CN117164674A - Antifreeze protein, gene, yeast engineering bacteria and application thereof - Google Patents
Antifreeze protein, gene, yeast engineering bacteria and application thereof Download PDFInfo
- Publication number
- CN117164674A CN117164674A CN202311377226.9A CN202311377226A CN117164674A CN 117164674 A CN117164674 A CN 117164674A CN 202311377226 A CN202311377226 A CN 202311377226A CN 117164674 A CN117164674 A CN 117164674A
- Authority
- CN
- China
- Prior art keywords
- antifreeze protein
- protein
- gene
- hhafp
- yeast
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108010053481 Antifreeze Proteins Proteins 0.000 title claims abstract description 73
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 59
- 241000894006 Bacteria Species 0.000 title claims abstract description 21
- 240000004808 Saccharomyces cerevisiae Species 0.000 title claims description 53
- 239000013604 expression vector Substances 0.000 claims abstract description 33
- 238000003259 recombinant expression Methods 0.000 claims abstract description 27
- 239000012634 fragment Substances 0.000 claims abstract description 12
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 claims description 60
- 210000004027 cell Anatomy 0.000 claims description 58
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 17
- 238000005138 cryopreservation Methods 0.000 claims description 11
- 238000000034 method Methods 0.000 claims description 10
- 230000007030 peptide scission Effects 0.000 claims description 10
- 150000001413 amino acids Chemical class 0.000 claims description 8
- 238000012258 culturing Methods 0.000 claims description 7
- 238000000855 fermentation Methods 0.000 claims description 7
- 230000004151 fermentation Effects 0.000 claims description 7
- 239000002773 nucleotide Substances 0.000 claims description 7
- 125000003729 nucleotide group Chemical group 0.000 claims description 7
- 235000013611 frozen food Nutrition 0.000 claims description 6
- 239000001963 growth medium Substances 0.000 claims description 6
- 230000028327 secretion Effects 0.000 claims description 6
- 239000003755 preservative agent Substances 0.000 claims description 5
- 230000002335 preservative effect Effects 0.000 claims description 5
- 210000004899 c-terminal region Anatomy 0.000 claims description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 238000002360 preparation method Methods 0.000 claims 1
- 230000000694 effects Effects 0.000 abstract description 13
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 abstract description 11
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 abstract description 11
- 238000007710 freezing Methods 0.000 abstract description 9
- 230000008014 freezing Effects 0.000 abstract description 8
- 238000003776 cleavage reaction Methods 0.000 abstract description 7
- 230000007017 scission Effects 0.000 abstract description 7
- 238000012216 screening Methods 0.000 abstract description 7
- 238000010276 construction Methods 0.000 abstract description 5
- 230000004083 survival effect Effects 0.000 abstract description 5
- 241000235342 Saccharomycetes Species 0.000 abstract description 4
- 230000003321 amplification Effects 0.000 abstract description 4
- 238000003199 nucleic acid amplification method Methods 0.000 abstract description 4
- 238000013459 approach Methods 0.000 abstract description 2
- 230000005779 cell damage Effects 0.000 abstract description 2
- 208000037887 cell injury Diseases 0.000 abstract description 2
- 102000004169 proteins and genes Human genes 0.000 description 41
- PRDFBSVERLRRMY-UHFFFAOYSA-N 2'-(4-ethoxyphenyl)-5-(4-methylpiperazin-1-yl)-2,5'-bibenzimidazole Chemical compound C1=CC(OCC)=CC=C1C1=NC2=CC=C(C=3NC4=CC(=CC=C4N=3)N3CCN(C)CC3)C=C2N1 PRDFBSVERLRRMY-UHFFFAOYSA-N 0.000 description 17
- 239000006228 supernatant Substances 0.000 description 17
- 239000000243 solution Substances 0.000 description 15
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 14
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 13
- 239000007788 liquid Substances 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 9
- 241000235058 Komagataella pastoris Species 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- 239000013598 vector Substances 0.000 description 8
- 102100036826 Aldehyde oxidase Human genes 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- 101000928314 Homo sapiens Aldehyde oxidase Proteins 0.000 description 7
- 230000003833 cell viability Effects 0.000 description 7
- 229940088598 enzyme Drugs 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 238000010186 staining Methods 0.000 description 7
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 241000251468 Actinopterygii Species 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 108010084455 Zeocin Proteins 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 239000012228 culture supernatant Substances 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 5
- 239000011550 stock solution Substances 0.000 description 5
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 4
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 4
- 239000002033 PVDF binder Substances 0.000 description 4
- 108010087230 Sincalide Proteins 0.000 description 4
- 230000002528 anti-freeze Effects 0.000 description 4
- 238000010609 cell counting kit-8 assay Methods 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000013078 crystal Substances 0.000 description 4
- 238000005520 cutting process Methods 0.000 description 4
- 238000001976 enzyme digestion Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 238000000137 annealing Methods 0.000 description 3
- 239000007469 bmm - medium Substances 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 239000012535 impurity Substances 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000000074 matrix-assisted laser desorption--ionisation tandem time-of-flight detection Methods 0.000 description 3
- 230000001338 necrotic effect Effects 0.000 description 3
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000012264 purified product Substances 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 235000020183 skimmed milk Nutrition 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108010041952 Calmodulin Proteins 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- 102000012410 DNA Ligases Human genes 0.000 description 2
- 108010061982 DNA Ligases Proteins 0.000 description 2
- 108010019160 Pancreatin Proteins 0.000 description 2
- 239000006180 TBST buffer Substances 0.000 description 2
- 230000001640 apoptogenic effect Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 238000009395 breeding Methods 0.000 description 2
- 230000001488 breeding effect Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 238000004043 dyeing Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 229940055695 pancreatin Drugs 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 1
- 108010089921 CTCGAG-specific type II deoxyribonucleases Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101800005151 Cholecystokinin-8 Proteins 0.000 description 1
- 102400000888 Cholecystokinin-8 Human genes 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 101710089350 Eggshell protein Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 241001052560 Thallis Species 0.000 description 1
- 241000255901 Tortricidae Species 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000004115 adherent culture Methods 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000002577 cryoprotective agent Substances 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000012137 double-staining Methods 0.000 description 1
- 230000000459 effect on growth Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000000556 factor analysis Methods 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000009920 food preservation Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000012246 gene addition Methods 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000012128 staining reagent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000001550 time effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 239000007222 ypd medium Substances 0.000 description 1
Landscapes
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention belongs to the technical field of biology, and discloses an antifreeze protein and a gene sequence thereof. And discloses engineering bacteria for expressing antifreeze protein and a construction method thereof. The antifreeze protein gene containing SEQ ID No.1 sequence is used as template for amplification to obtain 5' endHas the following componentsXhoI. Having 3' end withXbaI cleavage site and target fragment of 6 XHis tag; connecting the target fragment to an expression vector to construct a recombinant expression vector; and linearizing the recombinant expression vector, transferring the recombinant expression vector into host saccharomycetes, and screening positive transformants to obtain recombinant saccharomycetes. The obtained recombinant protein HhAFP can remarkably improve the survival rate of resuscitated cells after freezing and preserving and reduce cell damage. The invention can obtain the antifreeze protein with high activity and high yield, and provides a technical approach for the application and industrialization of the antifreeze protein.
Description
Technical Field
The invention belongs to the technical field of biology, and particularly relates to an antifreeze protein, engineering bacteria expressing the antifreeze protein, and a construction method and application thereof.
Background
In order to reduce the damage, glycerol, ethylene glycol, propylene glycol, acetamide, methanol, dimethyl sulfoxide (DMSO) and the like are usually added into cell cryopreservation liquid, and the permeable cryoprotectant can obviously relax cell membranes, so that the cells are more easily adapted to the pressure in the low-temperature preservation process. But it is toxic to cells due to its permeability and is detrimental to cell membrane proteins.
Antifreeze proteins were first found in the blood of antarctic fish, which were subsequently found in various organisms living in polar regions, such as fish, insects, plants, bacteria, fungi, and the like. The antifreeze protein is a special macromolecular protein, and can specifically lower the freezing point of the solution without affecting the melting point, so that the difference between the freezing point and the melting point is called thermal hysteresis activity, thereby preventing ice nucleus formation, controlling ice crystal growth, maintaining the liquid state of body fluid and improving the antifreeze capability of organisms to a certain extent.
The south pole ocean, which is covered by ice and snow for a long time, is the most severe living environment in the world, but still living beings adapt to the environment by producing antifreeze proteins in the body. The anti-freeze proteins found and verified to be active in antarctic fish are the eggshell protein ZPC5, the antifreeze protein LD4 and the calmodulin gene, wherein ZPC5 expressed and purified in vitro has the effect of inhibiting ice crystal growth in vitro, and LD4 protein and calmodulin gene have the effect of improving their low temperature resistance after being overexpressed in tobacco.
Except for antarctic fish, the Yunshan leaf roller is found in insectsChoristoneurafumiferana) An antifreeze protein (CfAFP) which is expressed in an E.coli expression system, and the obtained recombinant protein has the effect of obviously inhibiting the growth of ice crystals. In addition, a high-activity antifreeze protein also exists in the insect fleas living in the south poles, and researchers find that the antifreeze activity of the antifreeze protein at millimole concentration is 10-100 times of that of fish antifreeze protein. The research shows that the antifreeze protein has certain cold resistance or antifreeze effect both in vivo and in vitro, and the effect can be widely applied to the aspects of transgenic cold-resistant crop breeding, food freezing transportation, cell freezing preservation and the like.
Disclosure of Invention
The invention aims to provide an antifreeze protein (HhAFP) and a coding gene and application thereof.
The invention also provides an expression system of the antifreeze protein, yeast engineering bacteria and a method for efficiently expressing the antifreeze protein.
The technical scheme of the invention is as follows:
an antifreeze protein (HhAFP) comprising the amino acid sequence shown in SEQ ID No.1.
SEQ ID No.1:
MRVAEVAKVLWVGVCAVAAVTLVVGVQEVVKVVWVVWVWGVQAVVLVVAVVATVVVCFLVVHVVRVVTVCGRVAEVAGVAG。
Preferably, the amino acid sequence of the antifreeze protein is shown as SEQ ID No.1.
In one embodiment of the invention, the C-terminal of the antifreeze protein is further His-tagged.
The N end of the antifreeze protein is also provided with 1 or 2 signal peptide cleavage site amino acids. The amino acid of the signal peptide cleavage site is KR or R.
An antifreeze protein gene which codes for the antifreeze protein.
Preferably, the antifreeze protein gene contains a nucleotide sequence shown as SEQ ID No. 2.
More preferably, the nucleotide sequence of the antifreeze protein gene is shown as SEQ ID No. 2; alternatively, it carries a nucleotide sequence encoding a His tag at its 3' end.
Alternatively, it carries a sequence encoding 1 or 2 signal peptide cleavage site amino acids at its 5' end. Preferably Kex 2 signal peptide cleavage sites; the amino acid of the signal peptide cleavage site is KR or R.
SEQ ID No.2:
atgcgtgttgcagaagtggcaaaagtgctgtgggtgggtgtgtgtgcagtagcagcagtgaccctggtggtgggggtgcaggaggtggtgaaggtggtgtgggtcgtctgggtttggggagttcaggcagttgttcttgttgttgccgtggtggccaccgtggttgtctgctttctggttgttcatgttgttcgtgtcgtgacagtttgtggccgcgtggctgaagttgcaggtgttgccggt。
The antifreeze protein or antifreeze protein gene can be used for cell cryopreservation or frozen food preservation, and can be used for preparing cell cryopreservation liquid, frozen preservative or frozen food. The antifreeze protein gene can also be used for breeding transgenic cold-resistant plants and cultivating the cold-resistant plants.
A recombinant expression vector contains a gene for expressing the antifreeze protein.
Preferably, the recombinant expression vector contains a gene expressing a secretion signal peptide. In a preferred embodiment of the present invention, the recombinant expression vector is a pPICZ alpha A plasmid.
In a preferred embodiment of the present invention, the recombinant expression vector contains a nucleotide sequence capable of expressing the protein shown in SEQ ID No. 6.
SEQ ID No.6:
Wherein the method comprises the steps ofDouble underlineTo exocrine the signal peptide alpha-factor (1-83),wave lineFor Kex 2 signalsPeptide cleavage sites (84-85),single underlineIs an antifreeze protein (HhAFP) sequence (86-166),dashed underlineRepresenting a His tag sequence.
In a preferred embodiment of the present invention, the recombinant expression vector contains the sequence of SEQ ID No. 5.
SEQ ID No. 5:
atgagatttccttcaatttttactgctgttttattcgcagcatcctccgcattagctgctccagtcaacactacaacagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcgatgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattgctgctaaagaagaaggggtatctctcgagaaaagaatgcgtgttgcagaagtggcaaaagtgctgtgggtgggtgtgtgtgcagtagcagcagtgaccctggtggtgggggtgcaggaggtggtgaaggtggtgtgggtcgtctgggtttggggagttcaggcagttgttcttgttgttgccgtggtggccaccgtggttgtctgctttctggttgttcatgttgttcgtgtcgtgacagtttgtggccgcgtggctgaagttgcaggtgttgccggtcatcatcatcatcatcattgatag。
A yeast engineering strain expressing antifreeze protein contains the nucleotide sequence of said antifreeze protein HhAFP.
Preferably, the yeast engineering bacteria, the yeast gene also contains a gene fragment encoding a secretion signal peptide Kex 2 and a signal peptide cleavage site.
The host bacteria of the yeast engineering bacteria are pichia pastoris, preferably pichia pastoris X-33.
The method for constructing the yeast engineering bacteria comprises the following steps:
(1) Amplifying the antifreeze protein gene as a template to obtain a protein with 5' endXhoI,3' end hasXbaI enzyme cutting site and target fragment of 6 XHis tag coding gene;
(2) The target fragment is connected to an expression vector to construct a recombinant expression vector;
(3) And (3) linearizing the recombinant expression vector, transferring the linearized recombinant expression vector into host saccharomycetes, and screening positive transformants to obtain recombinant saccharomycetes.
In the step (1), the amino acid sequence gene shown in the SEQ No.1 is used as a template for amplification. Preferably, in step (1), the amplification is performed using the primers shown in SEQ ID No.3 and SEQ ID No. 4.
SEQ ID No.3 (HhAFP-F): ctcgagaaaagaatgcgtgttgcagaagtg
SEQ ID No.4(HhAFP-R):tctagactatcaatgatgatgatgatgatgaccggcaacacctgcaacttc
The target fragment obtained by amplification has the length of 285bp and is provided with XhoI, xbaI restriction enzyme sites and a 6 XHis tag.
The expression vector in the step (2) is pPICZ alpha A plasmid. Addition of HhAFP Gene at 5' endXhoI cleavage site, adding at 3' endXbaI cleavage site and 6 XHis tag. By usingXhoI、XbaThe enzyme I carries out double enzyme digestion and connection on the target fragment and pPICZ alpha A plasmid to construct a recombinant expression vector pPICZ alpha A-HhAFP。
In step (3), usingSacThe enzyme I linearizes the recombinant expression vector and inserts it into the yeast DNA genome.
In the step (3), competent yeast host is mixed with the linearized recombinant expression vector and subjected to electric excitation treatment. Specifically, electric shock is performed after ice bath; electric shock parameters: the voltage is 1000-1500V, the capacitance is 20-30 mu F, and the resistance is 150-250 omega. Preferably, the voltage is 12000V, the capacitance is 25 muF, and the resistance is 200Ω. Sorbitol solution was added after the shock.
In step (3), positive transformants were screened with bleomycin Zeocin and methanol.
In a preferred embodiment of the invention, the sequence of SEQ ID No.5 is inserted into a yeast host.
The yeast engineering bacteria or the fermentation product thereof can be used for preparing antifreeze protein.
A method of preparing an antifreeze protein comprising the steps of: fermenting the yeast engineering bacteria in BMM culture medium containing methanol, and culturing at 27-29 deg.C for 68-75 hr.
Further, the yeast engineering bacteria are fermented in BMM culture medium containing 1.4-1.6% of methanol in volume concentration, and are cultured for 68-75h at 27-29 ℃, and methanol is added into the culture medium according to the volume ratio of 1.4-1.6% every 18-30 h. Culturing at 200-500rpm and pH=5.5-6.5.
In a preferred embodiment of the present invention, the culture is performed in BMM medium containing 1.5% (v/v) methanol at 28-29℃for 72 hours, and methanol is added to the medium every 24 hours at a volume ratio of 1.5%; and, culturing under conditions of 240-300rpm and ph=6.0.
The antifreeze protein or the fermentation product of the yeast engineering bacteria can be used for preparing cell cryopreservation liquid, frozen preservative or frozen food.
The fermentation supernatant after fermentation of the yeast engineering bacteria can be directly used for preparing cell cryopreservation liquid, frozen preservative or frozen food, or preparing cell cryopreservation liquid, frozen preservative or frozen food after purifying to obtain antifreeze protein.
The invention has the beneficial effects that a new antifreeze protein is obtained by artificially synthesizing an antifreeze protein gene sequence and expressing the antifreeze protein gene sequence. The protein can obviously improve survival rate of resuscitated cells after freezing and preserving, and reduce cell damage.
And (3) transferring the antifreeze protein gene into yeast by constructing an antifreeze protein recombinant expression vector. The strain can express recombinant antifreeze protein with high activity. The obtained recombinant protein is added into the cell cryopreservation liquid instead of DMSO, and the survival rate of the cryopreserved cells after resuscitating is detected, so that the resuscitating survival rate of the cryopreserved cells added with the recombinant protein HhAFP is higher than that of the conventional cryopreserved cells added with DMSO.
And the yield of the recombinant antifreeze protein is greatly improved by optimizing the expression condition, so that the content of the recombinant antifreeze protein in the fermentation broth of the yeast engineering bacteria reaches 527mg/L. And the recombinant antifreeze protein has high proportion and less impurity protein and other impurities.
The invention can obtain the antifreeze protein with high activity and high yield, and provides a good foundation for the application of the antifreeze protein in various aspects; the invention expresses the active antifreeze protein with high yield by pichia pastoris, and provides a technical approach for realizing industrialization of the antifreeze protein.
Drawings
FIG. 1 shows the recombinant expression vector pPICZ alpha A-HhAFPThe construction (A), the PCR (B) and the double enzyme digestion (C) are identified, wherein M: DNA molecular weight standard; 1: a PCR product; 2: empty carrierDouble enzyme cutting products; 3: recombinant expression vector double enzyme cutting products;
FIG. 2 shows the results of PCR identification of yeast DNA, wherein M:2000bpDNA molecular weight standard; 1-2: yeast DNA;
FIG. 3 is a SDS-PAGE analysis of yeast supernatants wherein M:180kDa protein molecular weight standard; 1: supernatant of culture of pPICZ alpha A-containing transformant; 2: containing pPICZ alpha A-HhAFPSupernatant of transformant culture;
FIG. 4 shows the result of Western blot analysis of yeast supernatants, wherein M: a 45kDa ultra-low protein molecular weight standard; 1-2: supernatant of culture of pPICZ alpha A-containing transformant; 3-4: containing pPICZ alpha A-HhAFPSupernatant of transformant culture;
FIG. 5 shows the result of SDS-PAGE analysis of purified proteins, wherein M: a 45kDa ultra-low protein molecular weight standard; and (3) FT: loading a flowing liquid; W1-W2: washing 1-2; E1-E6: eluting 1-6;
FIG. 6 shows the result of Western blot analysis of purified proteins, wherein M: a 45kDa ultra-low protein molecular weight standard; 1: purifying the protein HhAFP;
FIG. 7 shows 293T cell live cell statistics (5 replicates per data set);
FIG. 8 shows the morphology under 293T cell inverted fluorescence microscopy (A-C: hoechst33342, PI, hoechst33342/PI staining results of cells frozen with DMEM-containing culture solution; D-F: hoechst33342, PI, hoechst33342/PI staining results of cells frozen with pPICZ αA-containing yeast culture; G-I: hoechst33342, PI, hoechst33342/PI staining results of cells frozen with HhAFP-containing yeast culture; bars=100 um);
FIG. 9 is SDS-PAGE analysis of methanol concentration effect on growth of yeast transformants (A) and culture supernatants thereof (B), wherein M: a 45kDa ultra-low protein molecular weight standard;
FIG. 10 is SDS-PAGE analysis of induction time effect on yeast transformant growth (A) and culture supernatant thereof (B), wherein M: a 45kDa ultra-low protein molecular weight standard;
FIG. 11 is SDS-PAGE analysis of the effect of induction temperature on growth of yeast transformants (A) and culture supernatants thereof (B) wherein M:45kDa ultra low protein molecular weight standard.
Detailed Description
Principal materials and reagents
243bp ofHhAFPThe sequence is composed of Optimus synthesizing by a limited company; PCR primers were synthesized by Shanghai Bioengineering Co.
pMD19-T cloning vector and restriction endonucleaseXhoI、XbaI、SacI) DNA polymerase, DNA ligase, DNA molecular weight standards (markers) were purchased from TaKaRa. Trans1-T1 competent cells were purchased from Beijing full gold Biotechnology Co. DNA plasmid miniprep kit, DNA agarose gel recovery kit, yeast genome extraction kit were purchased from Yu Tiangen Biochemical technologies (Beijing) Co. His tag protein purification kit and enhanced CCK-8 reagent were purchased from Shanghai Biyun biotechnology Co. The pPICZ alpha A expression vector and the X-33 yeast expression strain were purchased from Yu Fenghui organisms. Bleomycin was purchased from Invitrogen. Rainbow pre-dye low molecular weight protein markers were purchased from Zhongke Ruitai Biotech Co. anti-His tag murine monoclonal antibodies were purchased from kang century biotechnology limited. DMEM high sugar medium, penicillin-streptomycin solution, DPBS buffer were purchased from Hyclone company. 0.25% pancreatin, foetal calf serum was purchased from Gibco company and DMSO was purchased from Thermo Fisher company. Hoechst33342/PI apoptosis staining kit and amino acid-free yeast nitrogen source are purchased from Beijing Soy Bao technology Co.
EXAMPLE 1 HhAFP target Gene cloning and addition of restriction enzyme sites and his tag
243bp antifreeze proteinHhAFPThe gene sequence (SEQ ID No. 2) was synthesized by the Optimus of Praeparata. Using the synthesized HhAFP sequence as a template, the addition was usedXhoI、XbaThe I cleavage site and the 6 XHis-tagged primers HhAFP-F and HhAFP-R (i.e., SEQ ID No.3, 4, see Table 1) amplify the band of interest.
TABLE 1 primer design
Primer name | Primer sequence (5 '-3') | Product Length/bp |
HhAFP-F | ctcgagaaaagaatgcgtgttgcagaagtg | 30 |
HhAFP-R | tctagactatcaatgatgatgatgatgatgaccggcaacacctgcaacttc | 51 |
SEQ ID No.2:
atgcgtgttgcagaagtggcaaaagtgctgtgggtgggtgtgtgtgcagtagcagcagtgaccctggtggtgggggtgcaggaggtggtgaaggtggtgtgggtcgtctgggtttggggagttcaggcagttgttcttgttgttgccgtggtggccaccgtggttgtctgctttctggttgttcatgttgttcgtgtcgtgacagtttgtggccgcgtggctgaagttgcaggtgttgccggt。
The PCR reaction system is as follows: ddH 2 O80. Mu.L, syntheticHhAFPSequence 4. Mu.L as template, hhAFP-F (10. Mu. Mol/L) 8. Mu.L, hhAFP-R (10. Mu. Mol/L) 8. Mu.L, R-TaqDNA polymerase (0.05U/. Mu.L) 100. Mu.L, 200. Mu.L total. The PCR reaction program was set as follows: 94. pre-denatured at 3min at 94℃for 30s, annealed at 57℃for 30s, extended at 72℃for 1min, and after 34 cycles, final extension at 72℃for 10min. The PCR amplified product was purified, and the purified fragment was ligated to pMD19-T vector using DNA ligase to form pMD19-HhAFP plasmid, followed by transformation of E.coli competent cells.
And selecting positive monoclonal to carry out bacterial liquid PCR. The PCR reaction system is as follows: ddH 2 O5.8. Mu.L, bacterial solution 0.5. Mu.L, upstream and downstream primers (10. Mu. Mol/L) 0.6. Mu.L each, r-TaqDNA polymerase (0.05U/. Mu.L) 7.5. Mu.L, total 15. Mu.L, annealing temperature 55℃and PCR procedure. SubsequentlyThe bacterial liquid was sent to Shanghai bioengineering Co.Ltd for sequencing.
As a result of the sequencing, the size of the target band HhAFP was 285bp, and the target band HhAFP was provided with XhoI, xbaI cleavage sites and a 6 XHis tag.
EXAMPLE 2 recombinant expression vector pPICZ alpha A-HhAFPTransformation screen of the X-33 Strain
2.1 recombinant expression vector pPICZ alpha A-HhAFPConstruction of (3)
In example 1, hhAFP-F and HhAFP-R primers (SEQ ID Nos. 3, 4) were used for synthesisHhAFPAmplifying the sequence as a template, and addingXhoI、XbaI restriction enzyme site and 6 XHis tag to obtain a 273bp target band HhAFP. Connecting the target fragment HhAFP with a pichia pastoris expression vector pPICZ alpha A to construct a recombinant expression vector pPICZ alpha A-HhAFP(A in FIG. 1).
By restriction enzymesXhoI andXbai pair post-construction pMD19-T-HhAFPThe vector and empty vector ppiczαa were double digested. After enzyme digestion, the target fragment HhAFP is connected and transformed with the pichia pastoris expression vector fragment pPICZ alpha A to construct a recombinant expression vector pPICZ alpha A-HhAFP(A in FIG. 1).
The target gene is added with a 6 XHis tag, so that the detection and purification of the subsequent protein are facilitated. The 5' AOX1 promoter exists upstream of the pPICZ alpha A vector, and alpha-factor is a secretion signal peptide to carry out secretion and transportation of the expressed protein to the outside of cells. Upstream of the 5' AOX1 promoterSacI enzyme cutting site, can linearize the circular plasmid, facilitate insertion into yeast DNA genome. The recombinant expression vector has the gene for resisting Zeocin, and bleomycin Zeocin can be used for screening positive yeast transformants in subsequent experiments.
In the presence of pPICZαA-HhAFPSingle colonies were picked on E.coli screening plates and subjected to colony PCR. The selected colonies were PCR-amplified using the universal primers 5'AOX1 and 3' AOX1 of the pPICZ alpha A vector to give a 781bp band of interest. As shown in FIG. 1B, lane 1 has a distinct band around 781 bp. For recombinant expression vector pPICZalpha A-HhAFPProceeding withXhoI、XbaI double cleavage, obtaining a 273bp band (C in FIG. 1) with a size that matches the theoretical valueAnd (5) combining. Sequencing results confirmed pPICZ alpha A-HhAFPThe recombinant expression vector was constructed successfully.
Selecting positive monoclonal to carry out double enzyme digestion and bacterial liquid PCR detection, wherein a PCR reaction system and a PCR reaction program are the same (annealing temperature is 55 ℃), and then using linearized enzymeSacI recombinant expression vector pPICZαA-HhAFPAnd (5) linearizing. The PCR detection result shows that the primer contains the following sequence shown as SEQ ID No. 5:
double underlineRepresenting secretion signal peptide alpha-factor sequences (1-249),wave lineRepresents Kex 2 signal peptide cleavage sites (250-255),single underlineRepresents an antifreeze protein (HhAFP) sequence (256-498),dashed underlineRepresenting His tag sequences (499-516),dot underscoreRepresenting a strong termination signal (517-522).
The protein expressed by the sequence is shown in SEQ ID No. 6:
wherein the method comprises the steps ofDouble underlineTo exocrine the signal peptide alpha-factor (1-83),wave lineIs Kex 2 signal peptide cleavage site (84-85),single underlineIs an antifreeze protein (HhAFP) sequence (86-166),dashed underlineRepresenting His tag sequences (167-172).
Screening of high-copy positive yeast transformant and recombinant protein induced expression
Recombinant expression vector pPICZαA-HhAFPAnd the empty vector pPICZ alpha A is electrically transformed into Pichia pastoris X-33 strain, and 2 HhAFP transformants and 1 pPICZ alpha A transformant are obtained after screening by Zeocin and methanol utilization rate.
The method comprises the following steps: yeast competent cells and linearized pPICZαA-HhAFPMixing at 8:1 (V: V, competent cells 80. Mu.L, linearized plasmid 10. Mu.L, concentration 12.5 ng/. Mu.L), transferring into a 20mm electric beaker, and shocking (parameters: voltage 2000V after 5min in ice bath,capacitance 25. Mu.F, resistance 200. OMEGA.). After the electric shock, 1mL of 1M sorbitol solution was added to the horse, transferred to a pre-chilled 50mL centrifuge tube, and left to stand in an incubator at 29℃for 2h, followed by the addition of 1mL YPD medium, at 29℃and 200rpm/min for 2h. The supernatant was centrifuged off, and yeast cells were collected and plated on YPDS plates containing 100. Mu.g/mL Zeocin and incubated in an incubator at 29℃until monoclonal production. And (3) selecting monoclonal and sequentially inoculating the monoclonal to MM and MD plates, comparing the growth conditions of yeasts on the MM and MD plates, and screening high-copy yeast transformants using methanol rapidly.
The yeast DNA extraction kit is used for extracting the yeast genome DNA as a template, and the 5'AOX1 and 3' AOX1 of the universal primers of the pPICZ alpha A carrier are used as primers for carrying out PCR detection on the yeast DNA, wherein the PCR reaction system and the PCR reaction program are the same as those described above (the annealing temperature is 55 ℃). In addition, the empty vector ppiczαa was electrotransformed into pichia pastoris as a negative control.
The PCR detection results are shown in FIG. 2, which shows that the HhAFP transformant has two distinct bands around 2000bp and 781 bp. Because of the existence of the primer binding site of AOX1 in the Pichia pastoris X-33 strain, a band of about 2000bp is amplified, and the 781bp is a target band containing HhAFP (FIG. 2).
Empty vector of pPICZαA and pPICZαA-HhAFPExpression was induced in BMM medium, and after obtaining yeast supernatant, the supernatant was filtered and concentrated, and SDS-PAGE analysis was performed, and the results are shown in FIG. 3. The supernatant of the culture of strain 2 had a distinct band around 15 kDa, whereas the supernatant of the culture of strain 1 (control pPICZαA) had no band.
Western blot analysis further verifies that the results, as shown in FIG. 4, lanes 1 and 2 (control pPICZ. Alpha.A) have no band, lanes 3 and 4 have a distinct band around 16 kDa, and it is presumed that the band is a recombinant antifreeze protein HhAFP with a 6 XHis tag.
EXAMPLE 3 Western blot and MALDI-TOF/TOF analysis of recombinant protein-induced expression and purification products
Positive yeast transformants were selected and cultured to OD at 29℃in 25. Mu.L BMG medium at 250rpm/min and pH 6.0 600 1.5. The culture solution is centrifuged to collect the thalli, and inoculated into 100mL BMM for cultureIn the medium, the culture was carried out at 29℃and 250rpm/min at pH 6.0 for 72 hours, and 1mL of methanol was added every 24 hours to give a volume concentration of 1%. The culture product was collected by centrifugation and the supernatant was filtered through a 0.22 μm filter. The supernatant was then purified using His-tag protein purification kit: placing PVDF membrane in an antibody incubation box, adding a sealing solution (5% skimmed milk powder), placing the PVDF membrane in a shaking table, incubating for 2.5 hours at room temperature, adding a primary antibody (3% skimmed milk powder is used for diluting the anti-His tag mouse monoclonal antibody, the dilution ratio is 1:2500), standing overnight at 4 ℃, placing the PVDF membrane in the shaking table at room temperature, incubating for 1 h, and washing the membrane 3 times with TBST buffer solution for 5 minutes each time. Secondary antibody (3% skimmed milk powder diluted horseradish peroxidase labeled goat anti-mouse IgG, dilution ratio 1:2500) was added, and after incubation for 1.5h at room temperature, the membrane was washed 3 times with TBST buffer. Development was performed using BeyoECL Moon developer.
After SDS-PAGE analysis of the purified product, protein bands on the gel were transferred to PVDF membrane for Western blot analysis. The results are shown in FIGS. 5 and 6, respectively, with a distinct protein band around 16 kDa and no other bands. Meanwhile, the Western blot analysis result proves that the protein contains the target protein HhAFP with a 6 XHis tag. This purified product was thus confirmed to be the target protein HhAFP.
The purified product was subjected to MALDI-TOF/TOF analysis: development was performed using BeyoECL Moon developer. The protein bands on SDS-PAGE gel were sent to Shanghai, miao, new Biotechnology Co., ltd for MALDI-TOF/TOF analysis. The results showed that the sequence was identical to the theoretical sequence, SEQ ID No.1 with His tag at the C-terminal.
SEQ ID No.1:
MRVAEVAKVLWVGVCAVAAVTLVVGVQEVVKVVWVVWVWGVQAVVLVVAVVATVVVCFLVVHVVRVVTVCGRVAEVAGVAG。
EXAMPLE 4 detection of the anti-freezing effect of recombinant proteins in cell cryopreservation
293T cells were taken at 37℃with 5% CO 2 After the incubator was cultured until the degree of fusion became 90%, the medium was discarded, and the cells were washed with DPBS. Cells were digested with 0.25% pancreatin, counted and grouped, 3 tubes were repeated for each group, and 5×10 frozen for each tube 5 The cells were then added to 1mL of the prepared frozen stock solution.
The cell grouping is as follows: (1) control group: the frozen stock solution consists of 90% DMEM culture solution and 10% DMSO; (2) negative control group: the frozen stock solution consists of 90% of yeast culture supernatant of pPICZ alpha A and 10% of DMSO; (3) HhAFP group: the frozen stock solution consisted of the concentrated HhAFP yeast culture supernatant containing 3mg/mL (about 0.2 mM) of HhAFP.
The cells were placed in a cryopreservation box and stored frozen at-80℃for 24h. After taking out the freezing box, the freezing tube is quickly thawed at 37 ℃. After removing the frozen solution by centrifugation, the 293T cells are resuscitated and subjected to adherent culture for 4 hours: adding 1mL of culture solution, uniformly mixing, adding 100 mu L of culture solution into a 96-well plate, and repeating 3 holes; 37. culturing at the temperature of 4 hours.
Cell viability was detected by CCK-8 reagent: adding CCK-8 reagent, culturing at 37deg.C for 2 hr, and detecting the absorption light OD at 450nm wavelength by enzyme labeling instrument 450 . Then by the formula: hhAFP group cell viability (%) = [ a (HhAFP) -a (Blank)]/[A(DMEM)-A(Blank)]x100 calculation of cell viability with HhAFP added; cell viability (%) = [ a (ppiczαa) -a (Blank) of ppiczαa group]/[A(DMEM)-A(Blank)]x100 calculation of cell viability with addition of ppiczαa product; DMEM group cell viability (%) = [ a (DMEM) -a (Blank)]/[A(DMEM)-A(Blank)]x100 calculation of cell viability with DMEM medium added; wherein Blank refers to the absorbance of a well with CCK8 solution without cells. The data from each set of 5 replicates was assayed and 293T cell live cell statistics are shown in FIG. 7. As can be seen from FIG. 7, the HhAFP group had a larger number of living cells than the DMEM group and the pPICZαA group, and the difference was significant (P < 0.05).
Hoechst33342 is a nuclear dye that can penetrate cell membranes into cells to make nuclei exhibit blue fluorescence, while apoptotic cells exhibit strong blue fluorescence. PI can make necrotic cells appear red fluorescence, so that normal living cells appear weak blue fluorescence, apoptotic cells appear strong blue fluorescence, and necrotic cells appear strong red fluorescence and blue fluorescence under a fluorescence microscope. 200 μl was added to a 24-well plate and 3 wells were repeated. 37. After 4h incubation at C, the cells were observed under a normal microscope and photographed using a Zeiss microscope. The culture solution was aspirated, DPBS was added and washed once, and Hoechst33342/PI apoptosis staining reagent was added. 4. Dyeing at the temperature of 20-30min, sucking off the dyeing liquid, cleaning with DPBS, and observing and photographing under an inverted fluorescence microscope. After the experiment was repeated 3 times, statistical data were collected and single factor analysis of variance was performed using Graphpad Prism8 software.
The adherent cells were stained with Hoechst33342/PI, and the results are shown in FIG. 8 (A-C: the results of staining with Hoechst33342, PI, hoechst33342/PI of cells frozen with DMEM-containing culture solution; D-F: the results of staining with Hoechst33342, PI, hoechst33342/PI of cells frozen with pPICZ. Alpha. A-containing yeast culture; G-I: the results of staining with Hoechst33342, PI, hoechst33342/PI of cells frozen with HhAAP-containing yeast culture; bars=100 um).
From fig. 8, the HhAFP group exhibited significantly fewer cells than DMEM group and ppiczαa group, indicating that the HhAFP group had fewer necrotic cells than DMEM group and ppiczαa group.
The detection of CCK-8 reagent and Hoechst33342/PI double-staining detection prove that the cell survival rate of 293T cells frozen in the frozen stock solution containing antifreeze protein HhAFP is higher after resuscitation and has obvious difference with the control group and the negative group. From this, it was demonstrated that HhAFP has a protective effect in 293T cell cryopreservation, avoiding damage to cells by ice crystals, and reducing cell death.
Example 5 optimized expression of recombinant proteins under different conditions
Inoculating yeast transformant into BMG culture medium, culturing at 28deg.C and 250rpm under pH 6.0 to OD 600 After 1.5, the cells were collected by centrifugation.
The cells were inoculated into 50mL of BMM medium containing 0.5%, 1%, 1.5% and 2% methanol at different volume concentrations, respectively, and the inoculum size was 100. Mu.L of the bacterial liquid, and the cells were cultured at 28℃and 250rpm at pH 6.0 for 72 hours, and the supernatants were collected every 24 hours and supplemented with methanol according to the corresponding volume ratios. On the other hand, induction expression was performed by setting an induction temperature of 10℃and an induction time of 72 hours, and the supernatant was collected.
Protein concentration was determined using BCA method and SDS-PAGE analysis was performed to determine optimal expression and yield of recombinant protein HhAFP.
As shown in FIG. 9, the amount of protein expressed in the expression medium having methanol concentrations of 0.5%, 1.0%, 1.5% and 2.0% was differentThe target protein band was the deepest (72 h of incubation) at a methanol concentration of 1.5%, at which time the OD was the highest 600 2.22 and total protein concentration of 1.34mg/mL. OD after increasing methanol concentration 600 The total protein concentration and the target protein band were not significantly changed, but the large molecular weight of the hybrid protein band was deepened, so that the methanol concentration was determined to be 1.5%.
After 0h, 24h, 48h and 72h of expression culture, it was found that the protein bands were deepest when cultured for 72h, as shown in FIG. 10, at which time OD 600 2.23 and total protein concentration of 1.55mg/mL.
As shown in FIG. 11, the protein bands were darker at 28℃when the methanol concentration was 1.5% and the culture temperatures were 10℃and 28℃indicating that the protein expression was higher at 28℃than at 10℃when the total protein concentration was 1.29mg/mL and the expression level of recombinant protein HhAFP was 527mg/L.
By combining the results, when the expression culture temperature is 28 ℃, and the methanol concentration in the expression culture medium is 1.5%, after 72 hours of expression culture, the target protein obtained in the supernatant is more, the impurity protein is less, and the expression quantity of the recombinant protein HhAFP is 527mg/L through protein concentration measurement.
Claims (10)
1. An antifreeze protein comprising an amino acid sequence as set forth in SEQ ID No.1.
2. Antifreeze protein according to claim 1, characterized in that the amino acid sequence is shown in SEQ ID No.1, or the sequence shown in SEQ ID No.1 has a His tag at the C-terminal end, or the sequence shown in SEQ ID No.1 has 1 or 2 signal peptide cleavage site amino acids at the N-terminal end.
3. An antifreeze protein gene, which encodes an antifreeze protein as claimed in claim 1 or 2.
4. An antifreeze protein gene according to claim 3, comprising the nucleotide sequence shown in SEQ ID No. 2.
5. A recombinant expression vector comprising a gene encoding the antifreeze protein of claim 1 or 2.
6. A yeast engineering bacterium for expressing an antifreeze protein, wherein the yeast gene comprises a nucleotide sequence encoding the antifreeze protein of claim 1 or 2.
7. The yeast engineering bacterium according to claim 6, wherein the yeast gene further comprises a gene fragment encoding a secretion signal peptide and Kex 2 signal peptide cleavage site.
8. A method of preparing an antifreeze protein comprising the steps of:
fermenting the yeast engineering bacteria of claim 6 or 7 in BMM culture medium containing methanol, and culturing at 27-29 ℃ for 68-75h.
9. Use of an antifreeze protein gene according to claim 3 or 4, a yeast engineering bacterium according to claim 6 or 7 or a fermentation product thereof for preparing an antifreeze protein.
10. Use of an antifreeze protein according to claim 1 or 2, an antifreeze protein gene according to claim 3 or 4, a yeast engineering bacterium according to claim 6 or 7 or a fermentation product thereof for the preparation of a cell cryopreservation solution, a frozen preservative or a frozen food.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311377226.9A CN117164674B (en) | 2023-10-24 | 2023-10-24 | Antifreeze protein, gene, yeast engineering bacteria and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311377226.9A CN117164674B (en) | 2023-10-24 | 2023-10-24 | Antifreeze protein, gene, yeast engineering bacteria and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN117164674A true CN117164674A (en) | 2023-12-05 |
CN117164674B CN117164674B (en) | 2024-02-02 |
Family
ID=88930051
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202311377226.9A Active CN117164674B (en) | 2023-10-24 | 2023-10-24 | Antifreeze protein, gene, yeast engineering bacteria and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117164674B (en) |
Citations (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1273604A (en) * | 1997-07-31 | 2000-11-15 | 埃斯生物工程公司 | Antifreeze proteins, DNA and expression system |
US20010048962A1 (en) * | 1996-07-26 | 2001-12-06 | Richard Anthony Fenn | Frozen food product |
CN101402679A (en) * | 2008-11-13 | 2009-04-08 | 中国科学院遗传与发育生物学研究所 | Coldproof protein, encoding gene and uses thereof |
US20130165626A1 (en) * | 2010-04-30 | 2013-06-27 | Joichi Fukuoka | Antifreeze protein |
CN104212717A (en) * | 2014-09-18 | 2014-12-17 | 中国科学院海洋研究所 | Application of antifreeze protein of paralichthys olivaceus |
WO2015059057A2 (en) * | 2013-10-21 | 2015-04-30 | Vib Vzw | Novel class of antifreeze proteins |
US20190056394A1 (en) * | 2015-09-18 | 2019-02-21 | Hiroshima University | Protein tag that binds to substances having a crystal structure, and uses thereof |
CN110616227A (en) * | 2019-09-30 | 2019-12-27 | 天津科技大学 | Gene, recombinant expression vector, engineering strain and application of anti-freeze protein from tenebrio molitor |
CN110950945A (en) * | 2019-12-31 | 2020-04-03 | 石河子大学 | Antifreeze protein of Hepialus insect and coding gene and application thereof |
CN112876545A (en) * | 2021-03-19 | 2021-06-01 | 中国极地研究中心(中国极地研究所) | Antifreeze protein and preparation method and application thereof |
CN113667678A (en) * | 2021-07-08 | 2021-11-19 | 河南农业大学 | PsARF gene fragment and application thereof |
-
2023
- 2023-10-24 CN CN202311377226.9A patent/CN117164674B/en active Active
Patent Citations (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20010048962A1 (en) * | 1996-07-26 | 2001-12-06 | Richard Anthony Fenn | Frozen food product |
CN1273604A (en) * | 1997-07-31 | 2000-11-15 | 埃斯生物工程公司 | Antifreeze proteins, DNA and expression system |
CN101402679A (en) * | 2008-11-13 | 2009-04-08 | 中国科学院遗传与发育生物学研究所 | Coldproof protein, encoding gene and uses thereof |
US20130165626A1 (en) * | 2010-04-30 | 2013-06-27 | Joichi Fukuoka | Antifreeze protein |
WO2015059057A2 (en) * | 2013-10-21 | 2015-04-30 | Vib Vzw | Novel class of antifreeze proteins |
CN104212717A (en) * | 2014-09-18 | 2014-12-17 | 中国科学院海洋研究所 | Application of antifreeze protein of paralichthys olivaceus |
US20190056394A1 (en) * | 2015-09-18 | 2019-02-21 | Hiroshima University | Protein tag that binds to substances having a crystal structure, and uses thereof |
CN110616227A (en) * | 2019-09-30 | 2019-12-27 | 天津科技大学 | Gene, recombinant expression vector, engineering strain and application of anti-freeze protein from tenebrio molitor |
CN110950945A (en) * | 2019-12-31 | 2020-04-03 | 石河子大学 | Antifreeze protein of Hepialus insect and coding gene and application thereof |
CN112876545A (en) * | 2021-03-19 | 2021-06-01 | 中国极地研究中心(中国极地研究所) | Antifreeze protein and preparation method and application thereof |
CN113667678A (en) * | 2021-07-08 | 2021-11-19 | 河南农业大学 | PsARF gene fragment and application thereof |
Non-Patent Citations (3)
Title |
---|
CONNOR L SCHOLL: "Crystal waters on the nine polyproline type II helical bundle springtail antifreeze protein from Granisotoma rainieri match the ice lattice", 《FEBS J . 》, vol. 288, no. 14, pages 4332 - 4347 * |
胡爱军: "抗冻蛋白及其在食品工业中的应用", 《 食品工业科技》, vol. 23, no. 6, pages 75 - 77 * |
薛丽娥: "鱼类抗冻蛋白在动物精液、细胞、胚胎低温保存中的研究进展", 《中国畜牧兽医》, vol. 49, no. 12, pages 4715 - 4724 * |
Also Published As
Publication number | Publication date |
---|---|
CN117164674B (en) | 2024-02-02 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN106834336B (en) | Heterologous expression and purification method of trichoderma harzianum acid protease P6281 | |
CN111420037B (en) | Application of phage lyase Lysep3 in preparation of broad-spectrum antibacterial drugs | |
CN114989272A (en) | Phytophthora camphora effector protein SCR97226 and application thereof | |
CN110616227A (en) | Gene, recombinant expression vector, engineering strain and application of anti-freeze protein from tenebrio molitor | |
CN117164674B (en) | Antifreeze protein, gene, yeast engineering bacteria and application thereof | |
CN101864372A (en) | Preparation method of antibacterial peptide gene engineering strain | |
CN102719451A (en) | Poncirus trifoliata basic helix-loop-helix (PtrbHLH) and application in improving cold resistance of plant | |
CN110846294B (en) | Recombinant pectinase, gene thereof, recombinant vector, preparation method and application | |
CN110540974B (en) | Volvariella volvacea (Volvariella volvacea) catalase VCAT as well as coding gene and application thereof | |
CN103031290B (en) | High-sugar-tolerant beta-glucosaccharase Bg14, and expressed gene and application thereof | |
CN106243203B (en) | Volvariella volvacea heat shock protein VvHSP70 and application thereof | |
CN116555320A (en) | Recombinant human-derived III-type triple helix collagen engineering bacterium, and construction method and application thereof | |
CN110791508A (en) | Codon-optimized pediocin gene, expression vector and recombinant engineering strain | |
CN107815459B (en) | Pleurotus ostreatus manganese peroxidase gene and application thereof | |
CN111876395B (en) | Application of lentinus edodes manganese superoxide dismutase (LeMn-SOD) in improving stress tolerance of microorganisms | |
KR102155449B1 (en) | Method or mass production of LysP11 in plants, and pharmaceutical composition for prevention and treatment of swine erysipelas comprising the same | |
CN108085332B (en) | Recombinant yeast with cell surface displaying bean hull peroxidase and construction method and application thereof | |
CN104046642B (en) | The method of the Dimerized fusion protein of fermenting and producing | |
CN101831452B (en) | Method for efficiently expressing and producing T4 lysozyme through recombinant trichoderma reesei in inductive mode | |
KR101460861B1 (en) | Expression of bovine lactoferrin using transformed Chlorella | |
CN107058432B (en) | Method for producing antibacterial peptide by non-methanol induction | |
CN111500595A (en) | Ephedra sinica gene CeDREB1 and application thereof | |
CN105349536A (en) | Specific PCR primer for pathogenesis-related protein PR10 gene of tobacco and application thereof | |
CN109679985A (en) | Application of the plant as host in expression nine factor of blood coagulation | |
CN113005114B (en) | Enzyme SCXC, coding gene thereof and application of enzyme SCXC in preparation of pine wood nematode killing products |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |