CN117004650A - Cat dander allergen component feld1 double-chain dimer recombinant protein, preparation method and application - Google Patents
Cat dander allergen component feld1 double-chain dimer recombinant protein, preparation method and application Download PDFInfo
- Publication number
- CN117004650A CN117004650A CN202310745735.6A CN202310745735A CN117004650A CN 117004650 A CN117004650 A CN 117004650A CN 202310745735 A CN202310745735 A CN 202310745735A CN 117004650 A CN117004650 A CN 117004650A
- Authority
- CN
- China
- Prior art keywords
- feld1
- double
- recombinant protein
- cat dander
- allergen component
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 239000013566 allergen Substances 0.000 title claims abstract description 29
- 239000000539 dimer Substances 0.000 title claims abstract description 25
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 23
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 23
- 238000002360 preparation method Methods 0.000 title claims abstract description 8
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 27
- 241000282326 Felis catus Species 0.000 claims abstract description 25
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 19
- 238000001514 detection method Methods 0.000 claims abstract description 18
- 239000013612 plasmid Substances 0.000 claims abstract description 14
- 238000000034 method Methods 0.000 claims abstract description 11
- 239000013604 expression vector Substances 0.000 claims abstract description 8
- 239000013598 vector Substances 0.000 claims abstract description 7
- 238000002965 ELISA Methods 0.000 claims abstract description 6
- 241001052560 Thallis Species 0.000 claims abstract description 3
- 239000012634 fragment Substances 0.000 claims description 10
- 108091028732 Concatemer Proteins 0.000 claims description 8
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 claims description 6
- 238000000746 purification Methods 0.000 claims description 6
- 230000004927 fusion Effects 0.000 claims description 5
- 206010020751 Hypersensitivity Diseases 0.000 claims description 4
- 238000010276 construction Methods 0.000 claims description 4
- 101150084750 1 gene Proteins 0.000 claims description 3
- 238000001042 affinity chromatography Methods 0.000 claims description 3
- 208000026935 allergic disease Diseases 0.000 claims description 3
- 230000007815 allergy Effects 0.000 claims description 3
- 239000003795 chemical substances by application Substances 0.000 claims description 3
- 229910052759 nickel Inorganic materials 0.000 claims description 3
- 102000004190 Enzymes Human genes 0.000 claims description 2
- 108090000790 Enzymes Proteins 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 2
- 238000012258 culturing Methods 0.000 claims description 2
- 230000029087 digestion Effects 0.000 claims 1
- 239000001963 growth medium Substances 0.000 claims 1
- 238000009630 liquid culture Methods 0.000 claims 1
- 238000000605 extraction Methods 0.000 abstract description 4
- 238000003259 recombinant expression Methods 0.000 abstract description 2
- 230000002194 synthesizing effect Effects 0.000 abstract 1
- 238000006243 chemical reaction Methods 0.000 description 10
- 239000003153 chemical reaction reagent Substances 0.000 description 10
- 235000018102 proteins Nutrition 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 239000000872 buffer Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 239000006167 equilibration buffer Substances 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000011027 product recovery Methods 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 230000000172 allergic effect Effects 0.000 description 2
- 208000010668 atopic eczema Diseases 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000012637 gene transfection Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 239000002994 raw material Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 102100037084 C4b-binding protein alpha chain Human genes 0.000 description 1
- 101710159767 C4b-binding protein alpha chain Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000002009 allergenic effect Effects 0.000 description 1
- 238000003287 bathing Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000000379 polymerizing effect Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000001338 self-assembly Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229910021642 ultra pure water Inorganic materials 0.000 description 1
- 239000012498 ultrapure water Substances 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/24—Immunology or allergic disorders
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Urology & Nephrology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Immunology (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Plant Pathology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
The application relates to the technical field of recombinant proteins, and particularly discloses a cat dander allergen component feld1 double-chain dimer recombinant protein, a preparation method and application thereof. Firstly, preparing and synthesizing feld1 ch1, ch2 and Linker gene sequences, then fusing and connecting PCR, then constructing an expression vector by taking a plasmid pcDNA3.1 (+) as a vector, adding a connecting product into TOP10 competent cells for culture, collecting thalli, extracting plasmids, transfecting HEK293 cells with genes, expressing, purifying and obtaining ELISA titers. The method changes complex natural extraction into rapid, simple and stable recombinant expression, obtains target protein very similar to natural conformation, and improves the detection accuracy of allergen.
Description
Technical Field
The application relates to the technical field of recombinant proteins, in particular to a cat dander allergen component feld1 double-chain dimer recombinant protein, a preparation method and application.
Background
Cat dander allergen feld1 is 34kd dimer protein, which is formed by first connecting two protein chains of ch1 and ch2 in series and then polymerizing, and the protein conformation of the cat dander allergen feld1 is a double-chain dimer like a butterfly shape. Proteins exist mostly in single-or double-stranded monomeric form during recombination, however, proteins with a natural state can only stimulate allergic reactions in humans.
The current medical allergen detection raw materials are mostly extracted naturally, and target allergenic proteins are purified and separated in multiple ways and times from cat dander of multiple genera. Currently recombinant feld1 is a single-or double-stranded monomer, and is very different from the natural state, and a butterfly-shaped double-stranded dimer with biological activity is difficult to form.
Because of the species limitation of cats, the content and purity of the natural extraction target sensitized protein are extremely low, and the purification process is complicated, so that the protein is degraded and inactivated in the purification process, and the allergen detection difference is extremely large. Meanwhile, recombinant feld1 is in a single-chain or double-chain monomer form and has extremely low reaction to IgE of allergic people.
Disclosure of Invention
In order to improve the accuracy of cat dander allergen detection and reduce the difficulty of natural allergen extraction, the application provides a cat dander allergen component feld1 double-chain dimer recombinant protein, a preparation method and application.
In a first aspect, the application provides a preparation method of a double-stranded dimer recombinant protein of a cat dander allergen component feld1, which adopts the following technical scheme:
a method for preparing a double-chain dimer recombinant protein of a cat dander allergen component feld1, which comprises the following steps:
(1) Preparation of concatemer target fragments
1.1, the sequences of the feld1 ch1, ch2 and Linker genes are respectively SEQ ID NO.1, SEQ ID NO.2 and SEQ ID NO.3;
1.2 fusion and connection PCR to obtain a ch2-C4bp alpha-ch 1 concatemer target fragment, the sequence of which is SEQ ID NO.4;
(2) Construction of expression vectors
1.1 amplifying a target fragment of an enzyme cleavage site;
1.2pcDNA3.1 (+) plasmid double enzyme digestion, connecting target fragments;
(3) Protein expression
Adding the connection product into TOP10 competent cells for culturing, collecting thalli, and extracting plasmids;
(4) HEK293 cells are transfected by ch2-C4bp alpha-ch 1 gene, expressed and purified
(5) ELISA titers.
Preferably, the step (2) constructs an expression vector by using the plasmid pcDNA3.1 (+) as a vector.
Preferably, step (3) is added to TOP10 competent cells in an ice bath.
Preferably, the culture in the step (3) adopts LB-AG liquid medium.
Preferably, the purification in step (4) is performed by affinity chromatography using a nickel column.
In a second aspect, the application provides a double-stranded dimer recombinant protein of a cat dander allergen component feld1, which adopts the following technical scheme:
the cat dander allergen component feld1 double-chain dimer recombinant protein has the amino acid sequence as follows:
RGAVAVTAGVKMATCYDVAVANGNDSTKVNATRTAMKKDCYVNGSRVDGVMTTSSSKDCMGAVNTVDKNTGRMLGSQSISCSESGTWYPEVPRCEQEASEDLKPALTGMDAACTVAATADCCAVKRDVDTGTDYVVAYKAVVNARKNCVDAKMTDKNASDKYTSC。
preferably, the configuration is a butterfly double-stranded dimer.
In a third aspect, the application provides an application of a double-stranded dimer recombinant protein of a cat dander allergen component feld1, which adopts the following technical scheme:
the application of the cat dander allergen component feld1 double-chain dimer recombinant protein in preparing a cat allergy detection kit.
The application develops a structural framework of a polymer based on a C4 binding protein (C4 bp). C4bp is a plasma glycoprotein, which consists of 6-7 identical alpha-chains, the C-terminal residues of which are 541-597. C4bp- α contains 2 cysteine residues and a two parent α -helical region, due to its self-assembly ability and unique structure, by generating 1:1 are capable of forming a natural state double-stranded dimer conformation.
In summary, the application has the following beneficial effects:
1. the application changes the complex natural extraction of medical allergen detection raw materials into rapid, simple and stable recombinant expression, and obtains target protein which is quite similar to the natural conformation.
2. The definite allergen component detection is difficult to be achieved by natural extracts, and the detection result of the recombinant protein is more accurate and stable and is better used as the accompanying diagnosis of clinical vaccine application.
Drawings
Fig. 1: cloning the bands by molecules;
fig. 2: coating a plate result;
fig. 3: protein expression SDS-PAGE reduction electrophoresis;
fig. 4: verifying the potency;
fig. 5: a clinical detection result graph;
fig. 6: the method is a flow chart.
Detailed Description
EXAMPLE 1 calling and Synthesis of target Gene
Ch1 target Gene (accession No. NP-001041618.1) (SEQ ID NO. 1)
SEQ:ATGTTAGACGCAGCCCTCCCACCCTGCCCTACTGTTGCGGCCACAGCAGATTGTGA AATTTGCCCAGCCGTGAAGAGGGATGTTGACCTATTCCTGACGGGAACCCCCGACGAATATGTTGAGCAAGTGGCACAATACAAAGCACTACCTGTAGTATTGGAAAATGCCAGAATACTGAAGAACTGCGTTGATGCAAAAATGACAGAAGAGGATAAGGAGAATGCTCTCAGCTTGCTGGACAAAATATACACAAGTCCTCTGTGT
AA:MDAACTVAATADCCAVKRDVDTGTDYVVAYKAVVNARKNCVDAKMTDKNASDKYT SC
Ch2 target Gene (accession No. NP-001041618.1) (SEQ ID NO. 2)
SEQ:AGGGGGGCACTGCTTGTGCTGGCATTGCTGGTGACCCAAGCGCTGGGCGTCAAGA TGGCGGAAACTTGCCCCATTTTTTATGACGTCTTTTTTGCGGTGGCCAATGGAAATGAATTACTGTTGGACTTGTCCCTCACAAAAGTCAATGCTACTGAACCAGAGAGAACAGCCATGAAAAAAATCCAGGATTGCTACGTGGAGAACGGACTCATATCCAGGGTCTTGGATGGACTAGTCATGACAACCATCAGCTCCAGCAAAGATTGCATGGGTGAAGCAGTTCAGAACACCGTAGAAGATCTCAAGCTGAACACTTTGGGGAGA
AA:RGAVAVTAGVKMATCYDVAVANGNDSTKVNATRTAMKKDCYVNGSRVDGVMTTSSS KDCMGAVNTVDKNTGR
3.Linker(C4bpαGenebank NM_001419982.1 541-597AA)(SEQ ID NO.3)
DNA:ATGCTGGGCAGCCAGAGCATTAGCTGCAGCGAAAGCGGCACCTGGTATCCGGAAG TGCCG CGCTGCGAACAGGAAGCGAGCGAAGATCTGAAACCGGCGCTGACCGGC AA:MLGSQSISCSESGTWYPEVPRCEQEASEDLKPALTG
ch2-C4bp alpha-ch 1 concatemer target fragment (SEQ ID NO. 4)
AGGGGGGCACTGCTTGTGCTGGCATTGCTGGTGACCCAAGCGCTGGGCGTCAAGATGG
CGGAAACTTGCCCCATTTTTTATGACGTCTTTTTTGCGGTGGCCAATGGAAATGAATTAC
TGTTGGACTTGTCCCTCACAAAAGTCAATGCTACTGAACCAGAGAGAACAGCCATGAA
AAAAATCCAGGATTGCTACGTGGAGAACGGACTCATATCCAGGGTCTTGGATGGACTAG
TCATGACAACCATCAGCTCCAGCAAAGATTGCATGGGTGAAGCAGTTCAGAACACCGTA
GAAGATCTCAAGCTGAACACTTTGGGGAGAatgctgggcagccagagcattagctgcagcgaaagcggcacctg
gtatccggaagtgccgcgctgcgaacaggaagcgagcgaagatctgaaaccggcgctgaccggcATGTTAGACGCAGCCCT
CCCACCCTGCCCTACTGTTGCGGCCACAGCAGATTGTGAAATTTGCCCAGCCGTGAAGA
GGGATGTTGACCTATTCCTGACGGGAACCCCCGACGAATATGTTGAGCAAGTGGCACAA
TACAAAGCACTACCTGTAGTATTGGAAAATGCCAGAATACTGAAGAACTGCGTTGATGC
AAAAATGACAGAAGAGGATAAGGAGAATGCTCTCAGCTTGCTGGACAAAATATACACA
AGTCCTCTGTGT
Example 2ch2- -C4 bp. Alpha. -ch1 fusion ligation PCR
The system is configured according to the following table:
ddH 2 o was made up to a total volume of 1000 ul-100 ul/tube split, 10 tubes total, and the PCR procedure was as follows:
1% agarose gel electrophoresis, cutting gel, recovering concatemers (approximately 1200bp in size) and detecting the concentration.
Example 3 construction of expression vector Using plasmid pcDNA3.1 (+) as vector
5ug of the concatemer was taken, 5ul of SfiI was added, and Buffer CutSmart Buffer and water were added to a total volume of 200 ul. The reaction was carried out at 50℃for 5 hours, and the product was recovered using a PCR product recovery kit. Meanwhile, 10ug pcDNA3.1 (+) plasmid was taken, 8ul SfiI was added, buffer CutSmart Buffer and water were added to a total volume of 200ul, reacted for 3 hours at 50℃and cut to recover. 1.5ug of the digested pcDNA3.1 (+) plasmid and 450ng of the digested concatemer were taken and 15ul of T4 DNA ligase was added and buffer and water was added to a total volume of 150ul and ligated overnight at 16 ℃. The PCR product recovery kit was used for product recovery, eluting with 20ul water. Adding 10 mu L of purified ligation product into 100 mu L of TOP10 competent cells, and ice-bathing for 30min; LB-AG liquid medium was cultured overnight at 37℃to collect the cells and extract the plasmids.
Analysis of results
(1) The ch2-C4bp alpha-ch 1 ligation product constructs the vector, and the expression vector is successfully constructed, as shown in FIG. 1. Fig. 1: the bands were cloned molecularly. The size of the empty vector target band (5428 bp), the target fragment band (1200 bp) and the connected vector band (6628 bp) is correct, thus completing the construction of the expression vector.
(2) The monoclonal was transformed and the plating results are shown in FIG. 2. Fig. 2: the conversion TOP10 competent ligation products were plated.
EXAMPLE 4ch2-C4bp alpha-ch 1 Gene transfection, expression, purification
1. Gene transfection
The plasmid DNA extraction kit is used for extracting the ch2-C4bp alpha-ch 1 plasmid, HEK293 cells are transfected by genes, and the expression is carried out for 5 days in a serum-free culture medium shaking table. Centrifugation was performed at 5000rpm at 4℃for 10min, the supernatant (cell fermentation broth) was collected, concentrated gel was prepared, and the supernatant was subjected to SDS-PAGE electrophoresis, followed by a series of membrane transfer, blocking, antibody incubation, and the like.
2. Purification of proteins
Affinity chromatography using nickel column: washing 3-5 column volumes with ultra-pure water to wash off ethanol; washing 5-10 column volumes with equilibration buffer (20 mM phosphate buffer, 150mM NaCl,pH 7.4-8.5); the sample was loaded onto a column at a loading flow rate of 0.5ml/min. The equilibration buffer rewashes 5-10 column volumes. 8ml of elution buffer was collected by elution. The column was immediately equilibrated to neutrality with 5-10 column volumes of equilibration buffer. 1M NaCl regeneration flow wash 3-5 column volumes. Washing with pure water and 20% ethanol respectively for 3-5 column volumes. The column is kept at 4-8 ℃. The collected samples were pooled, passed through a dialysis zone, and dialyzed against Tris plasma using PBS at 4deg.C.
ELISA titers detection
Coating the purified protein with 2ug/ml 96-well ELISA plate for 24h at 4 ℃ and 100ul per well; next, 100ul per well was blocked with 1% skim milk dissolved in PBS at 4 ℃; then adding 1000PBS to continuously dilute human cat allergy or human normal serum, and incubating for 30min at 25 ℃ with 100ul per hole; followed by incubation at 25℃for 30min with addition of HRP-labeled IgE Fc at 1:1000 dilution, 100ul per well; then adding 100ul of TMB substrate solution into each hole, and reacting for 10min at room temperature in a dark place; finally, the reaction was quenched with 2M sulfuric acid and the OD at 450nm was read.
4. Analysis of results
4.1 protein expression SDS-PAGE reduction electrophoresis, see FIG. 3. Fig. 3: protein bands. The molecular weight of the predicted target protein is about 34kd, the molecular weight of the actually expressed protein after glycosylation is about 38kDa, the expressed target band is clear, and the purity is more than or equal to 95%.
4.2 potency verification, results are shown in figure 4. Fig. 4: ELISA titer validation plots. Compared with negative serum, the allergic serum has high reaction intensity and meets the immune requirement.
Example 5 clinical detection application of recombinant proteins
1. The method comprises the following steps:
after biotinylation feld1 reacts with clinical serum and fusion alkaline phosphatase recombinant anti-human IgE-Fc antibody in one step, SA magnetic beads are put into the kit, and luminescent substrates are added to read the light value after the magnetic beads are cleaned.
2. The kit comprises the following components:
1. reagent 1: biotinylated feld1
2. Reagent 2: recombinant murine anti-human IgE-Fc fusion alkaline phosphate
3. Reagent 3: SA magnetic bead
4. Reagent 4: luminous liquid
3. Full-automatic chemiluminescence instrument detection flow
3.1 placing the reagent components into a full-automatic chemiluminescence apparatus, and placing the serum sample into a sample tray.
3.2 the instrument was programmed to automatically aspirate 25ul each of reagents 1,2 and add to the reaction tube.
3.3, automatically sucking 25ul of serum sample according to a program, adding the serum sample into a 3.2 reaction tube, vibrating for 5s, and reacting for 15min.
3.4, automatically sucking the reagent 3 according to a program, adding the reagent into a 3.3 reaction tube, vibrating for 5s, and reacting for 5min.
3.5 the apparatus was programmed to automatically wash the beads in the 3.4 reaction tube.
3.6, automatically sucking the reagent 4 according to a program, adding the reagent into a 3.5 reaction tube, vibrating for 5s, and reacting for 5min.
And 3.7, automatically reading the photon number according to a program, calculating a luminescence value, and displaying the luminescence value on an operation panel.
4. Analysis of results
A total of 19 positive samples and 60 negative samples are detected, and the detection is carried out by synchronously using a commercial cat allergen detection kit, wherein kU/L is more than or equal to 0.35, and the result is shown in figure 5.
Fig. 5: and (5) a clinical detection result diagram. Compared with the commercial kit, the self-test kit has high sensitivity and more accurate detection, but both have the possibility of missing detection.
The present embodiment is only for explanation of the present application and is not to be construed as limiting the present application, and modifications to the present embodiment, which may not creatively contribute to the present application as required by those skilled in the art after reading the present specification, are all protected by patent laws within the scope of claims of the present application.
Claims (8)
1. A method for preparing a double-chain dimer recombinant protein of a cat dander allergen component feld1, which is characterized by comprising the following steps:
(1) Preparation of concatemer target fragments
a. The sequences of the feld1 ch1, the feld 2 and the Linker gene are respectively called as SEQ ID NO.1, SEQ ID NO.2 and SEQ ID NO.3;
b. fusion connection PCR to obtain a ch2-C4bp alpha-ch 1 concatemer target fragment with a sequence of SEQ ID NO.4;
(2) Construction of expression vectors
a. Amplifying a target fragment of the enzyme cutting site;
b. double digestion of pcDNA3.1 (+) plasmid and connection of target fragments;
(3) Protein expression
Adding the connection product into TOP10 competent cells for culturing, collecting thalli, and extracting plasmids;
(4) Transfecting HEK293 cells with ch2-C4bp alpha-ch 1 gene, expressing and purifying;
(5) ELISA titers.
2. The method for preparing the double-stranded dimer recombinant protein of the cat dander allergen component feld1 according to claim 1, which is characterized in that: and (2) constructing an expression vector by taking the plasmid pcDNA3.1 (+) as a vector.
3. The method for preparing the double-stranded dimer recombinant protein of the cat dander allergen component feld1 according to claim 1, which is characterized in that: the step (3) was added to TOP10 competent cells, ice-bath and cultured again.
4. The method for preparing the double-stranded dimer recombinant protein of the cat dander allergen component feld1 according to claim 1, which is characterized in that: the culture in the step (3) adopts LB-AG liquid culture medium.
5. The method for preparing the double-stranded dimer recombinant protein of the cat dander allergen component feld1 according to claim 1, which is characterized in that: and (3) performing affinity chromatography by using a nickel column for purification in the step (4).
6. The cat dander allergen component feld1 double-stranded dimer recombinant protein prepared by the method of any one of claims 1-5, which has the amino acid sequence of:
RGAVAVTAGVKMATCYDVAVANGNDSTKVNATRTAMKKDCYVNGSRVDGVMTTSSSKDCMGAVNTVDKNTGRMLGSQSISCSESGTWYPEVPRCEQEASEDLKPALTGMDAACTVAATADCCAVKRDVDTGTDYVVAYKAVVNARKNCVDAKMTDKNASDKYTSC。
7. the cat dander allergen component feld1 double-stranded dimer recombinant protein according to claim 6, characterized in that: the configuration is a butterfly double-stranded dimer.
8. Use of the cat dander allergen component feld1 double-stranded dimer recombinant protein according to claim 6 for preparing a cat allergy detection kit.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310745735.6A CN117004650B (en) | 2023-06-25 | 2023-06-25 | Double-chain dimer recombinant protein of cat dander allergen component feld, preparation method and application |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310745735.6A CN117004650B (en) | 2023-06-25 | 2023-06-25 | Double-chain dimer recombinant protein of cat dander allergen component feld, preparation method and application |
Publications (2)
Publication Number | Publication Date |
---|---|
CN117004650A true CN117004650A (en) | 2023-11-07 |
CN117004650B CN117004650B (en) | 2024-05-14 |
Family
ID=88573490
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310745735.6A Active CN117004650B (en) | 2023-06-25 | 2023-06-25 | Double-chain dimer recombinant protein of cat dander allergen component feld, preparation method and application |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117004650B (en) |
Citations (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20060292138A1 (en) * | 2005-06-23 | 2006-12-28 | Haiming Chen | Allergen vaccine proteins for the treatment and prevention of allergic diseases |
US20070092933A1 (en) * | 2002-08-14 | 2007-04-26 | Avidis Sa | Production of multimeric fusion proteins using a c4bp scaffold |
US20090175896A1 (en) * | 2005-03-18 | 2009-07-09 | Cytos Biotechnology Ag | CAT Allergen Conjugates and Uses Thereof |
WO2014154187A1 (en) * | 2013-03-15 | 2014-10-02 | 兰州大学 | Preparation and use of dimerized fusion protein |
CN104411719A (en) * | 2012-05-03 | 2015-03-11 | 瑞泽恩制药公司 | Human antibodies to fel d1 and methods of use thereof |
CN105219742A (en) * | 2015-11-10 | 2016-01-06 | 海南大学 | A kind of show restructuring cat sensitinogen rFel d 1 albumen immunostimulant virus-like particle, its expression vector and preparation and application thereof |
WO2016192788A1 (en) * | 2015-06-03 | 2016-12-08 | Universität Zürich Prorektorat Mnw | Methods and compositions for preventing and treating cat or dog dander allergy |
US20180250387A1 (en) * | 2015-09-08 | 2018-09-06 | Universität Zürich | Compositions against cat allergy |
US20200255503A1 (en) * | 2016-12-22 | 2020-08-13 | Regeneron Pharmaceuticals, Inc. | Method of treating an allergy with allergen-specific monoclonal antibodies |
WO2023281120A1 (en) * | 2021-07-09 | 2023-01-12 | Luxembourg Institute Of Health (Lih) | Dimeric protein complexes and uses thereof |
-
2023
- 2023-06-25 CN CN202310745735.6A patent/CN117004650B/en active Active
Patent Citations (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20070092933A1 (en) * | 2002-08-14 | 2007-04-26 | Avidis Sa | Production of multimeric fusion proteins using a c4bp scaffold |
US20090175896A1 (en) * | 2005-03-18 | 2009-07-09 | Cytos Biotechnology Ag | CAT Allergen Conjugates and Uses Thereof |
US20060292138A1 (en) * | 2005-06-23 | 2006-12-28 | Haiming Chen | Allergen vaccine proteins for the treatment and prevention of allergic diseases |
CN104411719A (en) * | 2012-05-03 | 2015-03-11 | 瑞泽恩制药公司 | Human antibodies to fel d1 and methods of use thereof |
WO2014154187A1 (en) * | 2013-03-15 | 2014-10-02 | 兰州大学 | Preparation and use of dimerized fusion protein |
WO2016192788A1 (en) * | 2015-06-03 | 2016-12-08 | Universität Zürich Prorektorat Mnw | Methods and compositions for preventing and treating cat or dog dander allergy |
US20180250387A1 (en) * | 2015-09-08 | 2018-09-06 | Universität Zürich | Compositions against cat allergy |
CN105219742A (en) * | 2015-11-10 | 2016-01-06 | 海南大学 | A kind of show restructuring cat sensitinogen rFel d 1 albumen immunostimulant virus-like particle, its expression vector and preparation and application thereof |
US20200255503A1 (en) * | 2016-12-22 | 2020-08-13 | Regeneron Pharmaceuticals, Inc. | Method of treating an allergy with allergen-specific monoclonal antibodies |
WO2023281120A1 (en) * | 2021-07-09 | 2023-01-12 | Luxembourg Institute Of Health (Lih) | Dimeric protein complexes and uses thereof |
Non-Patent Citations (2)
Title |
---|
樊娇娇;李苏颖;李春红;陈华;夏之宁;杨丰庆;: "组合肽配体库技术富集蛋白研究进展", 分析测试学报, no. 01, 25 January 2017 (2017-01-25), pages 154 - 162 * |
许卓谦;刘志刚;: "猫过敏原Fel d1基因的克隆、表达及特性鉴定", 中华微生物学和免疫学杂志, no. 12, 28 December 2006 (2006-12-28), pages 21 * |
Also Published As
Publication number | Publication date |
---|---|
CN117004650B (en) | 2024-05-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2022027702A1 (en) | Helicobacter pylori ferritin-based novel coronavirus s protein multimeric nanovaccine | |
CN111018985B (en) | Application of single-domain antibody aiming at bovine serum albumin BSA | |
CN113087792B (en) | Canine distemper virus nano antibody and application thereof | |
CN111138533B (en) | Single domain antibody against hepatitis A virus and derived protein thereof | |
CN113999310A (en) | PLGF monoclonal antibody, kit, preparation method and application thereof | |
KR20200003235A (en) | Identification of antigen-specific adaptive immune responses using arm-pcr and high-throughput sequencing | |
CN114276445A (en) | Rotavirus recombinant protein specific antibody, plasmid vector and method | |
CN112111015B (en) | PLA2R, C1q and THSD7A fusion protein and construction method and application thereof | |
CN111647081B (en) | Recombinant mouse anti-human interleukin 19 monoclonal antibody, preparation method and application | |
US20220214340A1 (en) | Zipper structure that helps the formation of protein dimer and application thereof | |
CN117004650B (en) | Double-chain dimer recombinant protein of cat dander allergen component feld, preparation method and application | |
CN111138532B (en) | Use of single domain antibodies against hepatitis a virus | |
CN110872354B (en) | Chicken-derived monoclonal antibody and single-chain antibody of mammal cell recombinant anti-human TK1, and preparation method and application thereof | |
CN111100209A (en) | Recombinant protein G3P20-31 and preparation method and application thereof | |
CN115819580A (en) | High affinity rabbit monoclonal antibodies to human IL-12 and uses thereof | |
CN114560940B (en) | SIRP alpha resisting rabbit recombinant monoclonal antibody, and preparation method and application thereof | |
CN111647086B (en) | Recombinant mouse anti-human creatine kinase monoclonal antibody, preparation method and application | |
CN111138554A (en) | Recombinant protein G3P1-12 and preparation method and application thereof | |
CN111647083B (en) | Recombinant mouse anti-human hemojulin monoclonal antibody, preparation method and application | |
CN111978382B (en) | Preparation method and application of recombinant protein of Sporothrix globosum Gp70 | |
CN117304326B (en) | Anti-MEIOB monoclonal antibody and application thereof | |
CN114317453B (en) | Hybridoma cell strain secreting insulin monoclonal antibody, monoclonal antibody and application thereof | |
CN114933642B (en) | Art v 1 recombinant protein and application thereof | |
CN114438125B (en) | Method for enhancing LGI1 immunofluorescence, and immunofluorescence detection method and application of LGI1 antibody | |
CN112250770A (en) | PR3, MPO and GBM fusion protein, and construction method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |