CN116751303A - Nanometer antibody for resisting guanylate cyclase 2C and application thereof - Google Patents
Nanometer antibody for resisting guanylate cyclase 2C and application thereof Download PDFInfo
- Publication number
- CN116751303A CN116751303A CN202310749124.9A CN202310749124A CN116751303A CN 116751303 A CN116751303 A CN 116751303A CN 202310749124 A CN202310749124 A CN 202310749124A CN 116751303 A CN116751303 A CN 116751303A
- Authority
- CN
- China
- Prior art keywords
- seq
- chimeric antigen
- antigen receptor
- cells
- guanylate cyclase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 101000899808 Homo sapiens Guanylyl cyclase C Proteins 0.000 title claims abstract description 71
- 102100022662 Guanylyl cyclase C Human genes 0.000 title claims abstract description 69
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 47
- 239000000427 antigen Substances 0.000 claims abstract description 15
- 108091007433 antigens Proteins 0.000 claims abstract description 15
- 102000036639 antigens Human genes 0.000 claims abstract description 15
- 150000001413 amino acids Chemical group 0.000 claims description 36
- 206010028980 Neoplasm Diseases 0.000 claims description 18
- 241000713666 Lentivirus Species 0.000 claims description 15
- 239000013598 vector Substances 0.000 claims description 14
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 13
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 11
- 239000013604 expression vector Substances 0.000 claims description 11
- 210000002865 immune cell Anatomy 0.000 claims description 11
- 108090000623 proteins and genes Proteins 0.000 claims description 11
- 239000000872 buffer Substances 0.000 claims description 10
- 101710095468 Cyclase Proteins 0.000 claims description 9
- 230000004913 activation Effects 0.000 claims description 8
- 230000003834 intracellular effect Effects 0.000 claims description 7
- 238000002360 preparation method Methods 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 230000019491 signal transduction Effects 0.000 claims description 6
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 5
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 5
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 4
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 4
- 239000000463 material Substances 0.000 claims description 4
- 108020004707 nucleic acids Proteins 0.000 claims description 4
- 102000039446 nucleic acids Human genes 0.000 claims description 4
- 150000007523 nucleic acids Chemical class 0.000 claims description 4
- -1 pH regulators Substances 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 4
- 239000011248 coating agent Substances 0.000 claims description 3
- 238000000576 coating method Methods 0.000 claims description 3
- 239000003085 diluting agent Substances 0.000 claims description 3
- 239000003814 drug Substances 0.000 claims description 3
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 claims description 2
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 claims description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 2
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 2
- 239000003963 antioxidant agent Substances 0.000 claims description 2
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 2
- 239000011230 binding agent Substances 0.000 claims description 2
- 239000000969 carrier Substances 0.000 claims description 2
- 239000003086 colorant Substances 0.000 claims description 2
- 239000006184 cosolvent Substances 0.000 claims description 2
- 239000007884 disintegrant Substances 0.000 claims description 2
- 239000003995 emulsifying agent Substances 0.000 claims description 2
- 239000000945 filler Substances 0.000 claims description 2
- 210000003630 histaminocyte Anatomy 0.000 claims description 2
- 210000002540 macrophage Anatomy 0.000 claims description 2
- 210000000822 natural killer cell Anatomy 0.000 claims description 2
- 230000003204 osmotic effect Effects 0.000 claims description 2
- 230000001177 retroviral effect Effects 0.000 claims description 2
- 239000002904 solvent Substances 0.000 claims description 2
- 239000004094 surface-active agent Substances 0.000 claims description 2
- 239000013603 viral vector Substances 0.000 claims description 2
- 239000000080 wetting agent Substances 0.000 claims description 2
- 210000004027 cell Anatomy 0.000 abstract description 80
- 230000002147 killing effect Effects 0.000 abstract description 13
- 210000004881 tumor cell Anatomy 0.000 abstract description 6
- 125000003275 alpha amino acid group Chemical group 0.000 abstract 3
- 238000000034 method Methods 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 15
- 206010009944 Colon cancer Diseases 0.000 description 14
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 12
- 239000003153 chemical reaction reagent Substances 0.000 description 10
- 238000001514 detection method Methods 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 9
- 210000001519 tissue Anatomy 0.000 description 9
- 238000005406 washing Methods 0.000 description 9
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 8
- 239000012634 fragment Substances 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 108090000695 Cytokines Proteins 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 206010027476 Metastases Diseases 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 239000012636 effector Substances 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- ZOOGRGPOEVQQDX-UUOKFMHZSA-N 3',5'-cyclic GMP Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=C(NC2=O)N)=C2N=C1 ZOOGRGPOEVQQDX-UUOKFMHZSA-N 0.000 description 5
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 5
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- ZOOGRGPOEVQQDX-UHFFFAOYSA-N cyclic GMP Natural products O1C2COP(O)(=O)OC2C(O)C1N1C=NC2=C1NC(N)=NC2=O ZOOGRGPOEVQQDX-UHFFFAOYSA-N 0.000 description 5
- 239000008367 deionised water Substances 0.000 description 5
- 229910021641 deionized water Inorganic materials 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 230000000968 intestinal effect Effects 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 230000009401 metastasis Effects 0.000 description 5
- 238000002823 phage display Methods 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- 108010078321 Guanylate Cyclase Proteins 0.000 description 4
- 102000014469 Guanylate cyclase Human genes 0.000 description 4
- 102100032700 Keratin, type I cytoskeletal 20 Human genes 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 238000009169 immunotherapy Methods 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 238000007789 sealing Methods 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 101000994460 Homo sapiens Keratin, type I cytoskeletal 20 Proteins 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 241001416177 Vicugna pacos Species 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 239000007853 buffer solution Substances 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 230000002496 gastric effect Effects 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 102000045577 human GUCY2C Human genes 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 238000004806 packaging method and process Methods 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000012089 stop solution Substances 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 206010012735 Diarrhoea Diseases 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 229920002594 Polyethylene Glycol 8000 Polymers 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 238000010009 beating Methods 0.000 description 2
- 239000000090 biomarker Substances 0.000 description 2
- 230000006037 cell lysis Effects 0.000 description 2
- 238000003501 co-culture Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000012737 fresh medium Substances 0.000 description 2
- 230000001024 immunotherapeutic effect Effects 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000011259 mixed solution Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 238000002791 soaking Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 229940126585 therapeutic drug Drugs 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- NLMDJJTUQPXZFG-UHFFFAOYSA-N 1,4,10,13-tetraoxa-7,16-diazacyclooctadecane Chemical compound C1COCCOCCNCCOCCOCCN1 NLMDJJTUQPXZFG-UHFFFAOYSA-N 0.000 description 1
- 125000001417 5'-guanylyl group Chemical group C=12N=C(N([H])[H])N([H])C(=O)C=1N=C([H])N2[C@@]1([H])[C@@](O[H])([H])[C@@](O[H])([H])[C@](C(OP(=O)(O[H])[*])([H])[H])([H])O1 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 238000011357 CAR T-cell therapy Methods 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- 102000004654 Cyclic GMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010003591 Cyclic GMP-Dependent Protein Kinases Proteins 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 108010001687 Enterotoxin Receptors Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 101710121697 Heat-stable enterotoxin Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 108010066370 Keratin-20 Proteins 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000012131 assay buffer Substances 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 108020001778 catalytic domains Proteins 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 239000012295 chemical reaction liquid Substances 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000000741 diarrhetic effect Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-N diphosphoric acid Chemical compound OP(O)(=O)OP(O)(O)=O XPPKVPWEQAFLFU-UHFFFAOYSA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000002729 effect on secretion Effects 0.000 description 1
- 239000006274 endogenous ligand Substances 0.000 description 1
- 230000000688 enterotoxigenic effect Effects 0.000 description 1
- 239000000147 enterotoxin Substances 0.000 description 1
- 231100000655 enterotoxin Toxicity 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- RQFCJASXJCIDSX-UUOKFMHZSA-N guanosine 5'-monophosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O RQFCJASXJCIDSX-UUOKFMHZSA-N 0.000 description 1
- 210000003917 human chromosome Anatomy 0.000 description 1
- 208000008384 ileus Diseases 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 210000002490 intestinal epithelial cell Anatomy 0.000 description 1
- 230000004609 intestinal homeostasis Effects 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000003147 molecular marker Substances 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 230000000771 oncological effect Effects 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 230000008533 pain sensitivity Effects 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000002980 postoperative effect Effects 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229940005657 pyrophosphoric acid Drugs 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 201000009881 secretory diarrhea Diseases 0.000 description 1
- 239000013049 sediment Substances 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Inorganic materials [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 231100000820 toxicity test Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 208000009935 visceral pain Diseases 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/005—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Virology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Hematology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Physics & Mathematics (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The application discloses a nano antibody for resisting guanylate cyclase 2C and application thereof. The amino acid sequence of the CDR1 of the nano antibody comprises a sequence shown as SEQ ID NO.1, SEQ ID NO.2 or SEQ ID NO.3, the amino acid sequence of the CDR2 of the nano antibody comprises a sequence shown as SEQ ID NO.4, SEQ ID NO.5, SEQ ID NO.6, SEQ ID NO.7, SEQ ID NO.8, SEQ ID NO.9 or SEQ ID NO.10, and the amino acid sequence of the CDR3 of the nano antibody comprises a sequence shown as SEQ ID NO.11, SEQ ID NO.12 or SEQ ID NO. 13. The nano antibody for resisting guanylate cyclase 2C can specifically bind to guanylate cyclase 2C antigen, has better affinity, is used as an antigen binding domain to construct chimeric antigen receptor and CAR-T cell, and has obvious killing activity on guanylate cyclase 2C positive tumor cells.
Description
The application relates to a divisional application of a patent application with the application number of 202211582937.5 (the application date of the original application is 2022, 12 and 09, and the name of the nanometer antibody is guanylate cyclase 2C and application thereof).
Technical Field
The application belongs to the technical field of biological medicines, and relates to a nano antibody for resisting guanylate cyclase 2C (GUCY 2C) and application thereof.
Background
Guanylate cyclase 2C (GUCY 2C) is a transmembrane receptor protein expressed mainly in human intestinal epithelial cells, its gene is located on human chromosome 12, the cDNA of GUCY2C contains an open reading frame of 3219bp, and it contains 27 exons in total, codes for a protein consisting of 1073 amino acids with a relative molecular mass of about 120kDa, belonging to the family of receptor ornithine cyclases. Its transmembrane and intracellular domains (kinase homology, junction and guanylate cyclase domains) share homology with other membrane-bound guanylate cyclases, while its unique N-terminal extracellular domain (residues 1-430) determines its ligand specificity.
In the extracellular domain, STa binds to the amino acid microdomains adjacent to the transmembrane region (87-393), while the mechanism by which Sta binding increases cGMP production is still unknown (see: john C Flickinger Jr, jeffrey A Rappaport, joshua RBarton, et al, guanyyl cyclase C as a biomarker for immunotherapies for the treatment of gastrointestinal Magnancies. Biomark.Med. (2021) 15 (3), 201-217, doi: 10.2217/bmm-2020-0359). Current studies indicate that the endogenous ligands guanosine and uridine can activate GUCY2C, which, by binding to GUCY2C, causes an increase in intracellular cyclic guanosine phosphate concentration, further activating cGMP-dependent protein kinase gii, thereby causing a corresponding physiological change. This physiological change plays a key role in maintaining intestinal homeostasis, improving visceral pain sensitivity, inhibiting intestinal tissue degeneration, etc. (Kuhn M. Molecular physiology of membrane guanylyl cyclereceptors. Physiol Rev,2016,96 (2): 751-804, doi: 10.1152/Physrev.00022.2015.).
GUCY2C is an intestinal tissue-specific polypeptide that is expressed in normal intestinal mucosal epithelium and primary or secondary colorectal cancer (see: frick GS, pitari GM, weinberg DS, et al, guanyyl cyclase C: a molecularmarker for staging and postoperative surveillance of patients with colorectal cancer. Expert Rev Mol Diagn,2005,5 (5): 701-713, doi: 10.1586/14737159.5.5.701.). Immunohistochemistry was performed to examine the expression of GUCY2C in normal intestinal tissue, colorectal cancer tissue and parenteral tissue, and carcinoembryonic antigen (CEA) and cytokeratin 20 (CK 20) were used as controls, and the results showed that the positive rate of GUCY2C in normal intestinal tissue and colorectal cancer tissue was 100% and 80%, CK20 was 94% and 100%, and CEA was 94% and 94%, respectively. GUCY2C is expressed predominantly in the mucosa crypt and villus, with the most expressed in the mid-villus but almost not in extra-intestinal tissue, while CEA and CK20 are expressed to different extents in esophageal and gastric cancer tissues. GUCY2C is more specific and sensitive than CEA and CK20, and is an effective index for detecting colorectal Cancer (see: buc E, vartanian MD, darcha C, et al, guanyyl cyclase C as a reliable immunohistochemical marker and its ligand Escherichia coli heat-stable enterotoxin as a potential protein-delivering vehicle for colorectal Cancer cells, eur J Cancer,2005,41 (11): 1618-1627, doi: 10.1016/j.ejca.2005.02.031.).
GUCY2C was originally termed the STa receptor and was previously identified as a receptor for thermostable enterotoxins (STa) that cause diarrhea pathogenic bacteria in travelers. Initial studies showed that STa is secreted by enterotoxigenic escherichia coli (ETEC) and can lead to cyclic GMP (cGMP) accumulation in the gut compared to other diarrheal toxins such as cholera toxin. This suggests that STa signal activation is possible by guanylate cyclase, one of the known protein family members catalyzing the conversion of GTP to cGMP and pyrophosphoric acid, and that GUCY2C was first cloned from a rat small intestine cDNA library using a highly conserved sequence of guanylate cyclase catalytic domains and demonstrated to be a source of both STa receptor and cGMP accumulation. GUCY2C is more conserved in all vertebrates, whereas a mutation in GUCY2C is its effect on secretion, whose loss of function can lead to decreased secretion and neonatal ileus, whereas GUCY2C gain of function will lead to increased secretion and secretory diarrhea.
Recent studies indicate that GUCY2C may be an extremely potential immunotherapeutic target for the treatment of gastrointestinal cancers. As early as 2008, there was an immunotherapeutic approach to making a vaccine using targeted GUCY2C, and researchers selected the extracellular domain of GUCY2C as a vaccine target, cloned into recombinant adenovirus serotype 5 (Ad 5), for immunogenicity and colorectal cancer treatment studies, ad5-GUCY2C significantly reduced tumor burden in mice models of liver and lung metastasis (two sites most common for colorectal cancer metastasis) and increased survival rate of mice compared to control. (see: john C Flickinger Jr, jeffrey A Rappaport, joshua R Barton, et al, guanylyl cyclase C as a biomarker for immunotherapies for the treatment of gastrointestinal magnanices. Biomark. Med. (2021) 15 (3), 201-217.).
Michael S.Magee et alConstruction of CART cells targeting human GUCY 2C-expressing metastases with human specific single-chain variable fragments promotes activation of antigen-dependent T cells, and allows up-regulation of activation markers and cytokine production, and kills GUCY 2C-expressing tumor cells. In an allograft mouse model, CAR-T cells directed against GUCY2C may have long-term protective effects on lung metastasis models of mouse colorectal cancer cells expressing human GUCY2C. Secondly in the human xenograft model of immunodeficient mice, CAR-T cells directed against GUCY2C recognize and kill human colorectal cancer cells endogenously expressing GUCY2C, thereby providing a long-lasting survival of the model. Researchers have shown that a single injection of the highest dose of 10 in colorectal lung metastasis model using CAR design encoding scFv specific for human GUCY2C 7 There were 60% of animals cured of CAR T cells. And CAR-T cells were repeatedly injected at this dose, the survival rate of treatment was increased to 80% 100 days after tumor implantation. In addition, 75% of animals initially treated with GUCY2C CAR-T cells survived more than 80 days after tumor re-transplantation, indicating that GUCY2C CART cells persisted and acted within 6 months after initial dosing. In addition, in the CDX model of peritoneal metastasis, an oncological experiment was performed using the human colorectal cancer cell line T84, and the constructed CAR-T cells of human GUCY2C had a curative effect on 100% of the test animals. The above strongly supports the potential value of GUCY 2C-directed CAR-T cell therapies in clinical applications of gastrointestinal malignancies. (Magee MS, abraham TS, baybutt TR, et al human GUCY2C-targeted Chimeric Antigen Receptor (CAR) -expressing T cells eliminate colorectal cancer meta-acids.cancer immunol.Res.6 (5), 509-516 (2018)).
In conclusion, GUCY2C can be used as a target spot of tumor treatment, provides an anti-GUCY2C antibody with high specificity and affinity, and has important significance for treating malignant tumors.
Disclosure of Invention
Aiming at the defects and actual demands of the prior art, the application provides the anti-guanylate cyclase 2C nanobody and the application thereof, and the anti-GUCY2C nanobody has high affinity, can be used as an antigen binding domain of a chimeric antigen receptor molecule to prepare the CAR-T cell, and has good application prospect in the aspect of tumor treatment.
In order to achieve the aim of the application, the application adopts the following technical scheme:
in a first aspect, the present application provides a nanobody against guanylate cyclase 2C, the amino acid sequence of CDR1 of the nanobody comprises the sequences shown in SEQ ID No.1, SEQ ID No.2, and SEQ ID No.3, the amino acid sequence of CDR2 of the nanobody comprises the sequences shown in SEQ ID No.4, SEQ ID No.5, SEQ ID No.6, SEQ ID No.7, SEQ ID No.8, SEQ ID No.9, and SEQ ID No.10, and the amino acid sequence of CDR3 of the nanobody comprises the sequences shown in SEQ ID No.11, SEQ ID No.12, and SEQ ID No. 13.
According to the application, a non-immunized alpaca is immunized by guanylate cyclase 2C recombinant protein, a phage display nano antibody library is constructed, and screening is carried out on anti-guanylate cyclase 2C antibodies according to the phage display nano antibody library to obtain monoclonal antibodies capable of specifically binding guanylate cyclase 2C antigens, wherein the antibodies belong to single domain antibodies.
The anti-GUCY2C nano antibody provided by the application has high affinity, can be used as an antigen binding domain of a chimeric antigen receptor molecule to prepare the CAR-T cell, and has a good application prospect in the aspect of tumor treatment.
SEQ ID NO.1:GYTYSSYC。
SEQ ID NO.2:GINYRNYC。
SEQ ID NO.3:GYTRGTHA。
SEQ ID NO.4:IDSDGST。
SEQ ID NO.5:IYNGD。
SEQ ID NO.6:IYNGA。
SEQ ID NO.7:IYNAA。
SEQ ID NO.8:SYNGD。
SEQ ID NO.9:VETDGNT。
SEQ ID NO.10:MYNGD。
SEQ ID NO.11:AADGPGRCYGGYWYRSPKISFGI。
SEQ ID NO.12:AAGAQFLCANNNWYQHLYTY。
SEQ ID NO.13:AAGDTVASRWYARRTSPMAVRGYND。
Preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.1, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.4, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 11;
preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.2, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.5, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 12;
preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.2, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.6, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 12;
preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.2, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.7, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 12;
preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.2, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.8, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 12.
Preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.3, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.9, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 13.
Preferably, the amino acid sequence of CDR1 of the nanobody comprises the sequence shown in SEQ ID NO.2, the amino acid sequence of CDR2 comprises the sequence shown in SEQ ID NO.10, and the amino acid sequence of CDR3 comprises the sequence shown in SEQ ID NO. 12.
Preferably, the heavy chain variable region of the nanobody further comprises: the framework region 1 (FR 1) shown in SEQ ID No.14 or 15, SEQ ID No.16 or 17, the framework region 2 (FR 2) shown in SEQ ID No.18, SEQ ID No.19 or 20, the framework region 3 (FR 3) shown in SEQ ID No.22, SEQ ID No.23, SEQ ID No.24 or 25 and the framework region 4 (FR 4) shown in SEQ ID No.26 or 27.
SEQ ID NO.14:QVKLVQSGGGLVQPGGSLRLSCAAS。
SEQ ID NO.15:QVKLVQSGGGSVQAGGSLRLSCAAS。
SEQ ID NO.16:EVKLVESGGGSVQAGGSLRLSCEAS。
SEQ ID NO.17:QVQLVESGGGSVQAGGSLRLSCAAS。
SEQ ID NO.18:MGWFRQAPGKEREGVAA。
SEQ ID NO.19:MAWFRQAPGKQREGVAR。
SEQ ID NO.20:MGWFRQAPGKEREGVAT。
SEQ ID NO.21:
SYADSVKGRFTISKDNAKNTLYLQMNSLEPEDTAMYYC。
SEQ ID NO.22:
SYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYC。
SEQ ID NO.23:
SYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAVYYC。
SEQ ID NO.24:
SYADSVKGRFTISQDNAKNLVYLQMNSLKPEDTAMYYC。
SEQ ID NO.25:
RYADSVKGRFTIIKDNAKNTLYLQMNSLKPDDTAMYYC。
SEQ ID NO.26:WGQGTQVTVSS。
SEQ ID NO.27:WGQGTQVTVST。
Preferably, the heavy chain variable region of the nanobody comprises the amino acid sequence shown as SEQ ID NO.28, SEQ ID NO.29, SEQ ID NO.30, SEQ ID NO.31, SEQ ID NO.32, SEQ ID NO.33 or SEQ ID NO. 34.
SEQ ID NO.28:
QVKLVQSGGGLVQPGGSLRLSCAASGYTYSSYCMGWFRQAPGKEREGVAAIDSDGST SYADSVKGRFTISKDNAKNTLYLQMNSLEPEDTAMYYCAADGPGRCYGGYWYRSPKISFG IWGQGTQVTVSS。
SEQ ID NO.29:
QVKLVQSGGGSVQAGGSLRLSCAASGINYRNYCMAWFRQAPGKQREGVARIYNGDS YADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCAAGAQFLCANNNWYQHLYTYW GQGTQVTVSS。
SEQ ID NO.30:
EVKLVESGGGSVQAGGSLRLSCEASGINYRNYCMAWFRQAPGKQREGVARIYNGASY ADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAVYYCAAGAQFLCANNNWYQHLYTYWG QGTQVTVST。
SEQ ID NO.31:
QVKLVQSGGGSVQAGGSLRLSCAASGINYRNYCMAWFRQAPGKQREGVARIYNAAS YADSVKGRFTISQDNAKNLVYLQMNSLKPEDTAMYYCAAGAQFLCANNNWYQHLYTYW GQGTQVTVSS。
SEQ ID NO.32:
QVKLVQSGGGSVQAGGSLRLSCAASGINYRNYCMAWFRQAPGKQREGVARSYNGDS YADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCAAGAQFLCANNNWYQHLYTYW GQGTQVTVSS。
SEQ ID NO.33:
QVQLVESGGGSVQAGGSLRLSCAASGYTRGTHAMGWFRQAPGKEREGVATVETDGN TRYADSVKGRFTIIKDNAKNTLYLQMNSLKPDDTAMYYCAAGDTVASRWYARRTSPMAVR GYNDWGQGTQVTVSS。
SEQ ID NO.34:
QVKLVQSGGGSVQAGGSLRLSCAASGINYRNYCMAWFRQAPGKQREGVARMYNGD SYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCAAGAQFLCANNNWYQHLYTY WGQGTQVTVSS。
In the application, a phage display technology is utilized to screen a guanylate cyclase 2C immune camel VHH library, and the obtained nano antibody has high affinity and has important application prospect in the aspect of constructing chimeric antigen receptor of targeted guanylate cyclase 2C.
In a second aspect, the application provides a nucleic acid molecule comprising a gene encoding the anti-GUCY2C nanobody according to the first aspect.
In a third aspect, the application provides a chimeric antigen receptor comprising a signal peptide, an antigen binding domain comprising a nanobody of guanylate cyclase 2C according to the first aspect, a hinge region, a transmembrane region and a signal transduction domain.
Preferably, the signal peptide comprises a CD8 a signal peptide.
Preferably, the hinge region comprises a CD8 a hinge region.
Preferably, the transmembrane region comprises any one or a combination of at least two of a CD8 a transmembrane region, a CD28 transmembrane region or a DAP10 transmembrane region.
Preferably, the signal transduction domain comprises an immunoreceptor tyrosine activation motif (cd3ζ).
Preferably, the signal transduction domain further comprises a co-stimulatory molecule comprising any one or a combination of at least two of 4-1BB, the intracellular domain of CD28, OX40, ICOS or the intracellular domain of DAP 10.
Preferably, the chimeric antigen receptor comprises a CD8 a signal peptide, a nanobody against guanylate cyclase 2C according to the first aspect, a CD8 a hinge region, a CD8 a transmembrane region and an immune receptor tyrosine activation motif.
In a fourth aspect, the present application provides an expression vector comprising a gene encoding the chimeric antigen receptor of the third aspect.
Preferably, the expression vector is any one of a lentiviral vector, a retroviral vector or an adeno-associated viral vector comprising a gene encoding the chimeric antigen receptor according to the third aspect, preferably a lentiviral vector.
In a fifth aspect, the present application provides a recombinant lentivirus comprising the expression vector of the fourth aspect.
Preferably, the recombinant lentivirus is prepared from mammalian cells transfected with the expression vector and helper plasmid of the fourth aspect.
In a sixth aspect, the present application provides a chimeric antigen receptor immune cell expressing the chimeric antigen receptor of the third aspect.
Preferably, the chimeric antigen receptor immune cell comprises the expression vector of the fourth aspect and/or the recombinant lentivirus of the fifth aspect.
Preferably, the chimeric antigen receptor immune cells comprise any one or a combination of at least two of T cells, B cells, NK cells, mast cells or macrophages.
In a seventh aspect, the application provides a pharmaceutical composition comprising a chimeric antigen receptor immune cell according to the sixth aspect and/or a nanobody according to the first aspect.
Preferably, the pharmaceutical composition further comprises pharmaceutically acceptable excipients.
Preferably, the auxiliary materials comprise any one or a combination of at least two of carriers, surfactants, disintegrants, coating materials, excipients, solubilizers, diluents, pH regulators, binders, wetting agents, colorants, emulsifiers, bacteriostats, cosolvents, osmotic pressure regulators, fillers, antioxidants or buffers.
In an eighth aspect, the application provides the use of the nanobody against guanylate cyclase 2C according to the first aspect, the nucleic acid molecule according to the second aspect, the chimeric antigen receptor according to the third aspect, the expression vector according to the fourth aspect, the recombinant lentivirus according to the fifth aspect, the chimeric antigen receptor immune cell according to the sixth aspect or the pharmaceutical composition according to the seventh aspect in the preparation of a medicament for treating a tumor.
Preferably, the tumor comprises a guanylate cyclase 2C expressing tumor.
Compared with the prior art, the application has at least the following beneficial effects:
(1) According to the application, the non-immunized alpaca is immunized by using the GUCY2C recombinant protein, a phage display nanobody library is constructed, the anti-GUCY2C antibody is screened according to the phage display nanobody library, the obtained nanobody can specifically bind to the GUCY2C antigen and has better affinity, and the KD (M) is respectively 2.75X10 as shown by the determination of the affinity of the antibody -11 、1.80×10 -8 、1.26×10 -8 、1.09×10 -8 、2.08×10 -8 、5.20×10 -8 And 1.82×10 -8 ;
(2) The nanometer antibody for resisting GUCY2C provided by the application has better affinity, is used as an antigen binding domain to construct a chimeric antigen receptor, and is used for preparing T cells, wherein the CAR-T cells have killing activity on GUCY2C positive tumor cells, and after being co-cultured with the GUCY2C positive cells, the nanometer antibody can efficiently secrete cell factor IFN-gamma, can be effectively applied to immunotherapy, and has important significance for developing tumor therapeutic drugs.
Drawings
FIG. 1A is a graph showing the affinity of Biacore for detection of anti-GUCY2C nanobody VHH-A1 in example 2;
FIG. 1B is a graph showing the affinity of the anti-GUCY2C nanobody VHH-A2 detected by Biacore in example 2;
FIG. 1C is a graph showing the affinity of the anti-GUCY2C nanobody VHH-A3 detected by Biacore in example 2;
FIG. 1D is a graph showing the affinity of Biacore for detection of anti-GUCY2C nanobody VHH-14 in example 2;
FIG. 1E is a graph showing the affinity of the anti-GUCY2C nanobody VHH-29 detected by Biacore in example 2;
FIG. 1F is a graph showing the affinity of anti-GUCY2C nanobody VHH-36 detected by Biacore in example 2;
FIG. 1G is a graph showing the affinity of anti-GUCY2C nanobody VHH-43 detected by Biacore in example 2;
FIG. 2 is a graph showing the results of FACS detection of GUCY2C antigen by anti-GUCY2C nanobodies in example 3;
FIG. 3 is a map of a chimeric antigen receptor lentiviral vector targeting GUCY2C in example 4;
FIG. 4 is a schematic representation of the chimeric antigen receptor structure expressing GUCY2C in example 4;
FIG. 5 is a graph showing the results of flow assay of the expression rate of chimeric antigen receptor of T lymphocytes in example 6;
FIG. 6 is a graph of the killing effect of CAR-T cells on 293T cells as described in example 7;
FIG. 7 is a graph showing the killing effect of CAR-T cells on colon cancer cells Colo205-GUCY2C in example 7;
FIG. 8 is a graph showing the killing effect of CAR-T cells on colon cancer cells SW620-GUCY2C in example 7;
FIG. 9 is a bar graph of IFNγ secretion by CAR-T cells in example 8.
Detailed Description
The technical means adopted by the application and the effects thereof are further described below with reference to the examples and the attached drawings. It is to be understood that the specific embodiments described herein are merely illustrative of the application and are not limiting thereof.
The specific techniques or conditions are not identified in the examples and are described in the literature in this field or are carried out in accordance with the product specifications. The reagents or apparatus used were conventional products commercially available through regular channels, with no manufacturer noted.
Example 1
In this example, phage nanobody libraries were constructed and panning were performed and primary screening was performed using ELISA, as follows:
(1) Construction of phage nanobody library
Immunizing alpaca with GUCY2C (GUCY 2C) extracellular recombinant protein, detecting serum titer by ELISA, and extracting peripheral blood; separating lymphocytes, extracting total RNA, performing reverse transcription to obtain cDNA, and amplifying VHH genes by nested PCR; VHH gene was inserted into pShort phagemid and electrotransformedSeparating and purifying the phage by PEG8000/NaCI precipitation method after the competent cells are amplified to obtain an antibody library; adjusting concentration, packaging, and freezing in refrigerator at-80deg.C;
(2) Screening of phage nanobody libraries
Firstly, incubating 293T cells with an antibody library for negative screening, and then incubating supernatant with 293T-GUCY2C cells (GUCY 2C positive) and 293T cells respectively; washing for 4 times by adopting a pre-cooled PT buffer solution at 4 ℃; infecting NEBalpha5F' cells, adding helper phage, and culturing overnight; coating a plate by a Drop method, and counting the enrichment degree the next day; separating and purifying the phage by PEG8000/NaCI precipitation method, and then carrying out the next round of screening; after enrichment, the VHH region was amplified using the obtained phage as a template, and subjected to second generation sequencing to obtain 7 anti-GUCY2C nanobodies, the amino acid sequences of which were respectively designated as VHH-A1, VHH-A2, VHH-A3, VHH-14, VHH-29, VHH-36 and VHH-43, as shown in SE1 ID No.28, SE1 ID No.29, SE1 ID No.30, SE1 ID No.31, SE1 ID No.32, SE1 ID No.33 and SE1 ID No. 34.
Example 2
The present example performs VHHFc nanobody expression, purification, and antibody affinity assay.
The various antibodies that met the conditions were screened for a total of seven candidate antibodies designated VHH-A1, VHH-A2, VHH-A3, VHH-14, VHH-29, VHH-36 and VHH-43. To further identify these antibodies, we constructed recombinant VHH antibodies with mouseFc tags (which were done by a third party) and the antibody quality test results obtained are shown in table 1.
TABLE 1
The above 7 GUCY2CVHH antibodies were subjected to affinity measurement by Biacore. Biacore is a bioanalytical sensing technology developed based on surface plasmon resonance (surface Plasmon resonance, SPR), and can detect and track the whole change process of binding and dissociating molecules in a solution and molecules fixed on the surface of a chip, record the whole change process in the form of a sensor graph, provide kinetic and affinity data, solidify antibodies on the surface of the chip in the measuring process, enable a mobile phase to be a solution containing antigens, and enable the affinity of 7 antibodies to reach sub-nanomolar levels as shown in a table 2 and a graph 1A-1G, wherein the affinities of the 7 antibodies are respectively 2.75 xE-11, 1.80 xE-8, 1.26 xE-8, 1.09 xE-8, 2.08 xE-8, 5.20 xE-8 and 1.82 xE-8.
TABLE 2
Nanobody | Ka(1/Ms) | Kd(1/s) | KD(M) |
VHH-A1(SEQ ID NO.28) | 4.63E+04 | 1.27E-06 | 2.75E-11 |
VHH-A2(SEQ ID NO.29) | 1.31E+05 | 2.36E-03 | 1.80E-8 |
VHH-A3(SEQ ID NO.30) | 1.44E+05 | 1.83E-03 | 1.26E-8 |
VHH-14(SEQ ID NO.31) | 1.30E+05 | 1.41E-03 | 1.09E-8 |
VHH-29(SEQ ID NO.32) | 1.32E+05 | 2.74E-03 | 2.08E-8 |
VHH-36(SEQ ID NO.33) | 1.16E+05 | 6.04E-04 | 5.20E-9 |
VHH-43(SEQ ID NO.34) | 1.38E+05 | 2.50E-03 | 1.82E-8 |
Example 3
This example describes a flow assay for the nanobodies of example anti-GUCY 2C.
Jurkat (GUCY 2C-), jurkat-GUCY2C cells were mixed with purified anti-GUCY2C nanobodies, incubated for 30min in an ice bath, then incubated with APC-labeled goat anti-mouse IgG antibodies for 30min, and detected by flow cytometry, as shown in FIG. 2, indicating that the anti-GUCY2C nanobodies of the application recognize GUCY2C antigens on the cell surface.
Example 4
This example prepares lentiviral vectors expressing a chimeric antigen receptor targeting GUCY2C (GUCY 2C CAR).
First, a lentiviral vector pSIN03 GUCY2C CAR carrying a GUCY2C CAR chimeric antigen receptor was constructed, the vector map is shown in FIG. 3, and the schematic of the chimeric antigen receptor is shown in FIG. 4, comprising a CD8 alpha signal peptide, a nanobody against GUCY2C (anti-GUCY 2C VHH), a CD8 alpha hinge region, a transmembrane region and an immunoreceptor tyrosine activation motif (CD 3 zeta).
Wherein the amino acid sequence of the signal peptide (SEQ ID NO. 35) is:
MALPVTALLLPLALLLHAARP。
the amino acid sequence of the anti-GUCY2C VHH is shown in SEQ ID NO.28, SEQ ID NO.29, SEQ ID NO.30, SEQ ID NO.31, SEQ ID NO.32, SEQ ID NO.33 or SEQ ID NO. 34.
The amino acid sequences of the CD 8. Alpha. Hinge region and the transmembrane region (SEQ ID NO. 36) are:
TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC。
the amino acid sequence of the 4-1BB intracellular region (SEQ ID NO. 37) is:
KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL。
the CD3 zeta amino acid sequence (SEQ ID NO. 38) is:
RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR。
the preparation method comprises the following steps:
(1) A PCR reaction system was prepared according to table 3 (reagents in table were derived from TOYOBO inc.), nanobody fragments of each anti-GUCY2C were amplified, and the reaction was performed according to the PCR procedure shown in table 4, with primer sequences:
GU-A1-F(SEQ ID NO.39):
ctgccgctggccttgctgctccacgccgccaggccgcaggtcaaactcgtcc。
GU-A3-F(SEQ ID NO.40):
ctgccgctggccttgctgctccacgccgccaggccggaggtgaagttggtgg。
GU-36-F(SEQ ID NO.41):
ctgccgctggccttgctgctccacgccgccaggccgcaggtccagctcgtcg。
GU-A1-R(SEQ ID NO.42):gcgctggcgtcgtggtgctggacactgtcact。
GU-A2-R(SEQ ID NO.43):gcgctggcgtcgtggtggagctgacggtcacc。
GU-A3-R(SEQ ID NO.44):gcgctggcgtcgtggtggtggacacggtgacc。
GU-14-R(SEQ ID NO.45):gcgctggcgtcgtggtggaggacacggtcacc。
GU-29-R(SEQ ID NO.46):gcgctggcgtcgtggtgctggacacggtcacc。
GU-36-R(SEQ ID NO.47):gcgctggcgtcgtggtgctagacacggtcacc。
GU-43-R(SEQ ID NO.48):gcgctggcgtcgtggtgctggagacggtcacc。
TABLE 3 Table 3
Reagent(s) | Volume (mu L) |
10×buffer | 5 |
2mM dNTP | 5 |
25mM MgSO 4 | 3 |
10 mu M upstream primer | 1 |
10 mu M downstream primer | 1 |
Template DNA (cDNA clone) | 1 |
Sterile deionized water (PCR grade water) | 33 |
KOD-Plus-Neo high-fidelity PCR enzyme | 1 |
TABLE 4 Table 4
(2) A PCR reaction system was prepared according to Table 5, and CD 8. Alpha. Signal peptide was added before the obtained amplified product, and the reaction was performed according to the PCR procedure shown in Table 4, using the primers:
BamH-CD8αsig-F(SEQ ID NO.49):
GCTGCAGGTCGACTCTAGAGGATCCCGCCACCATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGC。
CD8H-R(SEQ ID NO.50):GTCGCGGCGCTGGCGTCGTGGT。
TABLE 5
Reagent(s) | Volume (mu L) |
10×buffer | 5 |
2mM dNTP | 5 |
25mM MgSO 4 | 3 |
10 mu M upstream primer | 1 |
10 mu M downstream primer | 1 |
Template DNA (VHH fragment PCR reaction liquid) | 4 |
Sterile deionized water (PCR grade water) | 30 |
KOD-Plus-Neo high-fidelity PCR enzyme | 1 |
After the reaction is finished, the PCR product is subjected to 1% agarose gel electrophoresis, a 500bp fragment is recovered, and the quantity is fixed by an ultraviolet absorption method;
(3) A PCR reaction system was prepared according to Table 6, and after the completion of the preparation, a PCR reaction was performed according to the PCR procedure shown in Table 4 to amplify the CD 8. Alpha. Range-TM-41 BB-CD3Z fragment, using the primers as follows:
CD8αH-F(SEQ ID NO.51):ACCACGACGCCAGCGCCGCGAC。
Vector-R(SEQ ID NO.52):TCGATAAGCTTGATATCG。
TABLE 6
Reagent(s) | Volume (mu L) |
10×buffer | 5 |
2mM dNTP | 5 |
25mM MgSO 4 | 3 |
10 mu M upstream primer CD8 alpha H-F | 1 |
10 mu M downstream primer Vector-R | 1 |
Template DNA (HD CD19 CAR) | 1 |
Sterile deionized water (PCR grade water) | 33 |
KOD-Plus-Neo high-fidelity PCR enzyme | 1 |
After the PCR is finished, 1% agarose gel electrophoresis is carried out, fragments about 680bp are recovered, and the quantification is carried out by an ultraviolet absorption method;
(4) Carrying out BamHI and EcoRI double digestion on 5 μg of HD SIN03 CD19 CAR plasmid constructed in a laboratory, and recovering the vector after water bath reaction for 1h at 37 ℃;
the 3 fragments recovered above and the vector backbone were linked by recombinase, the recombination reaction system is shown in Table 7, and after completion of the preparation, the mixture was subjected to a water bath reaction at 37℃for 0.5h, and transformed into E.coli stbl3 competent cells by a conventional method.
TABLE 7
Reagent(s) | Usage amount |
HD CD19 CAR skeleton | 154.2ng |
CD8αsingal GUCY2C VHH | 10ng |
CD8αhinge-TM-41BB-CD3Z | 14ng |
5×CE buffer | 2μL |
Exnase TM II | 1.2μL |
Sterile deionized water (PCR grade water) | Make up to 12 mu L |
And selecting a monoclonal from the solid culture medium, culturing overnight, carrying out PCR identification, preparing a PCR reaction system as shown in table 8, carrying out a PCR procedure as shown in table 9, selecting a positive clone after the PCR is finished, and further carrying out sequencing identification, wherein the sequencing result meets the expectations. The primer sequences were as follows:
LV-F2(SEQ ID NO.53):TCTTGGTTCATTCTCAAGCCTC。
LV-R(SEQ ID NO.54):GCAACATAGTTAAGAATACC。
TABLE 8
Reagent(s) | Volume (mu L) |
Taq PCR Master Mix | 10 |
10μM F LV-F2 | 1 |
10μM R LV-R | 1 |
Template DNA bacterial liquid | 1 |
Sterile deionized water (PCR grade water) | 7 |
TABLE 9
Example 5
In this example, lentiviral vector HDSIN03-GUCY2CCAR prepared in example 4 was subjected to lentiviral packaging, concentration and titer detection, comprising the steps of:
(1) Lentivirus package
At 6.0X10 6 Cell count 293T cells were seeded in 10cm dishes at 37℃with 5% CO 2 The virus is prepared for packaging after overnight culture, and the culture medium is DMEM containing 10% of fetal calf serum; 5.4 mu g of HD SIN03-GUCY2C CAR, 6.2 mu g of helper plasmid pMDLg-RRE, 6.2 mu g of helper plasmid pRSV-REV and 2.4 mu g of envelope plasmid VSVg of lentiviral vector are dissolved in 0.8mL of serum-free DMEM culture solution and evenly mixed;
60.6. Mu.g PEI (1. Mu.g/. Mu.L) was dissolved in 0.8mL serum-free DMEM medium and vortexed at 1000rpm for 5 seconds and incubated at 25℃for 5min; adding PEI mixed solution into the DNA mixed solution, gently mixing after adding, and incubating at 25 ℃ for 25min to form a transfection complex; 1.6mL of the transfection complex is added into 10mL of DMEM medium containing 293T cells in a dropwise manner, and after 6 hours, the fresh medium is replaced; after 48 hours, collecting the virus liquid supernatant;
(2) Lentivirus concentration
Filtering the virus supernatant with a 0.45 μm filter membrane, collecting the filtered virus supernatant into a 50mL centrifuge tube, adding 1/4 PEG-NaCl virus concentrate, mixing the mixture upside down, and standing the mixture at 4 ℃ overnight; centrifuging at 4 ℃ at 3500 rpm for 30min; removing supernatant, adding RPMI 1640 medium (containing 10% FBS), and dissolving the resuspended viral pellet; split charging 50 μl of the concentrated lentiviral suspension into each portion, storing in a finished tube, and storing at-80deg.C;
(3) Lentivirus titer detection
mu.L Jurkat cells (2X 10) 5 Individual cells) were inoculated into 24-well plates, and the concentrated lentiviruses were added to the cell suspension in volumes of 1. Mu.L, 0.2. Mu.L and 0.04. Mu.L, respectively, and polybrene was added to a final concentration of 8. Mu.g/mL, 37℃at 5% CO 2 After overnight incubation, fresh medium was changed;
after 72h infection, 500 Xg was centrifuged for 5min, the supernatant was discarded to collect cells, 100. Mu.L PBS+2% FBS was added to resuspend the cells, 0.5. Mu.g of Rabbit Anti-Camelid VHH Antibody (iFluor 488) antibody was added and incubated on ice for 30min; after washing 1 time with streaming buffer (PBS containing 2% FBS), 300. Mu.L of streaming buffer was added to resuspend cells, and the infection efficiency was measured by flow cytometry; the titer was calculated as follows: titer (TU/mL) =number of cells x positive rate/virus volume (mL).
Example 6
Construction of overexpressing cell lines
GUCY2C-GFP lentiviruses were obtained by cotransfection of GUCY2C-GFP plasmid (purchased from Crohn's disease), pMGlg-RRE, pRSV-REV and VSVg plasmid, in the same manner as in example 5;
taking 1×10 pieces respectively 6 293T cells (stored by the company), jurkat cells (stored by the company), SW620 cells (purchased from the cell bank of the department of Chinese sciences), and colo205 cells (purchased from ATCC) were inoculated into a 6-well plate, and 1mL of the above-obtained GUCY2C-GFP lentivirus was added to thereby obtain Jurkat-GUCY2C, SW620-GUCY2C, colo-GUCY 2C over-expressing the GUCY2C protein.
Example 7
This example uses lentivirus transduced T lymphocytes prepared in example 5, comprising the steps of:
(1) Human PBMC were conditioned to a density of 1X 10 with T cell culture medium (X-VIVO+10% FBS+300U/mLIL-2) 6 1/100 volume of tcelltranact (magnetic beads commercially available to couple CD3 and CD 28) was added to activate for 24h;
(2) The activated T cells were collected and the cell density was adjusted to 1X 10 6 Per mL, according to the multiplicity of infection (multiplicityof infecti)on, MOI) of 10 lentivirus, polybrene was added to a final concentration of 8. Mu.g/mL; at 37℃with 5% CO 2 Replacing fresh culture medium after overnight culture in the environment, and carrying out passage every 3 days;
(3) 5 days after T cell infection, 3X 10 cells were taken 5 Centrifuging at 4 ℃ for 5min at 500g, discarding the supernatant, and washing once with streaming buffer; add 50. Mu.L buffer to resuspend cells, add 0.5. Mu.g Rabbit antibody-CamellidVHH hanntibody (iFluor 488) and incubate on ice for 30min; after washing 1 time with buffer solution, 300. Mu.L of buffer solution is added to resuspend the cells;
the expression rate of chimeric antigen receptor of T lymphocytes was measured by flow cytometry, and as a result, as shown in fig. 5, the infection efficiency of each group of CAR-T cells was: 71.6%, 44.1%, 63.9%, 43.3%, 52.3%, 59.9%, and 40.7%, indicating successful construction of CAR-T cells.
Example 8
In this example, an in vitro toxicity test of CAR-T cells was performed, comprising the steps of:
(1) Target cell inoculation
293-GPF-luci (GUCY 2C - ) Colo205-GUCY2C-luci and SW620-GUCY2C-luci as target cells, and adjusting the concentration of the target cells to 1X 10 5 100. Mu.L of the solution is inoculated into a 96-well plate;
(2) Effector cell seeding
GUCY2CCAR-T and control T cells are effector cells, and CAR-T cells and control T cells are added into a 96-well plate according to the effective target ratio of 0.3:1, 1:1 and 3:1;
(3) Each group was set with 3 duplicate wells and the average of 3 duplicate wells was taken, wherein each experimental group and each control group were as follows:
experimental group: specific killing group (effector cell + target cell), non-specific killing control group (effector cell + non-specific target cell);
control group: effector cells alone in culture, target cells and medium in natural and maximum release groups;
(4) After 18h co-culture of effector cells with target cells, 20 μl of lysate (10×) was added to the wells of the labeled maximum release group; the cell lysis condition is not observed regularly, so that the cell lysis is ensured to be complete;
(5) After blowing and sucking each hole by a row gun for 8 times, centrifuging 500g for 5min, and taking 50 mu L/hole supernatant into an ELISA plate;
(6) The detection method comprises the following steps: the prepared substrate was added to the ELISA plate at a concentration of 50. Mu.L/well, the plate was covered, incubated at room temperature for 30min in the absence of light, 50. Mu.L of stop solution (acetic acid) was added to each well, and absorbance at 490nm was measured within 30 min.
(7) The CAR-T killing efficiency calculation formula is as follows:
specific killing rate (%) = (experimental hole LDH value-natural release hole LDH value)/(maximum release hole LDH value-natural release LDH value).
The results are shown in figures 6-8, the CAR-T cells constructed by the application have no killing effect on GUCY2C negative 293T cells and have killing activity on GUCY2C positive tumor cells, and the CAR-T cells constructed by the application have high-efficiency tumor killing capacity and high specificity.
Example 9
In this example, the secretion of IFN-. Gamma.by CAR-T cytokines was detected using the respective kit HumanIFN-. Gamma.ELISAkit (Bigella, cat. Number: EK 180-96).
1. Cell culture supernatant
Cell cultures with an effective target ratio of 1:1 were centrifuged at 400 Xg for 10min to remove sediment, and the supernatant was stored at-80℃for examination.
2. Reagent preparation
All reagents, samples were returned to 25℃before testing, and if crystallization occurred in the concentrated reagents, the incubation was performed at 37℃until the crystals were completely dissolved, and 1 Xof wash solution and 1 Xof assay buffer were prepared according to the instructions of use.
3. Standard substance and sample preparation
Standard substance: standard stock was 2-fold diluted with 5%1640 medium for a total of 8 dilution gradients, including zero concentration.
Sample: samples were diluted in ratio using 5%1640 medium.
4. Detection step
(1) Soaking the ELISA plate: adding 300 mu L of 1 Xwashing liquid, standing and soaking for 30s, discarding the washing liquid, and beating the micro-pore plate on water-absorbing paper;
(2) Adding a standard substance: adding 100 mu L of standard substance diluted by 2 times ratio into a standard substance hole, and adding 100 mu L of standard substance diluent into a blank hole;
(3) Adding a sample: adding 100 mu L of cell culture supernatant into the sample hole;
(4) Adding a detection antibody: 50. Mu.L of diluted detection antibody (1:100 dilution) was added to each well;
(5) Incubation: sealing plates by using sealing plates, vibrating at 300rpm, and incubating at 25 ℃ for 2 hours;
(6) Washing: removing liquid, adding 300 mu L of washing liquid into each hole to wash the plate for 6 times, washing the plate each time, and beating the plate on absorbent paper;
(7) And (3) enzyme adding and incubation: mu.L of diluted horseradish peroxidase-labeled streptavidin (1:100 dilution) was added to each well;
(8) Incubation: using a new sealing plate membrane sealing plate, oscillating at 300rpm, incubating at 25 ℃ for 45min, and washing;
(9) And (3) color development of the substrate: 100 mu L of chromogenic substrate TMB is added into each hole, and incubated for 20min at 25 ℃ in the dark;
(10) Adding a stop solution: 100 mu L of stop solution is added to each well;
(11) Detecting and reading: within 30min, performing dual-wavelength detection by using an enzyme-labeled instrument, and measuring the OD value at the maximum absorption wavelength of 450nm and the reference wavelength; the OD value after calibration was 450nm minus the measurement at the reference wavelength.
The IFN-gamma factor secretion results are shown in FIG. 9, respectively, wherein spontaneous MOCK groups are independent CAR-T cell groups, and cytokine release is not basically detected; no cytokines were detected in the CAR-T cell co-cultured group with 293T cells; after co-culture with target cells that overexpress GUCY2C, the IFN-gamma secreted by the CAR-T cells exceeds 600pg/mL. The CAR-T cells constructed by the application release cytokines to GUCY2C positive tumor cells, and have no obvious cytokine secretion to GUCY2C negative cells.
In conclusion, the nano antibody with high affinity for resisting GUCY2C can be screened and prepared, can be combined with GUCY2C in a high-efficiency mode, is used as an antigen binding domain to construct a chimeric antigen receptor and CAR-T cells, and the obtained CAR-T cells have obvious killing activity and specificity on GUCY2C positive tumor cells and can secrete cytokines for killing tumors, so that the nano antibody can be effectively applied to immunotherapy, and has important significance in developing tumor therapeutic drugs.
The applicant states that the detailed method of the present application is illustrated by the above examples, but the present application is not limited to the detailed method described above, i.e. it does not mean that the present application must be practiced in dependence upon the detailed method described above. It should be apparent to those skilled in the art that any modification of the present application, equivalent substitution of raw materials for the product of the present application, addition of auxiliary components, selection of specific modes, etc., falls within the scope of the present application and the scope of disclosure.
Claims (10)
1. The nanometer antibody for resisting guanylate cyclase 2C is characterized in that the amino acid sequence of CDR1 of the nanometer antibody is a sequence shown as SEQ ID NO. 1;
the amino acid sequence of CDR2 of the nano antibody is the sequence shown in SEQ ID NO. 4;
the amino acid sequence of the CDR3 of the nano antibody is shown as SEQ ID NO. 11.
2. A nucleic acid molecule comprising a gene encoding the nanobody of guanylate cyclase 2C according to claim 1.
3. A chimeric antigen receptor, wherein the chimeric antigen receptor comprises a signal peptide, an antigen binding domain, a hinge region, a transmembrane region, and a signal transduction domain;
the antigen binding domain comprises the nanobody of anti-guanylate cyclase 2C of claim 1.
4. The chimeric antigen receptor according to claim 3, wherein the signal peptide comprises a CD8 a signal peptide;
preferably, the hinge region comprises a CD8 a hinge region;
preferably, the transmembrane region comprises any one or a combination of at least two of a CD8 a transmembrane region, a CD28 transmembrane region or a DAP10 transmembrane region;
preferably, the signal transduction domain comprises an immunoreceptor tyrosine activation motif;
preferably, the signal transduction domain further comprises a co-stimulatory molecule comprising any one or a combination of at least two of 4-1BB, the intracellular domain of CD28, OX40, ICOS or the intracellular domain of DAP 10;
preferably, the chimeric antigen receptor comprises a CD8 a signal peptide, the nanobody of anti-guanylate cyclase 2C of claim 1, a CD8 a hinge region, a CD8 a transmembrane region, and an immunoreceptor tyrosine activation motif.
5. An expression vector comprising a gene encoding the chimeric antigen receptor of claim 3 or 4;
preferably, the expression vector is any one of a lentiviral vector, a retroviral vector or an adeno-associated viral vector comprising a gene encoding the chimeric antigen receptor according to claim 3 or4, preferably a lentiviral vector.
6. A recombinant lentivirus comprising the expression vector of claim 5.
7. A chimeric antigen receptor immune cell, wherein the chimeric antigen receptor immune cell expresses the chimeric antigen receptor of claim 3 or 4;
preferably, the chimeric antigen receptor immune cell comprises the expression vector of claim 5 and/or the recombinant lentivirus of claim 6;
preferably, the chimeric antigen receptor immune cells comprise any one or a combination of at least two of T cells, B cells, NK cells, mast cells or macrophages.
8. A pharmaceutical composition comprising the chimeric antigen receptor immune cell of claim 7 and/or the nanobody of anti-guanylate cyclase 2C of claim 1;
preferably, the pharmaceutical composition further comprises pharmaceutically acceptable excipients;
preferably, the auxiliary materials comprise any one or a combination of at least two of carriers, surfactants, disintegrants, coating materials, excipients, solubilizers, diluents, pH regulators, binders, wetting agents, colorants, emulsifiers, bacteriostats, cosolvents, osmotic pressure regulators, fillers, antioxidants or buffers.
9. Use of the nanobody against guanylate cyclase 2C according to claim 1, the nucleic acid molecule according to claim 2, the chimeric antigen receptor according to claim 3 or4, the expression vector according to claim 5, the recombinant lentivirus according to claim 6, the chimeric antigen receptor immune cell according to claim 7 or the pharmaceutical composition according to claim 8 for the preparation of a medicament for the treatment of tumors.
10. The use according to claim 9, wherein the tumour comprises a tumour expressing guanylate cyclase 2C.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310749124.9A CN116751303B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310749124.9A CN116751303B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
CN202211582937.5A CN115894697B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211582937.5A Division CN115894697B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN116751303A true CN116751303A (en) | 2023-09-15 |
CN116751303B CN116751303B (en) | 2023-12-26 |
Family
ID=86477891
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211582937.5A Active CN115894697B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
CN202310749124.9A Active CN116751303B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
CN202310749079.7A Pending CN116874602A (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211582937.5A Active CN115894697B (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310749079.7A Pending CN116874602A (en) | 2022-12-09 | 2022-12-09 | Nanometer antibody for resisting guanylate cyclase 2C and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (3) | CN115894697B (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN116574187B (en) * | 2023-07-07 | 2024-03-08 | 浙江时迈药业有限公司 | Antibodies against GUCY2C and uses thereof |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112004552A (en) * | 2018-03-16 | 2020-11-27 | 托马斯杰斐逊大学 | anti-GUCY 2C chimeric antigen receptor compositions and methods |
EP3763737A1 (en) * | 2019-07-12 | 2021-01-13 | Eberhard Karls Universität Tübingen | Binding compounds of penicillin binding protein 2 a |
CN112480258A (en) * | 2020-12-11 | 2021-03-12 | 华道(上海)生物医药有限公司 | anti-CD123 nano antibody and application thereof |
JP2021525080A (en) * | 2018-05-23 | 2021-09-24 | ファイザー・インク | GUCY2c-specific antibodies and their use |
WO2022127871A1 (en) * | 2020-12-17 | 2022-06-23 | Parasol Biotech Ltd. | Gucy2c binding molecules and uses thereof |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2000224986A (en) * | 1999-02-03 | 2000-08-15 | Shingo Tsuyama | Monoclonal antibody peculiar to soluble guanylate cyclase |
MA47685A (en) * | 2017-03-02 | 2020-01-08 | Univ Amsterdam | SPECIFIC INCREASE IN DOPAMINE SYNTHESIS BY TARGETING GUANYLATE CYCLASE 2C RECEPTOR IN THE TREATMENT OF PARKINSON'S DISEASE |
EP3892720A1 (en) * | 2020-04-06 | 2021-10-13 | Innovative Cellular Therapeutics Holdings, Ltd. | Presenting cell and use thereof in cell therapy |
WO2021205325A1 (en) * | 2020-04-08 | 2021-10-14 | Pfizer Inc. | Anti-gucy2c antibodies and uses thereof |
TW202237639A (en) * | 2020-12-09 | 2022-10-01 | 日商武田藥品工業股份有限公司 | Compositions of guanylyl cyclase c (gcc) antigen binding agents and methods of use thereof |
TW202237638A (en) * | 2020-12-09 | 2022-10-01 | 日商武田藥品工業股份有限公司 | Compositions of guanylyl cyclase c (gcc) antigen binding agents and methods of use thereof |
-
2022
- 2022-12-09 CN CN202211582937.5A patent/CN115894697B/en active Active
- 2022-12-09 CN CN202310749124.9A patent/CN116751303B/en active Active
- 2022-12-09 CN CN202310749079.7A patent/CN116874602A/en active Pending
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112004552A (en) * | 2018-03-16 | 2020-11-27 | 托马斯杰斐逊大学 | anti-GUCY 2C chimeric antigen receptor compositions and methods |
JP2021525080A (en) * | 2018-05-23 | 2021-09-24 | ファイザー・インク | GUCY2c-specific antibodies and their use |
EP3763737A1 (en) * | 2019-07-12 | 2021-01-13 | Eberhard Karls Universität Tübingen | Binding compounds of penicillin binding protein 2 a |
CN112480258A (en) * | 2020-12-11 | 2021-03-12 | 华道(上海)生物医药有限公司 | anti-CD123 nano antibody and application thereof |
WO2022127871A1 (en) * | 2020-12-17 | 2022-06-23 | Parasol Biotech Ltd. | Gucy2c binding molecules and uses thereof |
Non-Patent Citations (2)
Title |
---|
ADAM E SNOOK等: "GUCY2C-targeted cancer immunotherapy: past, present and future", 《IMMUNOL RES》, vol. 51, no. 2, pages 161 - 169, XP019990822, DOI: 10.1007/s12026-011-8253-7 * |
姚镇东等: "鸟苷酸环化酶C在结直肠癌诊治中的研究进展", 《胃肠病学》, vol. 21, no. 10, pages 626 - 628 * |
Also Published As
Publication number | Publication date |
---|---|
CN116874602A (en) | 2023-10-13 |
CN116751303B (en) | 2023-12-26 |
CN115894697B (en) | 2023-08-29 |
CN115894697A (en) | 2023-04-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN109942709B (en) | anti-BCMA single domain antibody and application thereof | |
CN116063531B (en) | Anti-mesothelin nano antibody with high affinity and application thereof | |
WO2022033057A1 (en) | Single-domain antibody-based bcma chimeric antigen receptor, and application thereof | |
CN116751303B (en) | Nanometer antibody for resisting guanylate cyclase 2C and application thereof | |
CN110713539B (en) | Anti-carcinoembryonic antigen antibody and preparation method and application thereof | |
CN110655581B (en) | Anti-carcinoembryonic antigen antibody and preparation method and application thereof | |
CN110862456B (en) | Anti-carcinoembryonic antigen antibody and preparation method and application thereof | |
CN114149506B (en) | anti-CD 22 antibody and application thereof | |
CN116589585B (en) | anti-IL13Ra2 nano antibody and application thereof | |
CN116041519A (en) | anti-DLL 3 nanobody, related product and application | |
CN112979808B (en) | Antibody for resisting B cell mature antigen and application thereof | |
CN116253800B (en) | Heavy chain antibody against CLDN18.2, related products and uses | |
CN117025541A (en) | CAR-T cell targeting B7-H3 and co-expressing cytokines and chemokines and application thereof | |
CN116693688A (en) | anti-Intestinal protein OCI-5 antibody and application thereof | |
CN116675773A (en) | anti-MXR 7 antibody and application thereof | |
CN117586394A (en) | Monoclonal antibody combined with Dsg3 and application thereof | |
CN117551199A (en) | Preparation method and application of Claudin18.2 nano antibody | |
CN116574181A (en) | anti-Glypican 3 antibody and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |