finding near the DNA band of size 1.2kbp is 0/64 callus (0%).

Embodiment 7:

In the present embodiment, in order to seek the Cultivar of not carrying autonomy transposon gene (SEQ ID NO:2), and be illustrated in the callus that carries and do not carry autonomy transposon gene (SEQ ID NO:2) and whether have any different between the swivel base efficient of nonautonomy transposon gene, we have induced the anther callus that does not carry autonomy transposon gene (SEQ ID NO:2) by each Cultivar, and have detected the wherein swivel base efficient of nonautonomy transposon gene.Four kinds of rice cultivar Nihonbare, Koshihikari, Taichung No.65 and Kasarasu leaf DNA have been extracted with the CTAB method.The DNA that extracts with restriction enzyme HindIII digestion, the 1.0%LO3 agarose gel electrophoresis separates, after the alkali blotting is transferred to nylon membrane (HybondN+, Amersham Co.) with DNA, carries out Southern hybridization with the luminous DNA detection test kit of DIG (RocheCo.) and detect.Preparation probe used kit is a PCR DIG probe synthetic agent box (Roche Co.) for by pcr amplification autonomy transposon gene specific DNA zone, we with the oligonucleotide of the sequence that comprises SEQ ID NO:16 and 17 as the PCR primer.The result of Southern hybridization is presented at the copy that an autonomy transposon gene is respectively arranged among Nihonbare and the Koshihikari and exists, but does not then have (Figure 14) in Taichung No.65 and Kasarasu.

We have induced callus by Taichung No.65 flower pesticide subsequently, and whether nonautonomy transposon gene (SEQ ID NO:1) swivel base is taken place detect.

With the grain ear of Taichung No.65 before formation promptly by under the harvesting on the terminal bud, 10 ℃ of deepfreezes 10 days, 1% chlorine bleach liquor's sterilising treatment rinsed with sterile water after 1 minute.Flower pesticide by taking on the caryopsis, is inoculated in 35 * 10mm petri diss (CORNINGCo.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

Extract DNA (Kukuchi etc. (1998) Plant Biotechnology 15:45-48) by anther callus after in growth medium, cultivating for two weeks.In order to pass through pcr amplification autonomy transposon gene specific DNA zone, we use the oligonucleotide of the sequence that comprises SEQ ID NO:18 and 19 (L02), SEQ ID NO:20 and 21 (L06), SEQ ID NO:22 and 23 (L07) as the PCR primer.Each reaction system (100 μ l) is by 200ng DNA, the 2.5 AmpliTaq Gold of unit enzymes (ABI Co.), and 10 μ l, 10 * GeneAmp PCR damping fluid (comprises 15mM MgCl ₂), 10 μ l Gene Amp mixtures (every kind of dNTP is 2mM), and the 200pmol primer is formed.Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ extended 1 minute.35 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) electrophoretic separation DNA.The result is presented at L02, the L06 of the Taichung No.65 that does not carry autonomy transposon gene (SEQ ID NO:1) and the swivel base that the nonautonomy transposon gene does not all take place in the L07 site (table 2, first row).But as shown in Comparative Examples 3, in the Nihonbare anther callus that carries autonomy transposon gene (SEQ ID NO:2), swivel base takes place with high-level efficiency (10.9%～31.3) in the nonautonomy transposon gene.

Table 2

	L02	L06	L07
				Callus from flower pesticide	0/64	0/64	0/64
The anther callus of gene transfer	2/38 5.3％	1/38 2.6％	0/38 0％

Comparative Examples 3:

The grain ear of Nihonbare under the i.e. harvesting, 10 ℃ of deepfreezes 10 days, was sterilized 1 minute with 1% chlorine bleach liquor, and used rinsed with sterile water before appearance.Flower pesticide is taken by taking, be inoculated in 35 * 10mm petri diss (CORNING Co.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).Extract DNA by anther callus after in growth medium, cultivating for two weeks.In order to comprise the DNA zone of transposon gene DNA by pcr amplification, we with the oligonucleotide of the sequence of mentioning among the embodiment 7 that comprises SEQ ID NO:5 and 1 as the PCR primer.Each reaction system (100 μ l) is by 200ngDNA, the 2.5 AmpliTaq Gold of unit enzymes (ABI Co.), and 10 μ l, 10 * GeneAmp PCR damping fluid (comprises 15mM MgCl ₂), 10 μ l Gene Amp mixtures (every kind of dNTP is 2mM), and the 200pmol primer is formed.Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ extended 1 minute.35 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) electrophoretic separation DNA.We find that two are positioned at 850bp and near the DNA band of 420bp.Near the 850bp band points out this DNA to comprise a transposon gene.Near the 420bp band is then pointed out in these dna fragmentations and has been lacked transposon gene.The probability of finding near the DNA band of size 420bp is 11/64 callus (17.2%).

Embodiment 8:

In the present embodiment, we have separated the DNA zone that comprises autonomy transposon gene (SEQ ID NO:2), it is transduceed do not carry in the Cultivar (Taichung No.65) of autonomy transposon gene (SEQ ID NO:2), and detect the probability that swivel base takes place nonautonomy transposon gene in this Cultivar (SEQ ID NO:1).

The DNA zone that comprises autonomy transposon gene (SEQ IDNO:2) for the rice cultivar Nihonbare that increases, we have designed two primer nucleotide sequence SEQ ID NO:24 and 25 to carry out the PCR reaction, and both sequences lay respectively at next-door neighbour's upstream and downstream of target DNA zone (SEQ ID NO:2).We have synthesized the oligonucleotide of SEQ ID NO:24 and 25, and with it as the PCR primer.Extract Nihonbare leaf DNA with the CTAB method.Each reaction system (100 μ l) is by 200ng DNA, the 2.5 TaKaRa LA Taq of unit enzymes (Takara Co.), 10 μ l, 10 * LAPCR damping fluid II, 6 μ l 25mM MgCl ₂, 8 μ l dNTP mixtures (every kind of dNTP is 2.5mM), and the 100pmol primer is formed.Each PCR circulation comprises that 94 ℃ of sex change 30 seconds and 68 ℃ extended 1 minute.35 circulations altogether.After reaction finishes, with 0.8%LO3 sepharose (Takara Co.) electrophoretic separation DNA.We have obtained to comprise the DNA band that autonomy transposon gene, size are about 6.6kbp.Cut glue and reclaim near dna fragmentation (6.6kbp), and with TA clone test kit (In Vitrogen) with its subclone to the pCRII-TOPO plasmid, select ApaI and KpnI multiple clone site to be come out by excision in the pCRII-TOPO plasmid as restriction enzyme site, subclone is to carrying a selected marker thing gene (hygromycin resistance gene) and can be used for the binary vector of plant transfection, and with electroporation it transduceed into recombinant plasmid transformed edaphic bacillus (Agrobacteria) EHA101.The recombinant plasmid transformed edaphic bacillus infected anther callus before three days, with the streak inoculation of recombinant plasmid transformed edaphic bacillus to the AB substratum that contains kantlex (Wako) and Totomycin (Wako).

Subsequently, will comprise in the anther callus of dna fragmentation (about 6.6kbp) by agrobacterium-mediated transduction to a rice cultivar of recombinant plasmid transformed TaichungNo.65 of autonomy transposon gene (SEQ ID NO:2).

The grain ear of Taichung No.65 under the i.e. harvesting, 10 ℃ of deepfreezes 10 days, was sterilized 1 minute with 1% chlorine bleach liquor, and used rinsed with sterile water before appearance.Flower pesticide is taken by taking, be inoculated in 35 * 10mm petri diss (CORNING Co.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

After in growth medium, cultivating for two weeks, with recombinant plasmid transformed edaphic bacillus transfection TaichungNo.65 anther callus.After recombinant plasmid transformed edaphic bacillus streak inoculation to AB media surface cultivated 3 days, with spatula it is scraped, with AAM substratum (25ml) mixing that has added the 10mg/L Syringylethanone.Place in the petri diss (IWAKI) being mixed with the substratum of transfection with the recombinant plasmid transformed edaphic bacillus.To in growth medium, cultivate the anther callus in two weeks and place in the wire cloth, immerse the transfection mixed culture medium 2 minutes.Subsequently wire cloth is placed on the aseptic paper handkerchief to remove unnecessary substratum.With tweezers filter paper is fixed on the symbiotic culture medium, callus is placed on the filter paper, the surgical tape sealing was cultivated 3 days in 28 ℃ of dark.Our employed symbiotic culture medium is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 30g sucrose (Wako), 10g glucose (Wako), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 2g takes off acetyl gellan gum (Wako), the solid medium of 10mg Syringylethanone.Behind the symbiosis culture 3 days, callus is placed in the Erlenmeyer flask, add the 100ml sterilized water, after the vibration water is discarded.After sterilized water washing for several times, with after the rinsing liquid washing of having added 500mg/ml carbenisillin, callus is implanted in the petri diss again, each culture dish is implanted into 9 callus, and surgical tape seals under back 25 ℃ of light and cultivated one month.Our employed selection substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 30g sucrose (Wako), 0.3g casamino acids (DIFCO), 2.878g proline(Pro) (ICN), 0.1g meso-inositol (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 500mg Totomycin (Wako), 50mg Pyocianil (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).

Cultivated for 3～4 weeks in selecting substratum after, we have detected Nihonbare autonomy transposon gene and the contingent swivel base of nonautonomy transposon gene (SEQ ID NO:1) in the hygromycin resistance callus.

Extract DNA according to described method in (Kikuchi etc. (1998) Plant Biotechnology 15:45-48) by the hygromycin resistance callus.In order to comprise the DNA zone of autonomy transposon gene (SEQ ID NO:2) by pcr amplification, we with the oligonucleotide of the sequence that comprises the SEQ ID NO:24 that lays respectively at target DNA zone (SEQID NO:2) next-door neighbour's upstream and downstream and 25 as the PCR primer.

Each reaction system (100 μ l) is by 200ng DNA, the 2.5 TaKara LA Taq of unit enzymes (Takara Co.), 10 μ l, 10 * LA PCR damping fluid, 6 μ l 25mM MgCl ₂, 8 μ l dNTP mixtures (every kind of dNTP is 2.5mM), and the 100pmol primer is formed.Each PCR circulation comprises that 94 ℃ of sex change 30 seconds and 68 ℃ extended 12 minutes.35 circulations altogether.After reaction finishes, with 0.8%LO3 sepharose (Takara Co.) electrophoretic separation PCR product.As shown in figure 15, we have confirmed that Nihonbare autonomy transposon gene in the TaichungNo.65 of hygromycin resistance callus swivel base has taken place.

In order to comprise the DNA zone of nonautonomy transposon gene by pcr amplification, we use the oligonucleotide of the sequence that comprises SEQ ID NO:18 and 19 (L02), SEQ ID NO:20 and 21 (L06), SEQ ID NO:22 and 23 (L07) as the PCR primer.We prepare the PCR reaction mixture with HotStarTaqMaster Mix test kit (QIAGEN).Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 55 ℃ of renaturation 1 minute, and 72 ℃ extended 2 minutes.45 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) electrophoretic separation DNA.We have detected the probability that nonautonomy transposon gene disappearance in the callus of autonomy transposon gene is gone in 38 transductions, found that a DNA band (shown in the arrow), this band prompting has the disappearance (Figure 16) of nonautonomy transposon gene at the L06 gene locus.The nonautonomy transposon gene is about 0～5.3% (table 2, the 2nd row) at the probability of L02, L06, L07 gene locus disappearance.

The dna fragmentation of prompting nonautonomy transposon gene in L02 and L06 gene locus disappearance reclaimed by gel, and clone test kit (In Vitrogen) subclone to the pCRII-TOPO plasmid with TA.Measure the clone's that obtains nucleotide sequence with 310DNA sequenator (ABI Co.).Found that among these clones and all do not have nonautonomy transposon gene (Figure 17,18).

The above results is presented at transduction and goes in the TaichungNo.65 anther callus of Nihonbare autonomy transposon gene the nonautonomy transposon gene and induced swivel base has taken place.

On the basis of The above results, we can draw as drawing a conclusion, promptly the expressed transposon gene of SEQ ID NO:2 can not only be in anther callus autonomous swivel base, can also regulate the swivel base of nonautonomy transposon gene.

Embodiment 9:

In the present embodiment, we have detected SEQ ID NO:3 at anther callus of handling through U-18496 and the transposition activity in the cotyledon dish callus.

The grain ear of Nihonbare under the i.e. harvesting, 10 ℃ of deepfreezes 10 days, was sterilized 1 minute with 1% chlorine bleach liquor, and used rinsed with sterile water before appearance.Flower pesticide is taken by taking, be inoculated in 35 * 10mm petri diss (CORNING Co.) of built-in 3ml liquid nutrient medium, 50 flower pesticide of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4 dichlorophenoxyacetic acid (Sigma Co.), the liquid nutrient medium of 30g sucrose (Wako).At inducing culture after 3～4 weeks, to induce in the petri diss (Iwaki Co.) of 90 * 20mm of the implanted built-in 20～30ml substratum of callus of flower pesticide, grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (SigmaCo.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2ml α-Nai Yisuan solution (Sigma Co.), 2ml kinetin solution (Sigma Co.), 3g casamino acids (DIFCO), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).Extract DNA according to described method in (Kikuchi etc. (1998) Plant Biotechnology 15:45-48) by anther callus after in growth medium, cultivating for two weeks.

The seed of the Cultivar Nihonbare of paddy rice handled with 3% chlorine bleach liquor made its sterilization in 15～30 minutes, be inoculated in after the aqua sterilisa rinsing in the petri diss (Iwaki Co.) of 90 * 20mm of built-in 20～30ml substratum, 9 seeds of inoculation in each culture dish, inducing culture is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4g CHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (Sigma Co.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (Sigma Co.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).At the 10th day of inducing culture, induce the implanted built-in 20～30ml of callus of seed to add in the growth medium of 0mM, 0.1mM, 0.5mM U-18496 (Sigma Co.), grown cultures is 24 hours under 30 ℃, illumination.Our employed substratum is to comprise 4gCHU (N6) Basal Salt Mixture (Sigma Co.) in the 1L substratum, 1ml MS vitamin solution (SigmaCo.), 2mg 2,4-dichlorphenoxyacetic acid (Sigma Co.), 0.3g casamino acids (DIFCO), 0.1g meso-inositol (Sigma Co.), 2.878g proline(Pro) (Wako), 30g sucrose (Wako), 2g takes off the solid medium of acetyl gellan gum (Wako).Extract DNA with the pocket test kit of Dneasy plant (Qiagen) by seed callus after in growth medium, cultivating for two weeks.

In order to comprise the DNA zone of transposon DNA by pcr amplification, we use the oligonucleotide of the sequence that comprises SEQID NO:26 and 27 as the PCR primer.Each reaction system (100 μ l) is by 200ng DNA, the 2.5 TaKaRa LA Taq of unit enzymes (Takara Co.), 10 μ l10 * LAPCR damping fluid II, 6 μ l 25mM MgCl ₂, 8 μ l dNTP mixtures (every kind of dNTP is 2.5mM), and the 100pmol primer is formed.Each PCR circulation comprised 94 ℃ of sex change 30 seconds and 68 ℃ of extensions 12 minutes.35 circulations altogether.After reaction finishes, separate the PCR product with 0.8%LO3 sepharose (Takara Co.).

The result shows that the transposon gene of the nucleotide sequence comprise SEQ ID NO:3 in anther callus and cotyledon dish callus swivel base does not take place all, but in the cotyledon dish callus of handling through U-18496 the incidence very high (table 3) of swivel base.

Table 3:

	Miss rate
		Callus (Nihonbare) from flower pesticide	0/64(0％)
Callus (Nihonbare) from the cotyledon dish	0/64(0％)
		The 0mM U-18496	0/8(0％)
0.1mM U-18496	2/8(25％)
		0.5mM U-18496	7/8(87.5％)

The transposon gene that comprises the nucleotide sequence of SEQ ID NO:3 has the structure of an autonomy transposon gene, the encoding sequence that wherein also comprises a transposase, therefore can be activated by U-18496, and the swivel base of control nonautonomy transposon gene (SEQ ID NO:1).

Embodiment 10:

Extract the climax leaves DNA of a rice cultivar Kasarasu with the pocket test kit of Dneasy plant (QIAGEN).For the DNA zone of inserting transposon gene by the pcr amplification next-door neighbour, we use the inverse PCR method.We comprise the oligonucleotide of 15 bases of 5 ' end from SEQ ID NO:1 (5 '-CCATTGTGACTGGCC-3 ') as the PCR primer.The employed system of PCR is GeneAmp9600 system (ABI Co.).What be used to prepare the PCR reaction soln makes HotStarTaq Master Mix test kit (QIAGEN).Each PCR circulation comprises 96 ℃ of sex change 30 seconds, 44～58 ℃ of renaturation 1 minute, and 72 ℃ extended 1 minute.45 circulations altogether.After reaction finishes, with 2%LO3 sepharose (Takara Co.) electrophoretic separation PCR product.The dna fragmentation that is increased is cloned test kit (In Vitrogen) subclone to the pCRII-TOPO plasmid with TA.Measure the clone's that obtains nucleotide sequence with 310 dna sequencing instrument (ABI Co.).

Sequence table

＜110〉independent administrative legal person's science and technology development organization

＜120〉rice transposon gene

<130>FS02-290PCT

<160>27

<210>1

<211>430

<212>DNA

＜213〉paddy rice

<400>1

ggccagtcac aatgggggtt tcactggtgt gtcatgcaca tttaataggg gtaagactga 60

ataaaaaatg attatttgca tgaaatgggg atgagagaga aggaaagagt ttcatcctgg 120

tgaaactcgt cagcgtcgtt tccaagtcct cggtaacaga gtgaaacccc cgttgaggcc 180

gattcgtttc attcaccgga tctcttgcgt ccgcctccgc cgtgcgacct ccgcattctc 240

ccgcgccgcg ccggattttg ggtacaaatg atcccagcaa cttgtatcaa ttaaatgctt 300

tgcttagtct tggaaacgtc aaagtgaaac ccctccactg tggggattgt ttcataaaag 360

atttcatttg agagaagatg gtataatatt ttgggtagcc gtgcaatgac actagccatt 420

gtgactggcc 430

<210>2

<211>5341

<212>DNA

＜213〉paddy rice

<400>2

ggccagtcac aatggaggtt tcactggtgt gtcatgcaca tttaataggg gtaagactga 60

ataaaaaatg attatttgca tgaaatgggg atgagagaga aggaaagagt ttcatcctgg 120

tgaaactcgt cagcgtcgtt tccaagtcct cggtaacaga gtgaaacccc cgttgaggcc 180

gattcgtttc attcaccgga tctcttgcgt ccgcctccgc cgtgcgacct ccgcattctc 240

ccgcgccgcg ccgcgccacg cctccttccc gcgtgaacat tcctccttcc cgcgcgagcg 300

attccaccat ctcccccgtc cggcgcctac ggagtacacc gcaaccggtc gccccaatcc 360

ggcgcctaga ccgtgaccca cccgccatct tccgcaagac cgaatcccca acccacccac 420

catcttccgc cgcccccgtc cccgtccccg gccatggatc cgtcgccggc cgtggatccg 480

tcgccggccg tggatccgtc gccggctgct gaaacccggc ggcgtgcaac cgggaaagga 540

ggcaaacagc gcgggggcaa gcaactagga ttgaagaggc cgccgccgat ttctgtcccg 600

gccaccccgc ctcctgctgc gacgtcttca tcccctgctg cgccgacggc catcccacca 660

cgaccaccgc aatcttcgcc gattttcgtc cccgattcgc cgaatccgtc accggctgcg 720

ccgacctcct ctcttgcttc ggggacatcg acggcaaggc caccgcaacc acaaggagga 780

ggatggggac caacatcgac catttcccca aactttgcat ctttctttgg aaaccaacaa 840

gacccaaatt catggtacat gtattttctt ctttttctgt tactttcaac ctacggtaac 900

tctaattcat ggatgagact actgccattg tgcagttcaa tgctttttct tcatgttata 960

tttcgtccag ctgtgagtta tggtttgaag attgctgtgg ttgtttcatt gctgagtatg 1020

tgaaagatag atggatgaaa gagagaatta tattttagtc tgtaatcttg ctcatccagt 1080

tgctcatgta tgaccttggt tctagaatgt tgccctgact gtatgcttaa tgttcagaga 1140

agtgatgcct aaagcagtga gatcagtggg atcagattag ctatcgacat ataatattag 1200

ctatctcagt tgtgaaagag agatgggtga aaaggcaccc cttggattaa ttctgtagta 1260

tcaaattctg caccttgtct gtccatatgt tctgcttggt tggtgggtgc agtgcatttg 1320

taaaaaatag tttgcttctg atccttaata tatgtaacag ggaatgaatt ttcacccatc 1380

tcagttgtaa aggtactgtc ttgctatgca atatgtgtaa attgacaaac ctgaaaatag 1440

tctgtttgga atttgcaaaa gcaattcgat agtttggaat ttccaaacct cagtcagcag 1500

taggcaatcc attttagttc ttgctatgca caaaaacagt acacctgata tgctcatttt 1560

aatacaactt ttttgtctct gttacagttt ggtcaggggt tatcctccag gagggtttgt 1620

caattttatt caacaaaatt gtccgccgca gccacaacag caaggtgaaa attttcattt 1680

cgttggtcac aatatgggat tcaacccaat atctccacag ccaccaagtg cctacggaac 1740

accaacaccc caagctacga accaaggcac ttcaacaaac attatgattg atgaagagga 1800

caacaatgat gacagtaggg cagcaaagaa aagatggact catgaagagg aagagagact 1860

ggtattcatc ggatactttt acatttccat atgtctttgt tttgactaat acttgacagg 1920

tcattaactg attcttgtag gccagtgctt ggttgaatgc ttctaaagac tcaattcatg 1980

ggaatgataa gaaaggtgat acattttgga aggaagtcac tgatgaattt aacaagaaag 2040

ggaatggaaa acgtaggagg gaaattaacc aactgaaggt tcactggtca aggttgaagt 2100

cagcgatctc tgagttcaat gactattgga gtacggttac tcaaatgcat acaagcggat 2160

actccgacga catgcttgag aaagaggcac agaggctgta tgcaaacagg tttggaaaac 2220

cttttgcgtt ggtccattgg tggaagatac tcaaagatga gcccaaatgg tgtgctcagt 2280

ttgaatcaga gaaagacaag agcgaaatgg atgctgttcc agaacagcag tcacgtccta 2340

ttggtagaga agcagcaaag tctgagcgca atggaaagcg caagaaagaa aatgttatgg 2400

aaggcattgt cctcctaggg gacaatgtcc agaaaattat aaaggtccac gaagaccgga 2460

gggtggatcg tgaaaaggcc accgaagcac agattcagat atcaaatgca acattgttgg 2520

ccgctaagga gcagaaggaa gcaaagatgt tcgatgtgta caatactcta ttaagtaagg 2580

atacaagcaa catgtctgaa gatcaaatgg ctagccacca gagggcaata cggaaattag 2640

aggagaagct atttgcggat taaggtgagt tttataaact gaccactatt ttctgaaatg 2700

tatgaattct gaaatttata tacaattgtg taaacatgga aaattagata atgtatgcat 2760

gatgcacaac atgtgcgtgc agcactattt aatggcagtt tcacaagtgt gaaaactgac 2820

cactatagta ctattgtggt gtgaaaactg accactacta ttgtggtgtg aatgctactg 2880

tggtgtgaaa actgaccact atagtttcac attcctggat gcagccctcc tctatatata 2940

tagatacagt cctcatctct tcctggcata cacacagccc tcttctctaa ttcctggacg 3000

cagtcctcat ctcttcctgg catagacgca gcccttctct cttcctgttt agttcaacaa 3060

cattgaggtg atctgccttt ctttgaagtt tctatctttt ttcactgctg tgaatgatta 3120

tttctctgct gtgaatgatt atttctccaa tcttcctttg ttcaccttct ctctttctct 3180

gctgtgaaga tgtctggaaa tgaaaatcag attcctgtgt ccttgttgga cgagtttctc 3240

gctgaggatg agatcatgga tgagataatg gatgatgttc tccatgaaat gatggtgtta 3300

ttgcagtcct ccatcggaga tcttgaaaga gaggctgctg accatcgttt gcatccaagg 3360

aagcacatca agaggccacg agaggaagca catcaaaatt tggtgaatga ttatttctct 3420

gaaaatcctc tatatccttc caatattttt cgccgaagat ttcgtatgta caggccgctg 3480

tttttacgta ttgtggacgc attaggccag tggtcagatt actttactca gagggtagat 3540

gccgctggta ggcaagggct tagtccatta caaaagtgta ctgcagcaat tcgccaattg 3600

gctactggta gtggtgctga tgaactagat gagtatttga agattggaga gactactgct 3660

atggatgcta tgaaaaattt tgtgaaagga attagagaag tatttggtga aagatatctc 3720

aggcgtccca ctgtagaaga tactgaacga ctactcgagc ttggtgagag acgcggtttt 3780

cctggtatgt tcggtagcat tgactgtatg cattggcaat gggaaaggtg cccaactgcg 3840

tggaagggtc agttcactcg tggtgatcaa aaagtgccaa cgctgattct tgaggcagtg 3900

gcatcacatg atctttggat ttggcatgcg ttctttggag tagcaggttc taacaatgat 3960

atcaatgttt tgagccgatc tactgtgttt atcaatgagc tgaaaggaca agctcctaga 4020

gtgcagtaca tggtaaatgg gaatcaatac aacgaaggtt attttcttgc tgatggaatt 4080

taccctgaat ggaaggtatt tgctaagtca tatcgactcc ctatcactga gaaggagaag 4140

ttgtatgcac aacatcaaga aggggcaaga aaggatatcg agagagcatt tggtgttcta 4200

caacgtcgat tctgcatctt aaaacgacca gcccgtctat atgaccgagg tgtactccgt 4260

gatgttgtcc taggttgcat catacttcac aatatgatag ttgaagatga gaaggaagcg 4320

cgacttattg aagaaaatct agatttaaat gagcctgcta gttcatcaac ggttcaggca 4380

ccagaattct ctcctgacca gcatgttcca ttagaaagaa ttttagaaaa ggatactagt 4440

atgagagatc gtttggctca tcgccgactc aagaatgatt tggtggaaca tatatggaat 4500

aagtttggtg gtggtgcaca ttcatctggt aattatgttt ttattttgca ttattagtta 4560

tctatggtac taagatatgt acaagtttct ctaaattgca ctaaatctgt ggttcatatt 4620

ggatatgtgt aaactatgaa tgtagcctga ctaaaaccat cattcatgct gaactggttt 4680

ttgttttgta tatgcaggat gaaacaagga actaggtttc tgaacgcatt acggactgaa 4740

ggttgagggg cagaatgatc cacccagttg cttctatcag atcactaaag tttcatttca 4800

ctgttttatt ttggacactt gatgcttgtg tgcatccgat gaatgtttaa tttggtcacc 4860

tgatgcttgt gtgcatccga tgaatgttta atttggtcac ctgatgcttg tatgcagtta 4920

tctatcttat ttgttaatgt tgctggtact gaggattttt agaagtgaaa tgcacaagtt 4980

gctgtgtttt ttgactgatc cttgtgtgca cttgacgttg tatgtgacaa atgatggttc 5040

ccagttgtgc acctgattca tgattcagtt attcagttta aattgacgtt gtttgtgtgc 5100

accttttgtc agttagccag ttacggctgg aagttgtgta agtttgtgtg acgcctggct 5160

acaggatttt gggtacaaat gatcccagca acttgtatca attaaatgct ttgcttagtc 5220

ttggaaacgt caaagtgaaa cccctccact gtggggattg tttcataaaa gatttcattt 5280

gagagaagat ggtataatat tttgggtagc cgtgcaatga cactagccat tgtgactggc 5340

c 5341

<210>3

<211>5166

<212>DNA

＜213〉paddy rice

<400>3

ggccagtcac aatgggtgtt tcatttgagt gtcatgcgca tttaatacag tgacaagtca 60

gcaaaagagc aatatttgca tgaaatgggt aggagagaga gtaaactcgt ttcaccatgg 120

tgacacgaga tagcgccgtt tcccaggtcg ctgaaacggg gtgaaacagc attgagagtt 180

catcgtttca cctccgggat cccgtgcgag cgctgctctt cgccatcttc gcgcgcatcg 240

ccggattctt cccgcgcgag tcccccatct tcccgcgcag cacctccatg ttcccgcccc 300

caaagcactg gctcgaagct tttttcccca atctcacctg caaccctagc gccagactca 360

gtccccatcg ccccgtccgt cccataccct agcgcaagaa ccacgagcgg agattgcgga 420

gctggatcca caagtaggtg gtgaatcctg tccatctgcc gccgtccgcc gtccagcagc 480

catggatcca caaggaggtg gtggatcccg tctgagcgcc gccggcagag gagggaataa 540

gcgtgggggc aagcagctgg gcctgaagag gtcgtcggcg cctgctccat caccggcaac 600

agctcagcca ccgctgcctg caagttcccc tcctgaagct ccatcgccgg caacagttca 660

gccgcctact ccatcgtcaa gtcctgctgt tgctgccccc agttcatccc ctgctgtacc 720

gatgtcaacc atgcccccat ggccaccgca aggagcagga tggggctctg taccccccaa 780

ttttgctttt ctgcaaggaa accaacaagg cccaagttca tggtattttc tccttgtcac 840

agattattca ctgtacacta tgatacatga tatgactctc ttcttcatgc attagtaatt 900

agttcctgtt tatgctcaat gaaatttgtt agaatcagta tgtcagtaca ttggtaattt 960

gatatatgcc tgagtaatga atagaaaaaa tgtagtattc agtatggatt gcagtaatac 1020

tttgttagtg aaaattcagt attcagtatg cagtatggat tgcggcttgt ataacagaaa 1080

ttgaaagcaa aagattcagt ttgcaatctg gacagtgtac tgtacaacat gtaattcaca 1140

tacgtaaagc ttgttaaata tctccttgtc agtacattgg taacaaatgc tttgagtgta 1200

aatgccaagg gtatcatcct aacattggta tatattttta gccttctgta tggaatgcag 1260

acatggtctt ctttgcaacc acagcaacag cttgccctac actctgtgct gtcgtcatag 1320

ctaaccaaat aacctgttag tactgatata tatggtcttc tttgcaacca cagcaacagc 1380

ttgccctaca tggtcttctg tatgcttgac taaacttgtt acttgacata tatgcttgac 1440

tgaacttgtt gcttgactga attattcctt acacatactg tagtacttgc ttgactgaac 1500

tatgtcagga tcttattaaa aaaaatctat gtcagcactg ctactatgtc aggatcatca 1560

gtatgatgct taagtaacct gttagtatgt cagtacttac tatgtcagga tcatcttctg 1620

gaacttacta tgtttgattt tcttatgctg ccatcggttt caattggatt tgcttcttat 1680

gttttcaggt tgtatcctac agaaggcttc gtaaattttc tccaacagaa ctgtctgccg 1740

cagccacaag aaggtgaaaa ttttcacctt gttggtcaga ctaccaacac aatgtctact 1800

ccaccaccaa caccccaagc tgcagctaac aatacagtcc aaattgatat tcatgaagat 1860

gcaatcaatg atgcaagtgc taaaaagaga agtttgagat attggactca tgatgaggaa 1920

gagagattgg ctagtgcttg gttgaatgct tctaaagatc ccattcatgg gaatgaaaag 1980

aaaggtgata cgttttggaa agaggttact gatgagttca acagaaaagg gaatgggaag 2040

cgtacaaggg aaataaatca attgaaggtt cattggtcac gcctcaaatc atcgattgga 2100

gaattcaatg attactggac taaggtaact caaatgaata caagcggata tgacgatgac 2160

atgctggaga aggaggcaca acagatgtat gcaaatacat ttggaaagcc ttttgcactt 2220

gtgcattggt ggaagatact gagaaaagag cccaagtggt gtgcaatgat tgagaaggac 2280

aaaaacaagg ctgaagtggt tgatattcca gatgaacaaa agcgtcccat tggtagagaa 2340

gcagcacaag ccgagcgcaa tggaaaacgc aagaaggaca gtatgtcaga aggaattgtc 2400

atcctagggg acaatattga aaaaattatc aaagtgacgc aagatcggaa gctggagcgt 2460

gagaaggtca ctgaagcaca gattcacatt tcaaacgtaa atttgaaggc agcagaacag 2520

caaaaagaag caaagatgtt tgaggtatac aattccctgc tcactcaaga tacaagtaac 2580

atgtctgaag aacagaaggc tcgccgagac aaggcattac aaaagctgga ggaaaagtta 2640

tttgctgact aaggttagat atctaatcta atctgagctg cactattatt tataataatt 2700

aaagaatgct gcaatattta gttatattgt ctgtatatct gtgctgcact atgcagtcag 2760

ctgcatatca cgaatttgtc aaatctgagc tgcatatctg tgaatggtgc aatatttagt 2820

tatattaatt acccagtgtg aatgatgtat tgctgtcagt ttcacatata gtatgaatgc 2880

tgcactatgc agtcagtttc acatgcagtg tgaatgctgc actaggcagt cagtttcaca 2940

tgcagtgggc gcctatttat gcagagttta gccatctctc tactcctctc agaaactcat 3000

tccctctttt ctcatacgaa gacctcctcc cttttatctt tactgtttct ctcttcttca 3060

aagatgtctg agcaaaatac tgatggaagt caagttccag tgaacttgtt ggatgagttc 3120

ctggctgagg atgagatcat agatgatctt ctcactgaag ccacggtggt agtacagtcc 3180

actatagaag gtcttcaaaa cgaggcttct gaccatcgac atcatccgag gaagcacatc 3240

aagaggccac gagaggaagc acatcagcaa ctagtgaatg attacttttc agaaaatcct 3300

ctttaccctt ccaaaatttt tcgtcgaaga tttcgtatgt ctaggccact ttttcttcgc 3360

atcgttgagg cattaggcca gtggtcagtg tatttcacac aaagggtgga tgctgttaat 3420

cggaaaggac tcagtccact gcaaaagtgt actgcagcta ttcgccagtt ggctactggt 3480

agtggcgcag atgaactaga tgaatatctg aagataggag agactacagc aatggaggca 3540

atgaagaatt ttgtcaaagg tcttcaagat gtgtttggtg agaggtatct taggcgcccc 3600

accatggaag ataccgaacg gcttctccaa cttggtgaga aacgtggttt tcctggaatg 3660

ttcggcagca ttgactgcat gcactggcat tgggaaagat gcccagtagc atggaagggt 3720

cagttcactc gtggagatca gaaagtgcca accctgattc ttgaggctgt ggcatcgcat 3780

gatctttgga tttggcatgc attttttgga gcagcgggtt ccaacaatga tatcaatgta 3840

ttgaaccaat ctactgtatt tatcaaggag ctcaaaggac aagctcctag agtccagtac 3900

atggtaaatg ggaatcaata caatactggg tattttcttg ctgatggaat ctaccctgaa 3960

tgggcagtgt ttgttaagtc aatacgactc ccaaacactg aaaaggagaa attgtatgca 4020

gatatgcaag aaggggcaag aaaagatatc gagagagcct ttggtgtatt gcagcgaaga 4080

ttttgcatct taaaacgacc agctcgtcta tatgatcgag gtgtactgcg agatgttgtt 4140

ctagcttgca tcatacttca caatatgata gttgaagatg agaaggaaac cagaattatt 4200

gaagaagatt tagatctaaa tgtgcctcct agttcatcaa ccgttcagga acctgagttc 4260

tctcctgaac agaacacacc atttgataga gttttagaaa aagatatttc tatccgagat 5320

cgagcggctc ataaccgact taagaaagat ttggtggaac acatttggaa taagtttggt 4380

ggtgctgcac atagaactgg aaattgagaa tcagtaaatg taattatttt atttttcttg 4440

taatttatat atctatggtc cacttgtaaa tttctgaatg ctcatcgcca tattttttaa 4500

tctctgcagg ttccaatcta tttacaggtt ccctaaaaaa aaatctattt gcaggttcca 4560

gtctgttgtc ttcacaatgt aagttctgag aatcaaatca ctatgttttt ctcttttttg 4620

gtagctacag ggtgttagaa catgtgttat tttctttact atgcaattgt gatcctccaa 4680

tatttatcta ctgcatgtgt aaacctgttt gtcatgtctg aactactttc atttgtacag 4740

ggtgaaagaa tcaatgaaat ctatgggtgc atcgtcaatt tgcctccagt tacctgcttg 4800

tcatcgtcat ttgtagctta gttctgtcat atttcacctc gagttaacat ctattcagtt 4860

atctaaactt tgctatgtag tgaacttggt tgaatggtca tttaaattta tcaagtgaac 4920

aatcgtacct atctgtgctg aatgcatgta ttttgttttg tgttcaagtg gctacacacg 4980

tttgtgttac atacgatccc actatgtggc tggaattaaa tgccttgaat ttgcattgga 5040

aacgctagag tgaaacacag cattgagaag gtctgtttca ttgtacgttt caacttgttt 5100

catcttcgtt tcagctgatg tggcgtctgg gaaacagtgt aatgaaacac tgcattgtga 5160

atggcc 5166

<210>4

<211>455

<212>PRT

＜213〉paddy rice

<400>4

Met Ser Gly Asn Glu Asn Gln Ile Pro Val Ser Leu Leu Asp Glu Phe

1 5 10 15

Leu Ala Glu Asp Glu Ile Met Asp Glu Ile Met Asp Asp Val Leu His

20 25 30

Glu Met Met Val Leu Leu Gln Ser Ser Ile Gly Asp Leu Glu Arg Glu

35 40 45

Ala Ala Asp His Arg Leu His Pro Arg Lys His Ile Lys Arg Pro Arg

50 55 60

Glu Glu Ala His Gln Asn Leu Val Asn Asp Tyr Phe Ser Glu Asn Pro

65 70 75 80

Leu Tyr Pro Ser Asn Ile Phe Arg Arg Arg Phe Arg Met Tyr Arg Pro

85 90 95

Leu Phe Leu Arg Ile Val Asp Ala Leu Gly Gln Trp Ser Asp Tyr Phe

100 105 110

Thr Gln Arg Val Asp Ala Ala Gly Arg Gln Gly Leu Ser Pro Leu Gln

115 120 125

Lys Cys Thr Ala Ala Ile Arg Gln Leu Ala Thr Gly Ser Gly Ala Asp

130 135 140

Glu Leu Asp Glu Tyr Leu Lys Ile Gly Glu Thr Thr Ala Met Asp Ala

145 150 155 160

Met Lys Asn Phe Val Lys Gly Ile Arg Glu Val Phe Gly Glu Arg Tyr

165 170 175

Leu Arg Arg Pro Thr Val Glu Asp Thr Glu Arg Leu Leu Glu Leu Gly

180 185 190

Glu Arg Arg Gly Phe Pro Gly Met Phe Gly Ser Ile Asp Cys Met His

195 200 205

Trp Gln Trp Glu Arg Cys Pro Thr Ala Trp Lys Gly Gln Phe Thr Arg

210 215 220

Gly Asp Gln Lys Val Pro Thr Leu Ile Leu Glu Ala Val Ala Ser His

225 230 235 240

Asp Leu Trp Ile Trp His Ala Phe Phe Gly Val Ala Gly Ser Asn Asn

245 250 255

Asp Ile Asn Val Leu Ser Arg Ser Thr Val Phe Ile Asn Glu Leu Lys

260 265 270

Gly Gln Ala Pro Arg Val Gln Tyr Met Val Asn Gly Asn Gln Tyr Asn

275 280 285

Glu Gly Tyr Phe Leu Ala Asp Gly Ile Tyr Pro Glu Trp Lys Val Phe

290 295 300

Ala Lys Ser Tyr Arg Leu Pro Ile Thr Glu Lys Glu Lys Leu Tyr Ala

305 310 315 320

Gln His Gln Glu Gly Ala Arg Lys Asp Ile Glu Arg Ala Phe Gly Val

325 330 335

Leu Gln Arg Arg Phe Cys Ile Leu Lys Arg Pro Ala Arg Leu Tyr Asp

340 345 350

Arg Gly Val Leu Arg Asp Val Val Leu Gly Cys Ile Ile Leu His Asn

355 360 365

Met Ile Val Glu Asp Glu Lys Glu Ala Arg Leu Ile Glu Glu Asn Leu

370 375 380

Asp Leu Asn Glu Pro Ala Ser Ser Ser Thr Val Gln Ala Pro Glu Phe

385 390 395 400

Ser Pro Asp Gln His Val Pro Leu Glu Arg Ile Leu Glu Lys Asp Thr

405 410 415

Ser Met Arg Asp Arg Leu Ala His Arg Arg Leu Lys Asn Asp Leu Val

420 425 430

Glu His Ile Trp Asn Lys Phe Gly Gly Gly Ala His Ser Ser Gly Asn

435 440 445

Tyr Val Phe Ile Leu His Tyr

450 455 460

<210>5

<211>482

<212>PRT

＜213〉paddy rice

<400>5

Met Gln Ser Leu Ala Ile Ser Leu Leu Leu Ser Glu Thr His Ser Leu

1 5 10 15

Phe Ser His Thr Lys Thr Ser Ser Leu Leu Ser Leu Leu Phe Leu Ser

20 25 30

Ser Ser Lys Met Ser Glu Gln Asn Thr Asp Gly Ser Gln Val Pro Val

35 40 45

Asn Leu Leu Asp Glu Phe Leu Ala Glu Asp Glu Ile Ile Asp Asp Leu

50 55 60

Leu Thr Glu Ala Thr Val Val Val Gln Ser Thr Ile Glu Gly Leu Gln

65 70 75 80

Asn Glu Ala Ser Asp His Arg His His Pro Arg Lys His Ile Lys Arg

85 90 95

Pro Arg Glu Glu Ala His Gln Gln Leu Val Asn Asp Tyr Phe Ser Glu

100 105 110

Asn Pro Leu Tyr Pro Ser Lys Ile Phe Arg Arg Arg Phe Arg Met Ser

115 120 125

Arg Pro Leu Phe Leu Arg Ile Val Glu Ala Leu Gly Gln Trp Ser Val

130 135 140

Tyr Phe Thr Gln Arg Val Asp Ala Val Asn Arg Lys Gly Leu Ser Pro

145 150 155 160

Leu Gln Lys Cys Thr Ala Ala Ile Arg Gln Leu Ala Thr Gly Ser Gly

165 170 175

Ala Asp Glu Leu Asp Glu Tyr Leu Lys Ile Gly Glu Thr Thr Ala Met

180 185 190

Glu Ala Met Lys Asn Phe Val Lys Gly Leu Gln Asp Val Phe Gly Glu

195 200 205

Arg Tyr Leu Arg Arg Pro Thr Met Glu Asp Thr Glu Arg Leu Leu Gln

210 215 220

Leu Gly Glu Lys Arg Gly Phe Pro Gly Met Phe Gly Ser Ile Asp Cys

225 230 235 240

Met His Trp His Trp Glu Arg Cys Pro Val Ala Trp Lys Gly Gln Phe

245 250 255

Thr Arg Gly Asp Gln Lys Val Pro Thr Leu Ile Leu Glu Ala Val Ala

260 265 270

Ser His Asp Leu Trp Ile Trp His Ala Phe Phe Gly Ala Ala Gly Ser

275 280 285

Asn Asn Asp Ile Asn Val Leu Asn Gln Ser Thr Val Phe Ile Lys Glu

290 295 300

Leu Lys Gly Gln Ala Pro Arg Val Gln Tyr Met Val Asn Gly Asn Gln

305 310 315 320

Tyr Asn Thr Gly Tyr Phe Leu Ala Asp Gly Ile Tyr Pro Glu Trp Ala

325 330 335

Val Phe Val Lys Ser Ile Arg Leu Pro Asn Thr Glu Lys Glu Lys Leu

340 345 350

Tyr Ala Asp Met Gln Glu Gly Ala Arg Lys Asp Ile Glu Arg Ala Phe

355 360 365

Gly Val Leu Gln Arg Arg Phe Cys Ile Leu Lys Arg Pro Ala Arg Leu

370 375 380

Tyr Asp Arg Gly Val Leu Arg Asp Val Val Leu Ala Cys Ile Ile Leu

385 390 395 400

His Asn Met Ile Val Glu Asp Glu Lys Glu Thr Arg Ile Ile Glu Glu

405 410 415

Asp Leu Asp Leu Asn Val Pro Pro Ser Ser Ser Thr Val Gln Glu Pro

420 425 430

Glu Phe Ser Pro Glu Gln Asn Thr Pro Phe Asp Arg Val Leu Glu Lys

435 440 445

Asp Ile Ser Ile Arg Asp Arg Ala Ala His Asn Arg Leu Lys Lys Asp

450 455 460

Leu Val Glu His Ile Trp Asn Lys Phe Gly Gly Ala Ala His Arg Thr

465 470 475 480

Gly Asn

485

<210>6

<211>900

<212>DNA

＜213〉paddy rice

<400>6

tttcaagtac aatctcaact tagggaaagt tgtgattgag ggaggatgtt agataatgtt 60

agttagtttg ttatagagat agattagttc tgttaccgca tgtactttct tgtatctatc 120

tctatatcca ggattgtctc aggttgttga gattaatcct atcctttgta cacgccacgg 180

tagaggctct ttctgcctat atcaacaaag gtgcggcccc gtaaaggggt tcaacgcttc 240

tcattccgtt ttacaatcct ccttcttcct cctggtgttg gaaattcgtt gatcgagttg 300

aaactctcat ccttcatcat gtgctgcaga aactaacgcg tgcacagatg atggatgggt 360

gtggtgtgac atgaaagtgg atcaatgaca cgcggcacat ttaggggagt gtgtcgtgtc 420

ttgacttctt catgcaaaag tataccaacc ctgtataagg ccagtcacaa tggctagtgt 480

cattgcacgg ctacccaaaa tattatacca tcttctctca aatgaaatct tttatgaaac 540

aatccccaca gtggaggggt ttcactttga cgtttccaag actaagcaaa gcatttaatt 600

gatacaagtt gctgggatca tttgtaccca aaatccggcg cggcgcggga gaatgcggag 660

gtcgcacggc ggaggcggac gcaagagatc cggtgaatga aacgaatcgg cctcaacggg 720

ggtttcactc tgttaccgag gacttggaaa cgacgctgac gagtttcacc aggatgaaac 780

tctttccttc tctctcatcc ccatttcatg caaataatca ttttttattc agtcttaccc 840

ctattaaatg tgcatgacac accagtgaaa cccccattgt gactggccta agcatctttg 900

<210>7

<211>18

<212>DNA

＜213〉artificial sequence

<400>7

ttaggccagt cacaatgg 18

<210>8

<211>24

<212>DNA

＜213〉artificial sequence

<400>8

gtgcgtggtt ggtctcggct ttat 24

<210>9

<211>24

<212>DNA

＜213〉artificial sequence

<400>9

cctccttctt cctcctggtg ttgg 24

<210>10

<211>28

<212>DNA

＜213〉artificial sequence

<400>10

gtaagactga ataaaaaatg attatttg 28

<210>11

<211>26

<212>DNA

＜213〉artificial sequence

<400>11

catcttctct caaatgaaat ctttta 26

<210>12

<211>23

<212>DNA

＜213〉artificial sequence

<400>12

atgtagtttg tcggtaagtt tga 23

<210>13

<211>23

<212>DNA

＜213〉artificial sequence

<400>13

atgtgttgtg attgatggga taa 23

<210>14

<211>30

<212>DNA

＜213〉artificial sequence

<400>14

gggtgagtga agtgagtgag tgagcagcat 30

<210>15

<211>30

<212>DNA

＜213〉artificial sequence

<400>15

agttagggga ggagagttgg gcataggaat 30

<210>16

<211>23

<212>DNA

＜213〉artificial sequence

<400>16

gcctcctgct gcgacgtctt cat 23

<210>17

<211>30

<212>DNA

＜213〉artificial sequence

<400>17

caactggatg agcaagatta cagactaaaa 30

<210>18

<211>24

<212>DNA

＜213〉artificial sequence

<400>18

cagtacgcca ccaatcacca tcat 24

<210>19

<211>24

<212>DNA

＜213〉artificial sequence

<400>19

ctcatctcga acgcaaccta aata 24

<210>20

<211>25

<212>DNA

＜213〉artificial sequence

<400>20

tgtgatgaac agaacaccac cgaga 25

<210>21

<211>25

<212>DNA

＜213〉artificial sequence

<400>21

cccaaagata cagagcacct acaca 25

<210>22

<211>21

<212>DNA

＜213〉artificial sequence

<400>22

tgatccagat acaacctcca t 21

<210>23

<211>21

<212>DNA

＜213〉artificial sequence

<400>23

gaaaagaaaa acaaacaaga a 21

<210>24

<211>30

<212>DNA

＜213〉artificial sequence

<400>24

gggtgagtga agtgagtgag tgagcagcat 30

<210>25

<211>30

<212>DNA

＜213〉artificial sequence

<400>25

agttagggga ggagagttgg gcataggaat 30

<210>26

<211>21

<212>DNA

＜213〉artificial sequence

<400>26

cctcacaacc aatccctacc a 21

<210>27

<211>21

<212>DNA

＜213〉artificial sequence

<400>27

agccaccaca ataaccaaag t 21

1

Claims (13)

1. rice transposon gene, it is made up of a kind of nucleotide sequence, and this nucleotide sequence and SEQ ID NO:3 have at least 90% homology.

2. paddy rice transposase gene, it is made up of a kind of nucleotide sequence, and the 2959th～4407 bit base of this nucleotide sequence and SEQ ID NO:3 has at least 75% homology.

3. a kind of proteinic transposase gene of encoding, described protein comprise the aminoacid sequence of SEQ ID NO:5 or take place one or the aminoacid sequence of several amino acid whose disappearances, replacement or interpolation in this aminoacid sequences.

4. transposase, it comprises the aminoacid sequence of SEQ ID NO:5 or take place one or the aminoacid sequence of several amino acid whose disappearances, replacement or interpolation in this aminoacid sequence.

5. the plasmid that contains the transposon gene of claim 1.

6. the plasmid that contains the transposase gene of a kind of promotor and claim 2 or 3.

7. make the method for rice transposon gene generation swivel base, comprise the transformant that has imported the described transposon gene of claim 1 carried out anther culture or handled with chemical reagent that described rice transposon gene comprises the nucleotide sequence that has at least 95% homology with SEQ ID NO:1.

8. the method for claim 7, host wherein is a plant.

9. the method for claim 8, wherein said plant is paddy rice, barley, wheat or corn.

10. make the method for rice transposon gene generation swivel base, comprise the transformant that has imported a kind of promotor and claim 2 or 3 described transposase genes carried out anther culture or handled with chemical reagent that described rice transposon gene comprises the nucleotide sequence that has at least 95% homology with SEQ ID NO:1.

11. the method for claim 10, host wherein is a plant.

12. the method for claim 11, wherein said plant are paddy rice, barley, wheat or corn.

13. each method in the claim 7 to 12, wherein said chemical reagent are U-18496 or 5-azadeoxycytidine.

Images