CN110713539B

CN110713539B - Anti-carcinoembryonic antigen antibody and preparation method and application thereof

Info

Publication number: CN110713539B
Application number: CN201910899926.1A
Authority: CN
Inventors: 狄升蒙; 井洋洋; 陈鑫; 冯冬歌; 余学军
Original assignee: Huadao Shanghai Biological Medicine Co ltd
Current assignee: Huadao Shanghai Biological Medicine Co ltd
Priority date: 2019-09-23
Filing date: 2019-09-23
Publication date: 2021-04-16
Anticipated expiration: 2039-09-23
Also published as: CN110713539A

Abstract

The invention provides an anti-CEA antibody, which comprises a heavy chain variable region and a light chain variable region, wherein the complementarity determining region of the heavy chain variable region comprises CDR-H1 with an amino acid sequence shown as SEQ ID No.1, CDR-H2 with an amino acid sequence shown as SEQ ID No.2 and CDR-H3 with an amino acid sequence shown as SEQ ID No.3, and the complementarity determining region of the light chain variable region comprises CDR-L1 with an amino acid sequence shown as SEQ ID No.4, CDR-L2 with an amino acid sequence shown as SEQ ID No.5 and CDR-L3 with an amino acid sequence shown as SEQ ID No. 6. The inventor utilizes phage display technology to screen CEA scFv, thereby obtaining the high-affinity anti-CEA single-chain antibody. And the CEA-resistant chimeric antigen receptor gene is introduced into T cells by a genetic engineering method to prepare CEA CAR-T, so that the CEA CAR-T cells specifically recognize and kill the CEA-expressing digestive tract tumor cells, thereby realizing the anti-tumor effect of the CEA CAR-T cells.

Description

Anti-carcinoembryonic antigen antibody and preparation method and application thereof

Technical Field

The invention relates to the field of biotechnology, in particular to an anti-carcinoembryonic antigen antibody and a preparation method and application thereof.

Background

The concept of Chimeric antigen receptor modified T lymphocytes (CAR-T) was developed as early as 1989, but the ideal effect has not been achieved in clinical trials. Over the next two decades scientists have continually tried and optimized this until 2011, CD19(B lymphocyte antigen CD19, CD19) targeted CAR-T cells were used in clinical studies of relapsed/refractory chronic B-lymphocyte leukemia and achieved dramatic efficacy in the cure. To this end, the use of CAR-T cells for tumor therapy opens new sections.

The chimeric antigen receptor is an artificially synthesized fusion protein with a function similar to that of a T cell receptor, and mainly comprises a signal peptide, an antigen recognition region, a hinge region, a transmembrane region and an intracellular signal region. Upon binding to the target antigen, the chimeric antigen receptor forms a dimer, activates T cells by intracellular signaling molecules, secretes perforin and granzyme B, etc., to achieve killing of the target cells. Thus, CAR-T cells recognize target cells independently of MHC (MHC), thereby avoiding immune escape due to down-regulation of tumor cell MHC molecules.

In recent years, chimeric antigen modified T lymphocytes (CAR-T) have developed rapidly, and at present, two products are approved by FDA in the united states and are on the market, and many products are approved by clinical trials of drugs in China. The current CAR-T field is mostly researched by CD19, and is secondarily researched by BCMA (B-cell metastasis antigen, BCMA), wherein the former targets acute B lymphocyte leukemia, and the latter targets multiple myeloma, and the two are all malignant diseases of the blood system. However, the therapeutic effect of CAR-T cells is not ideal on solid tumors that account for more than 90% of all tumor types. This is due to several reasons, of which one important point is the lack of an ideal target antigen. As mentioned above, both CD19 and BCMA are specifically expressed in tumor cells, but have limited expression in normal tissues or on cells, and are therefore highly desirable therapeutic targets. In contrast, solid tumor specific targets are very lacking, and most targets are widely expressed in normal tissues in addition to being expressed on tumor cells. Therefore, the side effect of "On target, off tumor" brought by CAR-T cell therapy is very obvious.

The international cancer research center Globocan2012 pointed out that the incidence of tumor incidence and mortality increased, 3 of the most common 5 tumors in men were digestive system tumors (colorectal, gastric, liver), and 2 of the most common 5 tumors in women were digestive system tumors (colorectal, gastric) (Steward BW, et al, 2014). It can be seen that digestive system tumors occupy an important position worldwide. It has also been reported that the incidence of gastric cancer and colorectal cancer in China is second and fourth (Chenwanqing et al, 2017), respectively. The digestive system tumors mainly comprise esophageal cancer, gastric cancer, liver cancer, colorectal cancer, pancreatic cancer, bile duct cancer and the like, the most effective means at present is still operation, and patients lacking surgical indications have few particularly effective treatment means, and the 5-year survival rate is still very low on the whole, so that the development of novel treatment means for treating the tumors is urgently needed. CAR-T cells are undoubtedly one of the most promising means of curing digestive tumors.

Carcinoembryonic Antigen (CEA) was originally found in colon cancer and fetal intestinal tissue and was later shown to be present widely in digestive system tumors of endoderm origin. CEA is now considered to be a sensitive biomarker of gastrointestinal tumors (e.g., colorectal, pancreatic, gallbladder, etc.) and is widely expressed in cancer tissues and expressed in small amounts in cell membranes of normal epidermal cell luminal surfaces (Kinugasa, T, et al, 1998; Zhang, C.C, et al, 2017; Pishvaian, M, et al, 2016), an ideal target. Therefore, the CEA chimeric antigen receptor gene for resisting CEA is introduced into the CEA CAR-T prepared by the T cell through a genetic engineering method, so that the CEA CAR-T cell can specifically recognize and kill the digestive tract tumor cells expressing CEA, thereby realizing the anti-tumor effect of the CEA CAR-T cells.

Disclosure of Invention

In view of the above-mentioned disadvantages of the prior art, it is an object of the present invention to provide an anti-CEA antibody, a method for preparing the same, and use thereof, for solving the problems of the prior art.

To achieve the above and other related objects, the present invention provides an anti-CEA antibody comprising a heavy chain variable region and a light chain variable region, the anti-CEA antibody having one or more of the following technical features;

<1> the heavy chain variable region comprises CDR-H1 having an amino acid sequence shown in SEQ ID No. 1;

<2> the heavy chain variable region comprises CDR-H2 having an amino acid sequence shown in SEQ ID No. 2;

<3> the heavy chain variable region comprises CDR-H3 having an amino acid sequence shown in SEQ ID No. 3;

<4> the variable region of the light chain comprises CDR-L1 having the amino acid sequence shown in SEQ ID No. 4;

<5> the variable region of the light chain comprises CDR-L2 having an amino acid sequence shown in SEQ ID No. 5;

<6> the variable region of the light chain comprises CDR-L3 having an amino acid sequence shown in SEQ ID No. 6;

GFTFSSYAMS(SEQ ID No.1)

HISGSGGNTYYADSVKG(SEQ ID No.2)

SWGSSNYGTFDI(SEQ ID No.3)

RASQSVNNNFLG(SEQ ID No.4)

GASSRAT(SEQ ID No.5)

QQYGSSPLT(SEQ ID No.6)

a CDR (complementary determining region) generally refers to a region of an antibody that can sterically complement an antigenic determinant. The variability in antibodies is typically not evenly distributed throughout the variable region of the antibody, and the heavy and light chain variable regions of a monoclonal antibody typically each have 3 hypervariable regions (HVRs) which are generally complementary in spatial structure to antigenic determinants, so the hypervariable regions are also referred to as Complementarity Determining Regions (CDRs), i.e., the heavy chain variable region typically includes three complementarity determining regions, i.e., HCDR1, HCDR2 and HCDR3, and the light chain variable region typically includes three complementarity determining regions, i.e., LCDR1, LCDR2 and LCDR 3.

In certain embodiments of the invention, the complementarity determining region of the heavy chain variable region of the anti-CEA antibody comprises CDR-H1 having an amino acid sequence shown in SEQ ID No.1, CDR-H2 having an amino acid sequence shown in SEQ ID No.2, and CDR-H3 having an amino acid sequence shown in SEQ ID No. 3.

In certain embodiments of the present invention, the complementarity determining region of the light chain variable region of the anti-CEA antibody includes CDR-L1 having an amino acid sequence shown in SEQ ID No.4, CDR-L2 having an amino acid sequence shown in SEQ ID No.5, and CDR-L3 having an amino acid sequence shown in SEQ ID No. 6.

In certain embodiments of the present invention, the complementarity determining region of the heavy chain variable region comprises CDR-H1 having an amino acid sequence shown in SEQ ID No.1, CDR-H2 having an amino acid sequence shown in SEQ ID No.2, and CDR-H3 having an amino acid sequence shown in SEQ ID No.3, and the complementarity determining region of the light chain variable region comprises CDR-L1 having an amino acid sequence shown in SEQ ID No.4, CDR-L2 having an amino acid sequence shown in SEQ ID No.5, and CDR-L3 having an amino acid sequence shown in SEQ ID No. 6.

In certain embodiments of the invention, the anti-CEA antibody is a single chain antibody (scFv). Single chain antibodies may generally be V's comprising antibodies_H(variable region of heavy chain) and V_LPolypeptide chain of (light chain variable region). Generally, single chain antibodies may also include a linker peptide (linker), which is usually located at V_HAnd V_LSuch that the scFv forms the desired structure capable of binding to the antigen. For example, the anti-CEA antibody may comprise V_HAnd V_L，V_HAnd V_LCan be provided with a connecting peptide, and the single-chain anti-CEA antibody can sequentially comprise V from the N end to the C end_LLinker peptide and V_HThe anti-CEA single-chain antibody may also sequentially comprise V from N-terminus to C-terminus_HLinker peptide and V_L. The linker peptide can be any of a variety of linker peptides suitable for use in the art for forming scfvs, for example, the linker peptide can be G4S3 linker, which G4S3 linker can be selected or designed as described in Michel Sadelain et al, Science relative Medicine, 2013; jianne et c, Science relative Medicine, 2015.

In some embodiments of the present invention, the anti-CEA antibody is obtained by screening from a natural humanized phage antibody library, and the nucleotide sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID nos. 7 and 8, respectively, and the amino acid sequences of the heavy chain variable region and the light chain variable region are shown in SEQ ID nos. 9 and 10:

SEQ ID No.7

V_L:

gaaacgacactcacgcagtctccaggcaccctgtctttgtctccaggggaaagagccaccctctcctgcagggccagtcagagtgttaa caacaacttcttaggctggtaccagcagagagttggccaggctcccaggctcctcatctatggtgcatccagcagggccactggcatcccagac aggttcagtggcagtgggtctgggacagacttcactctcaccatcagcagactggagcctgaagattttgcagtgtattactgtcagcagtatggt agctcaccgctcactttcggcggagggaccaaggtggagatcaaa

SEQ ID No.8

V_H:

atggcccaggtgcagctgcaggagtcggggggaggctcggtacagcctggggggtccctgagactctcctgtgcagcctctggattca cctttagcagctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctcacatattagtggtagtggtggtaacacata ctacgcagactccgtgaagggccggttcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgagga cacggccgtatattactgtgcgaaaagttggggttcgagtaattatggtacttttgatatctggggccaagggacagtggtcaccgtctcttca

SEQ ID No.9：

V_L:

ETTLTQSPGTLSLSPGERATLSCRASQSVNNNFLGWYQQRVGQAPRLLIYGASSRATGI PDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPLTFGGGTKVEIK

SEQ ID No.10：

V_H:

MAQVQLQESGGGSVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSHISGSGGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSWGSSNYGTFDIWGQG TVVTVSS

(the underlined parts of SEQ ID No.9 and 10 are CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3 in that order)

In certain embodiments of the present invention, the heavy chain variable region and the light chain variable region may further comprise a framework region, and the framework region may be located between the complementarity determining regions or at both ends of the complementarity determining regions. In some embodiments of the invention, the sequence of the framework region is a human monoclonal antibody variable region, or a framework region sequence obtained by substituting, deleting or adding one or more (specifically, 1 to 50, 1 to 30, 1 to 20, 1 to 10, 1 to 5, or 1 to 3) amino acids to the sequence of the framework region of the murine monoclonal antibody variable region, and the sequence of the framework region may have a homology of 80%, 85%, 90%, 93%, 95%, 97%, or 99% or more with the sequence of the framework region of the human monoclonal antibody variable region.

In another aspect, the present invention provides an isolated polynucleotide encoding the heavy chain variable region and/or the light chain variable region or the full-length amino acid of the anti-CEA antibody.

In another aspect, the invention provides the use of the anti-CEA antibody in the preparation or screening of a therapeutic drug, or in the preparation of a diagnostic drug.

The therapeutic agent may be one that targets the CEA antigen, binds to, or acts on the CEA antigen, and thereby treats and/or prevents the indication.

In certain embodiments of the invention, the therapeutic agent may be a tumor therapeutic agent. The tumor treatment drug can be a drug which takes CEA antigen on the functional surface of the surface of tumor cells as a target, combines or acts on the CEA antigen, and thereby treats and/or prevents tumors. The tumor can be positive CEA expression tumor such as gastric cancer, lung cancer, esophageal cancer, intestinal cancer, pancreatic cancer and the like.

In certain embodiments of the invention, the therapeutic agent is a chimeric antigen receptor cell therapeutic agent.

The chimeric antigen receptor cell therapeutic agents typically include chimeric antigen receptor cells, which may be chimeric antigen receptor T cells, chimeric antigen receptor NK cells, and the like, which typically include T lymphocytes, which also include a chimeric antigen receptor. The chimeric antigen receptor NK cells typically include NK cells, which also include a chimeric antigen receptor. The chimeric antigen receptor includes a transmembrane domain, an intracellular domain, and an extracellular domain. In certain embodiments of the invention, the extracellular domain comprises the anti-CEA antibody, i.e., the chimeric antigen receptor cell can express the anti-CEA antibody on the cell surface, thereby directing the cell to act on cells expressing CEA antigen (e.g., tumor cells). The action on the cells expressing the CEA antigen may be killing of the cells expressing the CEA antigen, or the like.

The diagnosis medicament specifically refers to a reagent for diagnosing by taking a CEA antigen as a biomarker and acting on a target CEA antigen.

In another aspect, the invention provides an isolated polypeptide comprising a transmembrane domain, an intracellular domain and an extracellular domain, said extracellular domain comprising said anti-CEA antibody.

In certain embodiments of the invention, the polypeptide is a chimeric antigen receptor.

In certain embodiments of the invention, the transmembrane domain may comprise the transmembrane domain of a protein molecule such as CD8 α, CD28, DAP10, and the like. For example, the amino acid sequence of CD 8a may include the sequence shown below: IYIWAPLAGTCGVLLLSLVITLYC are provided.

For another example, the sequence of CD8 α can be referenced to NM _001145873, the sequence of CD28 can be referenced to NM _006139, and the sequence of DAP10 can be referenced to NM _ 014266.

In certain embodiments of the invention, the endodomain may include a costimulatory domain and/or a signaling domain, e.g., the endodomain may include the signaling domain of a 4-1BB, CD28, OX40, ICOS, CD3 zeta, DAP10, etc. protein molecule. As another example, the amino acid sequence of 4-1BB includes the following:

KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

the amino acid sequence of the CD3 zeta comprises the following:

RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQE GLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR。

for another example, the sequence of 4-1BB may refer to NM _001561, the sequence of CD28 may refer to NM _006139, the sequence of OX40 may refer to NM _003327, the sequence of ICOS may refer to NM _012092, the sequence of CD3 zeta may refer to NM _198053, and the sequence of DAP10 may refer to NM _ 014266. In one embodiment of the present invention, the endodomain comprises 4-1BB and CD3 zeta in sequence from N-terminus to C-terminus.

In certain embodiments of the invention, the polypeptide comprises the anti-CEA single chain antibody, transmembrane domain, intracellular domain in order from N-terminus to C-terminus. In some embodiments of the invention, the polypeptide comprises, in order from N-terminus to C-terminus, an anti-CEA single chain antibody, a CD 8a transmembrane region, a 4-1BB co-stimulatory domain, a CD3 zeta signaling domain. In a specific embodiment of the invention, the polypeptide comprises the anti-CEA single-chain antibody, a CD28 transmembrane region, a CD28 co-stimulatory domain, and a CD3 zeta signaling domain in sequence from N-terminus to C-terminus. In another embodiment of the invention, the polypeptide comprises the anti-CEA single chain antibody, CD 8a transmembrane region, OX40 co-stimulatory domain, CD3 zeta signaling domain in order from N-terminus to C-terminus. In another specific embodiment of the invention, the polypeptide comprises the anti-CEA single chain antibody, CD 8a transmembrane region, ICOS co-stimulatory domain, CD3 zeta signaling domain in order from N-terminus to C-terminus. In another specific embodiment of the invention, the polypeptide comprises the anti-CEA single-chain antibody, CD8 alpha transmembrane region, 4-1BB co-stimulatory domain, CD3 zeta from N-terminal to C-terminal. In another specific embodiment of the present invention, the polypeptide comprises the anti-CEA single chain antibody, CD28 transmembrane region, CD28 co-stimulatory domain, OX40 co-stimulatory domain, CD3 zeta signaling domain in order from N-terminus to C-terminus.

In another aspect, the invention provides a T lymphocyte expressing a membrane-bound polypeptide.

The T lymphocytes may typically express the polypeptide, which may typically bind to a CEA antigen, more particularly may bind to a CEA antigen by comprising the extracellular domain of the anti-CEA antibody, and when the polypeptide binds to the CEA antigen, the T lymphocytes may typically be activated and/or stimulated to proliferate. In certain embodiments of the invention, the extracellular domain comprises the anti-CEA antibody, i.e., the chimeric antigen receptor T cells can express the anti-CEA antibody on the surface of T lymphocytes, such that the T lymphocytes can be directed to act on cells expressing CEA antigen (e.g., tumor cells), which can be killing cells expressing CEA antigen, or the like.

In another aspect, the invention provides an NK cell expressing the polypeptide bound to a membrane.

The NK cell may typically express the polypeptide and may typically bind to a CEA antigen, more particularly may bind to a CEA antigen by comprising the extracellular domain of the anti-CEA antibody, and when the polypeptide binds to the antigen, the NK cell may typically be activated and/or stimulated to proliferate. In certain embodiments of the invention, the extracellular domain comprises the anti-CEA antibody, i.e., the chimeric antigen receptor NK cells can express the anti-CEA antibody on the surface of NK cells, such that the NK cells can be directed to effect on cells expressing a CEA antigen (e.g., tumor cells), which effect can be killing of cells expressing a CEA antigen, or the like.

The invention also provides the application of the separated polypeptide, the T lymphocyte and the NK cell in preparing or screening therapeutic drugs or preparing diagnostic drugs.

The therapeutic or diagnostic agent may be one that targets, binds or acts on the CEA antigen, thereby treating and/or preventing the indication.

In certain embodiments of the invention, the therapeutic agent may be a tumor therapeutic agent. The tumor treatment drug can be a drug which takes CEA antigen functionally expressed on the surface of tumor cells as a target, and combines or acts on the CEA antigen so as to treat and/or prevent tumors. The tumor can be CEA expression positive tumor such as gastric cancer, lung cancer, pancreatic cancer, intestinal cancer, etc.

In another aspect, the present invention provides a diagnostic kit comprising a diagnostically effective dose of the anti-CEA antibody or immunoconjugate thereof. An effective amount generally refers to an amount that provides a diagnostic benefit.

The diagnostic kit can generally be directed to the CEA antigen as a target of action, and diagnosis is carried out by taking the CEA antigen as a biomarker. The diagnostic kit may also include a label for the anti-CEA antibody, which may be used to label the anti-CEA antibody generally, and the types of labels that may be selected include, but are not limited to, combinations of one or more of fluorescent labels, radioactive labels, enzyme-labeled labels, chemiluminescent labels, and the like. Depending on the detection principle of the kit, the kit may also typically comprise one or more reagents required for the detection. In addition, the kit can also comprise the following components according to needs: containers, controls (negative or positive controls), buffers, adjuvants, etc., which can be selected by one skilled in the art as appropriate.

The inventor utilizes phage display technology to screen out the anti-CEA antibody 3H6 from the fully human antibody library, which can specifically bind to the CEA antigen. In addition, the inventor further modifies the single-chain antibody into a chimeric antigen receptor, for example, T cells and NK cells expressing the anti-CEA chimeric antigen receptor are used for treating digestive system tumors expressing CEA, so that the modified chimeric antigen receptor can improve the killing capacity to tumor cells.

Drawings

FIG. 1 shows the result of detecting the biotinylation of CEA antigen by ELISA.

FIG. 2 shows the detection of the binding of 3H6-scFv-mIgG1 single chain antibody to CEA antigen by ELISA.

FIG. 3 shows the detection of the affinity of 3H6-scFv-mIgG1 single chain antibody by Biacore.

FIG. 4 shows the detection by FACS of the CEA antigen recognized on the cell surface by the 3H6 scFv-mIgG1 single chain antibody.

FIG. 5 shows a schematic representation of the structure of a chimeric antigen receptor expressing 3H6 scFv.

FIG. 6 shows the expression rate of chimeric antigen receptors of T lymphocytes.

FIG. 7 shows FACS detection of T cells and 3H6 CAR-T cell phenotype.

FIG. 8 shows the killing effect of 3H6 CAR-T cells on CEA positive tumor cells.

Figure 9 shows prrl. ef1 α -3H6 CAR-WPRE lentiviral vector plasmid map.

Detailed Description

The following description of the embodiments of the present invention is provided for illustrative purposes, and other advantages and effects of the present invention will become apparent to those skilled in the art from the present disclosure. The invention is capable of other and different embodiments and of being practiced or of being carried out in various ways, and its several details are capable of modification in various respects, all without departing from the spirit and scope of the present invention.

Before the present embodiments are further described, it is to be understood that the scope of the invention is not limited to the particular embodiments described below; it is also to be understood that the terminology used in the examples is for the purpose of describing particular embodiments, and is not intended to limit the scope of the present invention; in the description and claims of the present application, the singular forms "a", "an" and "the" include plural referents unless the context clearly dictates otherwise.

When numerical ranges are given in the examples, it is understood that both endpoints of each of the numerical ranges and any value therebetween can be selected unless the invention otherwise indicated. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. In addition to the specific methods, devices, and materials used in the examples, any methods, devices, and materials similar or equivalent to those described in the examples may be used in the practice of the invention in addition to the specific methods, devices, and materials used in the examples, in keeping with the knowledge of one skilled in the art and with the description of the invention.

Unless otherwise indicated, the experimental methods, detection methods, and preparation methods disclosed herein all employ techniques conventional in the art of molecular biology, biochemistry, chromatin structure and analysis, analytical chemistry, cell culture, recombinant DNA technology, and related arts.

Example 1

Panning and ELISA preliminary screening of natural humanized phage antibody library

Panning of phage antibody libraries

3 EP tubes were prepared for magnetic bead blocking and tube wall blocking (A: 1ml PBS, 2% blocking-Grade Blocker, 50. mu.l streptavidin magnetic beads, 100. mu.l phage library; B: 1ml PBS, 2% blocking-Grade Blocker, 100. mu.l streptavidin magnetic beads; C: 1ml PBS, 2% blocking-Grade Blocker) and left to stand at room temperature for 1-2 h. The solution in tube C and the magnetic beads in tube A are discarded, the phage in tube A is collected and added to tube C, and the biotin-labeled antigen CEA (final concentration 20. mu.g/ml) is added at the same time, and the mixture is incubated at room temperature for 2 h. And collecting the magnetic beads in the tube B, discarding the solution, adding the mixture in the tube C, and placing the mixture in a test tube rotary table for rotary incubation for 15 min. The EP tube was placed on a magnetic stand and allowed to stand for 30s so that the magnetic beads were adsorbed to the tube wall. The supernatant was discarded and panning was performed by adding MPBST (PBS + 2% blocking-Grade Blocker + 0.05% Tween20), PBST (PBS + 0.05% Tween20), MPBS (PBS + 2% blocking-Grade Blocker) and PBS. The elutriation is carried out on a rotary shaking table for 2min, and each washing solution is elutriated for 5 times. The phages were eluted using 1ml of pancreatin (10. mu.g/ml) incubated at 37 ℃ for 30min, after removal of the magnetic beads by magnetic rack adsorption, 4ml of freshly cultured TG1 broth (A600. apprxeq.0.6) were infected and incubated at 37 ℃ for 30 min. 100 μ l of the bacterial suspension was diluted in a gradient and spread evenly on 2 XYT/ampicillin/glucose agar plates for calculation of the volume of the elutriated product. The remaining bacterial solution was centrifuged and resuspended in 2 XYT medium of appropriate volume and spread on plates with selection resistance for overnight culture. The bacteria were scraped from the plate using an appropriate amount of liquid culture medium, centrifuged to collect the cells, resuspended in an appropriate amount of 2 XYT medium containing 40% glycerol, and then aliquoted. All bacteria were stored at-80 ℃. The colony number on the gradient dilution plate is calculated, the volume of the elutriated product is calculated according to the dilution multiple, and 50 clones are randomly picked for sequencing analysis.

Phage packaging

50 μ l of the frozen supernatant from the previous round of panning was added to 50ml of culture medium and cultured in 150ml culture flask at 37 ℃ with shaking (250rpm) until A600 became 0.6, and the initial broth A600 should be less than 0.05. The helper phage M13K07 was added in a ratio of 1:500, and the mixture was first allowed to stand at 37 ℃ for 30min, followed by incubation at 37 ℃ for 30min with shaking (250 rpm). The cells were collected by centrifugation at 4500rpm for 10min, resuspended in 2 XYT medium containing ampicillin and kanamycin in the same volume, and cultured at 30 ℃ for 4h with shaking (250 rpm). The supernatant was collected by centrifugation at 4500rpm for 10min and 1/4 volumes of PEG solution (20% polyethylene glycol, 2.5M NaCl) were added to precipitate the phage overnight. After phage collection by centrifugation at 4,000rpm for 30min at 4 ℃, they were resuspended in 1ml of PBS solution and transferred to a 15ml centrifuge tube. The mixture was centrifuged again at 4,000rpm for 10min to remove impurities such as bacterial debris, and the supernatant was collected. The supernatant was mixed with an equal volume of 60% glycerol and dispensed into 1.5ml EP tubes and stored at-80 ℃.

To obtain more antibodies likely to bind CEA antigen, the two antibody libraries established from different periods each have a capacity greater than 10¹⁰The natural humanized phage display antibody library of (1) ((

library 1 and

library 2) will be the primary antibody source for anti-CEA scFv antibody screening. In order to avoid the destruction of antigen epitope in the panning process, a liquid phase panning scheme using avidin magnetic beads for phage antibody screening will be used as the antibody library panning method. The CEA antigen is biotinylated by N-hydroxysuccinimide biotin, and the ELISA detection result shows that the CEA antigen is successfully biotinylated, and the result is shown in figure 1.

Biotinylated CEA antigen was used for 3 rounds of panning. The products of each round of panning were quality controlled by their yields of two orders of magnitude higher than the control and the enrichment of the randomly selected 50 clone-analyzed sequences. The results show that the yield of the elutriation product is significantly increased after 3 rounds of elutriation and is 4 orders of magnitude higher than the control. Sequencing result analysis shows that a plurality of sequences are obviously enriched. To avoid losing sequence diversity, preliminary ELISA screens will be performed from the 2nd and 3 rd round panning products. And (3) randomly selecting positive clones from the elutriation products, carrying out induced expression, detecting the CEA antigen binding capacity of the expression supernatant by an ELISA method, and screening out CEA-binding positive clones.

The ELISA detection method comprises the following steps:

the antigen used was diluted to an appropriate concentration (1. mu.g/m) using a coating solutionl to 0.001. mu.g/ml), 100. mu.l per well were coated overnight at 4 ℃ (to avoid evaporation, plates should be covered or plates should be placed flat in a metal wet box with wet gauze at the bottom). After 3 washes of PBST (containing 0.05% Tween-20), blocking was performed by incubation with blocking solution (1% BSA in PBST containing 0.05% Tween-20) for 2h at room temperature. Add 100. mu.l of the sample to be tested (which can be diluted in a gradient as required for the experiment) and incubate for 1h at room temperature. After washing the plates 3 times with PBST (containing 0.05% Tween-20), 100ul of secondary HRP-labeled antibody (1/5000 diluted) was added and incubated for 1h at room temperature. PBST (containing 0.05% Tween-20) was washed for 3 times, added with 100. mu.l of TMB developing solution, incubated at room temperature in dark for 10min, and then added with 100. mu.l of 2mol/L H₂SO₄The reaction was terminated. Readings were taken using a microplate reader at 450nm wavelength and the results were analyzed. To ensure the specification of each ELISA run, negative and positive controls were set up in each 96-well plate. The reliability of the experimental results is judged by the reading values of the negative and positive controls in the normal range.

Example 2

FACS screening of candidate clones

Cell culture was performed according to standard cell culture protocols, and a single cell suspension was prepared using pancreatin-digested cells. Centrifugation (300g, 5min) to remove culture medium followed by resuspension of cells to 2x 10 with Flow solution⁶cell/ml. Round bottom 96well plates 2x 10 additions per well⁵A cell suspension of individual cells. After centrifugation at 300g for 5min, the supernatant was removed, the cells were resuspended with 100. mu.l of periplasmic protein extract and incubated for 1h at 4 ℃. After centrifugation at 300g for 5min, the supernatant was removed and the Flow solution resuspended cells and repeated 3 times to remove periplasmic protein extract. The anti-myc antibody was diluted to 2. mu.g/ml with blocking solution, 100. mu.l of resuspended cells per well and incubated for 1h at 4 ℃. After 3 times of washing the cells with Flow Buffer, 100. mu.l of Alexa-488anti-mouse antibody was added to resuspend the cells, and the cells were incubated at 4 ℃ for 1 hour. After 3 times of washing the cells with Flow Buffer, 200. mu.l of Flow Buffer was used to resuspend the cells and examined by Flow cytometry.

The surface of the human colon cancer cell line SW620 expresses CEA in a low way, and an SW620 cell line (purchased from the Shanghai Jikai gene) which stably expresses the CEA is constructed by using the SW620 cell line as a positive control for cell level detection, while a 293T cell line which does not express CEA antigen is used as a negative control.

The CEA antigen is a protein expressed on the surface of a plurality of cancer cells, so that whether the cancer cells expressing the CEA antigen can be combined with other CEA antigen besides the scFv combined with the CEA antigen on the surface of the SW620 cells obtained by the first round of detection and screening becomes a target for the second round of cell level detection. Human pancreatic cancer cells (BxPC-3 cells) and human gastric cancer cells (NCI-N87 cells) were selected for detection. The results of the first and second round FACS tests for the ability of candidate clones to bind CEA on the surface of tumor cells are shown in tables 1-1 and 1-2, respectively, and the candidate clones bind SW620/CEA and BxPC-3 cells to different degrees.

TABLE 1-1

Tables 1 to 2

Example 3

Off-rate ranking candidate clone

Antibody affinity depends on the degree of adaptation of the antibody variable region to the antigen, and is generally assessed by affinity. The dissociation constant (Koff) is generally the main kinetic mechanism affecting the affinity of antibodies, so the antibody affinity can be compared primarily by determining the dissociation rate. Also, Koff is concentration-independent, and thus can be measured without purifying the antibody. The Koff of the candidate clones was determined by Octet Red and ranked to aid in further selection of clones for subsequent analysis. Bacterial periplasmic extracts were prepared according to standard procedures. Immobilized biotin-labeled antigen (5. mu.g/ml) on streptavidin SA biosensor, periplasmic extract was diluted 2-fold with 1 × kinetic buffer, antigen and scFv antibody binding time 300s, dissociation time 300 s. The SA biosensor was regenerated by a 10mM glycine solution. All samples were ranked according to Kdis values. The results showed that the 3H6 single-chain antibody had a Koff value of 4.35E-04.

Example 4

scFv-mIgG1 single-chain antibody expression, purification and antibody affinity determination

To further identify the antibodies screened, it is desirable to express the antibodies in mammalian cells. Thus, a plasmid vector with a mouse Fc tag expressing scFv was first constructed as follows.

PCR amplification of 3H6 scFv, the system is shown in Table 3, the primers are shown in Table 2, the PCR reaction conditions are shown in Table 4, the digested vector was used

And purifying by using a PCR purification kit. The air-dried DNA was dissolved in 45. mu.l of water, and the concentration of the DNA was measured.

TABLE 2

TABLE 3

TABLE 4

Over-lap PCR the PCR reaction system was 50. mu.l as shown in Table 5. PCR reaction conditions are shown in Table 6, and the products were recovered and purified by gel.

TABLE 5

Reagent	Volume of
		10×reaction buffer	5.0μl
Fragment-1	3.0μl
		Fragment-2	3.0μl
Fragment-3	3.0μl
		pfx DNA polymerase	1.0μl
Add ddH2O	to 48μl.

TABLE 6

Cloning vector linearization of Pcp-buffer-mCg 1-FC (from Shanghai Ruizi chemical)

1) The first step of enzyme digestion, the enzyme digestion system is shown in Table 7, the carrier after enzyme digestion is used

And purifying by using a PCR purification kit.

TABLE 7

2) The second step of enzyme digestion, the enzyme digestion system is shown in Table 8, the carrier after enzyme digestion is used

And purifying by using a PCR purification kit.

TABLE 8

3) Homologous recombination system is shown in Table 9

TABLE 9

After homologous recombination, 10. mu.L of the resulting mixture was added to DH 5. alpha. competent cells, frozen on ice for 5min, heat-shocked in a 42 ℃ water bath for 90s, cooled on ice for 3min, added to 500. mu.L of LB medium, thawed at 37 ℃ at 220rpm for 30min, applied to 200. mu.L of LB medium containing 100ug/ml of ampicillin, and inverted in a 37 ℃ incubator overnight. And selecting a monoclonal for sequencing and identifying. The sequencing result is in line with expectation, and the plasmid vector with the mouse Fc tag expression scFv is successfully constructed.

293 cells were passaged to a cell density of about 2.4X 10 about 24h prior to plasmid transfection⁶cells/ml. The cell density is 4.1-4.8 × 10⁶cells/ml, viability>At 95%, 0.5mg of expression plasmid scFV-mIgG1 was used to transfect 293 cells by PEI method at 37 ℃ and 130rpm with 8% CO₂After shaking culture for 7 days, the cell culture product was centrifuged to obtain a supernatant, which was then filtered by Sartopore 2 (Sartorius) to remove cell debris, and the filtered supernatant was collected. The antibody of interest was collected using 5ml MabSelect Sure purification and the multimers were further purified away using Superdex 200. The collected target antibody was concentrated by centrifugation at 15ml 10K using a Centrifugal Filter Unit, and then filtered through a 0.22 μm Sterile Millex-GP Filter Unit. The antibody purity was determined by SEC-HPLC using the method for determination of A280 by NanoDrop 2000, and the results are shown in Table 10. The results showed that the antibody purity of clone OLD-2ND-3-H6-scFv-mIgG1 (abbreviated as OLD-2ND-3-H6 or 3H6-scFv-mIgG1) was 97.83%. The 3H6-scFv-mIgG1 single-chain antibody was identified by ELISA as binding to CEA antigen, and the results are shown in FIG. 2.

In addition, the affinity of the purified 3H6-scFv-mIgG1 single-chain antibody was measured by Biacore. Biacore is a bioanalytical sensing technology developed based on Surface Plasmon Resonance (SPR), and can detect the whole process of change of binding and dissociation of molecules in a tracking solution and molecules fixed on the surface of a chip, record the change in the form of a sensorgram, and provide kinetic and affinity data. In the measurement process, the antibody is immobilized on the surface of the chip, and the mobile phase is a solution containing the antigen. The measurement results are shown in table 11 and fig. 3. The KD value of the 3H6-scFv-mIgG1 single-chain antibody is 4.308E-08.

Watch 10

TABLE 11

Antibody	Antigen	ka(1/Ms)	kd(1/s)	KD(M)	Analyte model
						2H4	CEA	2.587E+05	1.114E-02	4.308E-08	1:1 binding

Example 5

3H6 scFv-mIgG1 Single chain antibody flow assay

293T (CEA-), SW620-CEA (CEA +), BxPC3(CEA +) three tumor cells and purified 3H6 scFv-mIgG1 antibody were incubated for 30min in ice bath, then incubated for 30min with APC labeled goat anti-mouse IgG antibody, and detected by flow cytometry, and the result was shown in FIG. 4, in which the single-chain antibody recognized CEA antigen on the cell surface.

Example 6

Lentiviral vector preparation of chimeric antigen receptor expressing 3H6 scFv

A lentiviral vector prrl. ef1 α -3H6 CAR-WPRE carrying 3H6 scFv chimeric antigen receptor was first constructed and the vector map is shown in figure 9. The chimeric antigen receptor sequence comprising the signal peptide, 3H6 scFv, CD8 alpha glue chain region, transmembrane region and immunoreceptor tyrosine activation motif was synthesized in sequence as follows, and the results are shown in FIG. 5.

1.PCR reaction systems were prepared according to table 12 to amplify scFv fragments of 3H6 using the following primers:

3H6-F ctgccgctggccttgctgctccacgccgccaggccggaaacgacactcacgc(SEQ ID No.17)

3H6-R cggcgctggcgtcgtggttgaagagacggtgaccac(SEQ ID No.18)

after the preparation, the reaction was carried out according to the PCR procedure shown in Table 13,

TABLE 12

Reagent	Volume (μ L)
		10x buffer	5
2mM dNTP	5
		25mM MgSO ₄	3
10μM primer F 3H6-F	1
		10μM primer R 3H6-R	1
Template DNA new-3rd-3H6	1
		PCR grade water	33
KOD-Plus-Neo	1

The above reagent is from TOYOBO Inc.

Watch 13

2. The PCR reaction was set up as in Table 14, and the scFv fragment was preceded by the CD8 α signal peptide using the following primers:

BamH-CD8αsig-F：gctgcaggtcgactctagaggatcccgccaccatggccttaccagtgaccgccttgctcctgccgctggccttgc (SEQ ID No.19)

3H 6-R: (same SEQ ID No.18)

After preparation, PCR reactions were performed according to the PCR procedure shown in Table 13. After the reaction is finished, carrying out 1% agarose gel electrophoresis on the PCR product, recovering fragments of about 780bp, and quantifying by an ultraviolet absorption method.

TABLE 14

Reagent	Volume (μ L)
		10 x buffer	5
2mM dNTP	5
		25mM MgSO ₄	3
10μM primer F BamH-CD8αsig-F	1
		10μM primer R 3H6-R	1
PCR reaction solution for Template DNA scFv fragment	4
		PCR grade water	30
KOD-Plus-Neo	1

3. A PCR reaction system was prepared according to Table 15, and the CD8 α hinge-TM-41BB-CD3Z fragment was amplified using the following primers:

CD8αH-F accacgacgccagcgccgcgac(SEQ ID No.20)

Vector-R tcgataagcttgatatcg(SEQ ID No.21)

after preparation, PCR reactions were performed according to the PCR procedure shown in Table 13. After the PCR is finished, 1% agarose gel electrophoresis is carried out, fragments of about 780bp are recovered, and the quantification is carried out by an ultraviolet absorption method.

Watch 15

Reagent	Volume (μ L)
		10 x buffer	5
2mM dNTP	5
		25mM MgSO ₄	3
10μM primer F CD8αH-F	1
		10μM primer R Vector-R	1
Template DNA	1
		PCR grade water	33
KOD-Plus-Neo	1

The reagent is from STOYOBO Inc.

4. Mu.g of the laboratory-constructed HD CD19 CAR plasmid was digested with BamHI and EcoRI, reacted in a water bath at 37 ℃ for 2 hours, and then the vector was recovered.

The 3 fragments and the step 4 vector using recombinant enzyme connection, the recombination reaction system as shown in Table 16, after the preparation of water bath reaction at 37 ℃ 0.5h, according to the conventional method transformed into Escherichia coli stbl3 competent cells. And selecting a monoclonal from a solid culture medium, culturing overnight, performing PCR identification, selecting a positive clone after the PCR is finished, and further performing sequencing identification, wherein the sequencing result is in line with expectation. The PCR reaction formulations are shown in Table 17 and the PCR procedures are shown in Table 18.

TABLE 16

Reagent	Volume of
		HD CD19 CAR	184.54ng
CD8αsingal 3H6 scFv	31.32ng
		CD8αhinge-TM-41BB-CD3Z	29.72ng
5 x CE buffer	2μL
		Exnase^TM II	1μL
PCR grade water	Up to 10μL
		Total	10μL

TABLE 17

Reagent	Volume (μ L)
		Taq PCR Master Mix	10
10μM F Seq-trEF1a-F	1
		10μM R Vector-R	1
Template DNA bacterial liquid	1
		PCR grade water	7
Total	20

Watch 18

The amino acid sequence of the signal peptide is: MALPVTALLLPLALLLHAARP (SEQ ID No.22)

The amino acid sequence of 3H6 scFv is:

MAQVQLQESGGGSVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSHISGSG GNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSWGSSNYGTFDIWGQG TVVTVSS(SEQ ID No.23)

the amino acid sequences of the CD8 α hinge and transmembrane regions are:

TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVL LLSLVITLYC(SEQ ID No.24)

the amino acid sequence of the immunoreceptor tyrosine activation motif is:

RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQE GLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID No.25)

the nucleotide sequence of CEA CAR is:

atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccaggccggaaacgacactcacgcagtctccagg caccctgtctttgtctccaggggaaagagccaccctctcctgcagggccagtcagagtgttaacaacaacttcttaggctggtaccagcagaga gttggccaggctcccaggctcctcatctatggtgcatccagcagggccactggcatcccagacaggttcagtggcagtgggtctgggacagac ttcactctcaccatcagcagactggagcctgaagattttgcagtgtattactgtcagcagtatggtagctcaccgctcactttcggcggagggacc aaggtggagatcaaaggtggaggcggttcaggcggaggtggctctggcggtggcggatcgatggcccaggtgcagctgcaggagtcgggg ggaggctcggtacagcctggggggtccctgagactctcctgtgcagcctctggattcacctttagcagctatgccatgagctgggtccgccagg ctccagggaaggggctggagtgggtctcacatattagtggtagtggtggtaacacatactacgcagactccgtgaagggccggttcaccatctc cagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtatattactgtgcgaaaagttggggttc gagtaattatggtacttttgatatctggggccaagggacagtggtcaccgtctcttcaaccacgacgccagcgccgcgaccaccaacaccggcg cccaccatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggactt cgcctgtgatatctacatctgggcgcccttggccgggacttgtggggtccttctcctgtcactggttatcaccctttactgcaaacggggcagaaa gaaactcctgtatatattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaag aaggaggatgtgaactgagagtgaagttcagcaggagcgcagacgcccccgcgtacaagcagggccagaaccagctctataacgagctcaa tctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctca ggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaagg ggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcgc(SEQ ID No.26)

separating the two gene fragments of the obtained signal peptide-3H 6, CD8 alpha hinge region, transmembrane region and immunoreceptor tyrosine activation motif by agarose gel electrophoresis, and then recovering, purifying and quantifying by using an agarose gel DNA fragment recovery kit; the lentiviral expression vector pRRL. EF1. alpha. -CEACAR-WPRE was cut with restriction enzymes BamHI and EcoRI (from NEB) and the procedure was as described. Separating the enzyme digestion product by agarose gel electrophoresis, and then recovering, purifying and quantifying by using an agarose gel DNA fragment recovery kit; then, the two target fragments and the vector are cloned into a lentiviral vector by using a recombinase, sequencing verification is carried out, and the sequencing result is in line with expectation.

Example 7

Packaging of lentiviruses

(1) At 1.6X 10⁷ Cell number 293T cells were plated in 15cm dishes at 37 ℃ with 5% CO₂Culturing overnight to prepare packaged virus, wherein the culture medium contains DMEM and 10% Fetal Bovine Serum (FBS);

(2) dissolving lentiviral vector 30 μ g pRRL. EF1 α -3H6 CAR-WPRE, helper plasmid gag/pol 12.5 μ g and envelope plasmid VSVg 10 μ g (both helper plasmid gag/pol and envelope plasmid VSVg are from the gene of Kjekah, Shanghai) in 2000 μ L serum-free DMEM medium, and mixing;

(3) mu.g PEI (1. mu.g/. mu.L) was dissolved in 2000. mu.L serum free DMEM medium, gently mixed (or vortexed at 1000rpm for 5 seconds) and incubated at room temperature for 5 min;

(4) formation of transfection complexes: adding the PEI mixed solution into the DNA mixed solution, immediately mixing by vortex or mixing lightly, and incubating for 20min at room temperature;

(5) dripping 4mL of the transfection compound into a 15cm culture dish containing 25mL of DMEM medium, and replacing the fresh medium after 4-5 h;

(6) after 48h, the virus supernatant was collected.

Example 8

Lentiviral concentration

Filtering the virus supernatant with a 0.45-micron filter membrane, collecting the filtrate in a 50mL centrifuge tube, adding 1/4 PEG-NaCl virus concentrated solution, turning upside down, mixing uniformly, and standing at 4 ℃ overnight; centrifuging at 4 deg.C and 3500rpm for 30 min; removing supernatant, adding appropriate amount of RPMI 1640 culture medium (containing 10% FBS), and dissolving and resuspending virus precipitate; the concentrated lentiviral suspension was aliquoted into 50 μ L aliquots, stored in finished tubes and stored at-80 ℃.

Example 9

Lentiviral titer detection

500 μ L K562 cells (1X 10)⁵Individual cells) were seeded into 24-well culture plates; adding the concentrated lentivirus into the cell suspension at 1. mu.L, 0.2. mu.L and 0.04. mu.L respectively, and adding polybrene to a final concentration of 5. mu.g/mL; 37 ℃ and 5% CO₂After overnight culture, the fresh medium was replaced; after 72h of infection, cells are collected, 400g of the cells are centrifuged for 5min, the supernatant is discarded, and the cells are washed once by PBS and 2% FBS solution; adding FITC-labeled goat anti-human Fab antibody according to a dilution ratio of 1:50, and incubating for 30min on ice; adding 1mL of PBS + 2% FBS solution, washing twice, adding a proper volume of PBS + 2% FBS solution, resuspending cells, and detecting by adopting a flow cytometer; taking a cell sample with a positive rate of 5-20%, and calculating the titer (TU/mL) as the cell number (10)⁵) X positive rate/virus volume (mL).

Example 10

Lentivirally transduced T lymphocytes

T lymphocyte activation: anti-human CD3 antibody and anti-human CD28 antibody were diluted with PBS to final concentrations of 1. mu.g/mL and 0.5. mu.g/mL, respectivelyg/mL, coating a pore plate, and standing overnight in a refrigerator at 4 ℃; discarding the antibody coating solution in the pore plate, and washing twice with 1mL of PBS; human PBMC were adjusted to a density of 1X 10 with T cell culture medium (X-VIVO + 10% FBS + IL-2(300U/mL))⁶mL, then inoculated into CD3 and CD28 antibody coated well plates for activation for 48 h; collecting activated T cells, adjusting cell density to 1 × 10⁶(iv)/mL, lentivirus was added at a multiplicity of infection (MOI) of 10, polybrene was added to a final concentration of 5 μ g/mL; at 37 ℃ with 5% CO₂After overnight incubation in the environment, the medium was replaced with fresh medium. Passages were performed every 2-3 days.

Example 11

Lymphocyte chimeric antigen receptor expression

1.

1) After 5 days of infection, 3X 10 of the above-mentioned three-dimensional samples were taken⁵Centrifuging the T cells at 4 ℃ for 5min at 400g, discarding the supernatant, and washing the cells once with PBS and 2% FBS;

2) adding 50 μ L PBS + 2% FBS to resuspend the cells, adding 1 μ L FITC labeled goat anti-human Fab antibody, and incubating on ice for 30 min; after PBS + 2% FBS is washed twice, 300 mu L of PBS + 2% FBS is added to resuspend cells, and a flow cytometer is adopted to detect the infection efficiency; the results are shown in figure 6, with a CAR positive cell proportion of 45.7%.

2.

2) add 50. mu.L PBS + 2% FBS to resuspend the cells, add 1. mu.L FITC labeled Anti-CD3 Ab, Percp-Cy5.5 labeled Anti-CD4 Ab and PE-Cy7 labeled Anti-CD8 Ab, incubate on ice for 30 min; after washing twice with PBS + 2% FBS, adding 300 μ L PBS + 2% FBS to resuspend the cells, and detecting the cell phenotype by using a flow cytometer; the results are shown in FIG. 7a, where the proportion of CD3+ cells in untransfected T cells was over 99%, the proportion of CD3+ CD4+ cells was 24.6%, and the proportion of CD3+ CD8+ cells was 73.8%; 3H6 CAR-T cells, as shown in fig. 7b, the proportion of CD3+ cells was over 99%, the proportion of CD3+ CD4+ cells was 31.7%, and the proportion of CD3+ CD8+ cells was 67.1%.

Example 12

In vitro toxicity assay of CAR-T cells

1. Target cell seeding

293T (CEA-), SW620-CEA and BxPC3(CEA +) as target cells, and the concentration of the target cells is adjusted to 1X 10⁵mL, 100 μ L was inoculated to 96well plates;

2. effector cell inoculation:

3H6 CAR-T and control T cells were effector cells; adding CAR-T cells and control T cells to a 96-well plate according to an effective target ratio of 0.3:1, 1:1 and 3: 1;

3. each group was set with 3 replicate wells, and the average of the 3 replicate wells was taken. Wherein each experimental group and each control group are as follows:

each experimental group: each target cell + CAR-T;

control group 1: maximal release of LDH by target cells;

control group 2: target cells spontaneously release LDH;

control group 3: the effector cells spontaneously release LDH;

4. the detection method comprises the following steps:

after the effector cells and the target cells were co-cultured for 18 hours, they were subjected to CytoTox 96 nonradioactive cytotoxicity assay kit (Promega). The method is a detection method based on a colorimetric method, and reflects the cracking degree of cells by detecting the content of Lactate Dehydrogenase (LDH). LDH is a stable cytosolic enzyme that is released upon cell lysis in a manner similar to that of⁵¹The release pattern of Cr in the radioactivity analysis was essentially the same. The released LDH medium supernatant can be detected by a coupled enzymatic reaction in which LDH converts a tetrazolium salt (INT) to red formazan (formazan). The amount of red product produced is proportional to the number of cells lysed. Reference is made in particular to the instructions of the CytoTox 96 nonradioactive cytotoxicity detection kit.

5. The cytotoxicity is calculated by the formula:

the results are shown in FIG. 8, 3H6 CAR-T cells had killing activity against CEA positive tumor cells, but no killing effect on CEA negative cells.

In conclusion, the 3H6 antibody capable of specifically binding to the CEA antigen is screened, and the CAR-T cell capable of specifically killing CEA positive tumor cells is constructed on the basis of 3H6 scFv. Therefore, the invention effectively overcomes various defects in the prior art and has high industrial utilization value.

The foregoing embodiments are merely illustrative of the principles and utilities of the present invention and are not intended to limit the invention. Any person skilled in the art can modify or change the above-mentioned embodiments without departing from the spirit and scope of the present invention. Accordingly, it is intended that all equivalent modifications or changes which can be made by those skilled in the art without departing from the spirit and technical spirit of the present invention be covered by the claims of the present invention.

Sequence listing

<110> Huadao (Shanghai) biopharmaceutical Co., Ltd

<120> anti-carcinoembryonic antigen antibody, preparation method and application thereof

<160> 26

<170> SIPOSequenceListing 1.0

<210> 1

<211> 10

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 1

Gly Phe Thr Phe Ser Ser Tyr Ala Met Ser

1 5 10

<210> 2

<211> 17

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 2

His Ile Ser Gly Ser Gly Gly Asn Thr Tyr Tyr Ala Asp Ser Val Lys

1 5 10 15

Gly

<210> 3

<211> 12

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 3

Ser Trp Gly Ser Ser Asn Tyr Gly Thr Phe Asp Ile

1 5 10

<210> 4

<211> 12

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 4

Arg Ala Ser Gln Ser Val Asn Asn Asn Phe Leu Gly

1 5 10

<210> 5

<211> 7

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 5

Gly Ala Ser Ser Arg Ala Thr

1 5

<210> 6

<211> 9

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 6

Gln Gln Tyr Gly Ser Ser Pro Leu Thr

1 5

<210> 7

<211> 324

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 7

gaaacgacac tcacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc 60

ctctcctgca gggccagtca gagtgttaac aacaacttct taggctggta ccagcagaga 120

gttggccagg ctcccaggct cctcatctat ggtgcatcca gcagggccac tggcatccca 180

gacaggttca gtggcagtgg gtctgggaca gacttcactc tcaccatcag cagactggag 240

cctgaagatt ttgcagtgta ttactgtcag cagtatggta gctcaccgct cactttcggc 300

ggagggacca aggtggagat caaa 324

<210> 8

<211> 369

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 8

atggcccagg tgcagctgca ggagtcgggg ggaggctcgg tacagcctgg ggggtccctg 60

agactctcct gtgcagcctc tggattcacc tttagcagct atgccatgag ctgggtccgc 120

caggctccag ggaaggggct ggagtgggtc tcacatatta gtggtagtgg tggtaacaca 180

tactacgcag actccgtgaa gggccggttc accatctcca gagacaattc caagaacacg 240

ctgtatctgc aaatgaacag cctgagagcc gaggacacgg ccgtatatta ctgtgcgaaa 300

agttggggtt cgagtaatta tggtactttt gatatctggg gccaagggac agtggtcacc 360

gtctcttca 369

<210> 9

<211> 108

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 9

Glu Thr Thr Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Asn Asn Asn

20 25 30

Phe Leu Gly Trp Tyr Gln Gln Arg Val Gly Gln Ala Pro Arg Leu Leu

35 40 45

Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser

50 55 60

Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu

65 70 75 80

Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Ser Ser Pro

85 90 95

Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

100 105

<210> 10

<211> 123

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 10

Met Ala Gln Val Gln Leu Gln Glu Ser Gly Gly Gly Ser Val Gln Pro

1 5 10 15

Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser

20 25 30

Ser Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu

35 40 45

Trp Val Ser His Ile Ser Gly Ser Gly Gly Asn Thr Tyr Tyr Ala Asp

50 55 60

Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr

65 70 75 80

Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr

85 90 95

Tyr Cys Ala Lys Ser Trp Gly Ser Ser Asn Tyr Gly Thr Phe Asp Ile

100 105 110

Trp Gly Gln Gly Thr Val Val Thr Val Ser Ser

115 120

<210> 11

<211> 50

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 11

cttgtcgcga ttcttaaggg tgtccagtgc gaaacgacac tcacgcagtc 50

<210> 12

<211> 60

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 12

cgatccgcca ccgccagagc cacctccgcc tgaaccgcct ccacctttga tctccacctt 60

<210> 13

<211> 60

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 13

ggtggaggcg gttcaggcgg aggtggctct ggcggtggcg gatcgatggc ccaggtgcag 60

<210> 14

<211> 50

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 14

atatgcaagg cttacaacca caatctgaag agacggtgac cactgtccct 50

<210> 15

<211> 50

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 15

agggacagtg gtcaccgtct cttcagattg tggttgtaag ccttgcatat 50

<210> 16

<211> 50

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 16

ccggccttgc cggcctcgag cggccgctta tttaccagga gagtgggaga 50

<210> 17

<211> 52

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 17

ctgccgctgg ccttgctgct ccacgccgcc aggccggaaa cgacactcac gc 52

<210> 18

<211> 36

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 18

cggcgctggc gtcgtggttg aagagacggt gaccac 36

<210> 19

<211> 75

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 19

gctgcaggtc gactctagag gatcccgcca ccatggcctt accagtgacc gccttgctcc 60

tgccgctggc cttgc 75

<210> 20

<211> 22

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 20

accacgacgc cagcgccgcg ac 22

<210> 21

<211> 18

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 21

tcgataagct tgatatcg 18

<210> 22

<211> 21

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 22

Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu

1 5 10 15

His Ala Ala Arg Pro

20

<210> 23

<211> 123

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 23

Met Ala Gln Val Gln Leu Gln Glu Ser Gly Gly Gly Ser Val Gln Pro

1 5 10 15

Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser

20 25 30

Ser Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu

35 40 45

Trp Val Ser His Ile Ser Gly Ser Gly Gly Asn Thr Tyr Tyr Ala Asp

50 55 60

Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr

65 70 75 80

Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr

85 90 95

Tyr Cys Ala Lys Ser Trp Gly Ser Ser Asn Tyr Gly Thr Phe Asp Ile

100 105 110

Trp Gly Gln Gly Thr Val Val Thr Val Ser Ser

115 120

<210> 24

<211> 69

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 24

Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala

1 5 10 15

Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly

20 25 30

Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile

35 40 45

Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu Ser Leu Val

50 55 60

Ile Thr Leu Tyr Cys

65

<210> 25

<211> 112

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 25

Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Lys Gln Gly

1 5 10 15

Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr

20 25 30

Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys

35 40 45

Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys

50 55 60

Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg

65 70 75 80

Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala

85 90 95

Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg

100 105 110

<210> 26

<211> 1470

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 26

atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60

ccggaaacga cactcacgca gtctccaggc accctgtctt tgtctccagg ggaaagagcc 120

accctctcct gcagggccag tcagagtgtt aacaacaact tcttaggctg gtaccagcag 180

agagttggcc aggctcccag gctcctcatc tatggtgcat ccagcagggc cactggcatc 240

ccagacaggt tcagtggcag tgggtctggg acagacttca ctctcaccat cagcagactg 300

gagcctgaag attttgcagt gtattactgt cagcagtatg gtagctcacc gctcactttc 360

ggcggaggga ccaaggtgga gatcaaaggt ggaggcggtt caggcggagg tggctctggc 420

ggtggcggat cgatggccca ggtgcagctg caggagtcgg ggggaggctc ggtacagcct 480

ggggggtccc tgagactctc ctgtgcagcc tctggattca cctttagcag ctatgccatg 540

agctgggtcc gccaggctcc agggaagggg ctggagtggg tctcacatat tagtggtagt 600

ggtggtaaca catactacgc agactccgtg aagggccggt tcaccatctc cagagacaat 660

tccaagaaca cgctgtatct gcaaatgaac agcctgagag ccgaggacac ggccgtatat 720

tactgtgcga aaagttgggg ttcgagtaat tatggtactt ttgatatctg gggccaaggg 780

acagtggtca ccgtctcttc aaccacgacg ccagcgccgc gaccaccaac accggcgccc 840

accatcgcgt cgcagcccct gtccctgcgc ccagaggcgt gccggccagc ggcggggggc 900

gcagtgcaca cgagggggct ggacttcgcc tgtgatatct acatctgggc gcccttggcc 960

gggacttgtg gggtccttct cctgtcactg gttatcaccc tttactgcaa acggggcaga 1020

aagaaactcc tgtatatatt caaacaacca tttatgagac cagtacaaac tactcaagag 1080

gaagatggct gtagctgccg atttccagaa gaagaagaag gaggatgtga actgagagtg 1140

aagttcagca ggagcgcaga cgcccccgcg tacaagcagg gccagaacca gctctataac 1200

gagctcaatc taggacgaag agaggagtac gatgttttgg acaagagacg tggccgggac 1260

cctgagatgg ggggaaagcc gagaaggaag aaccctcagg aaggcctgta caatgaactg 1320

cagaaagata agatggcgga ggcctacagt gagattggga tgaaaggcga gcgccggagg 1380

ggcaaggggc acgatggcct ttaccagggt ctcagtacag ccaccaagga cacctacgac 1440

gcccttcaca tgcaggccct gccccctcgc 1470

Claims

1. An anti-CEA antibody comprising a heavy chain variable region and a light chain variable region, said anti-CEA antibody having the following technical features:

<1> the amino acid sequence of CDR-H1 in the variable region of the heavy chain is shown in SEQ ID No. 1;

<2> the amino acid sequence of CDR-H2 in the variable region of the heavy chain is shown in SEQ ID No. 2;

<3> the amino acid sequence of CDR-H3 in the variable region of the heavy chain is shown in SEQ ID No. 3;

<4> the amino acid sequence of CDR-L1 in the variable region of the light chain is shown in SEQ ID No. 4;

<5> the amino acid sequence of CDR-L2 in the variable region of the light chain is shown in SEQ ID No. 5;

<6> the amino acid sequence of CDR-L3 in the variable region of the light chain is shown in SEQ ID No. 6.

2. The anti-CEA antibody of claim 1, wherein the amino acid sequence of the heavy chain variable region of said anti-CEA antibody comprises: an amino acid sequence shown as SEQ ID No. 9;

and the amino acid sequence of the light chain variable region of the anti-CEA antibody comprises: the amino acid sequence shown as SEQ ID No. 10.

3. The anti-CEA antibody of claim 1, wherein said anti-CEA antibody is a single chain antibody, and/or a monoclonal antibody.

4. An isolated polynucleotide encoding the full length amino acid of the anti-CEA antibody of any of claims 1-2.

5. A construct comprising the isolated polynucleotide of claim 4.

6. An antibody expression system comprising the construct or genome of claim 5 having integrated therein an exogenous polynucleotide according to claim 4.

7. The method of preparing an anti-CEA antibody according to any of claims 1-2, comprising the steps of: is suitable for

Culturing the antibody expression system of claim 6 under conditions in which said antibody is expressed, thereby expressing said antibody, and purifying and isolating said antibody.

8. Use of the anti-CEA antibody of any of claims 1-2 in the manufacture of a medicament for the treatment of an antineoplastic agent or for the manufacture of a diagnostic antineoplastic agent.

9. An isolated polypeptide comprising an extracellular domain comprising the anti-CEA antibody of any one of claims 1-2 and a hinge region, a transmembrane domain, and an intracellular domain, the polypeptide consisting of, in order from the N-terminus to the C-terminus, a signal peptide having the amino acid sequence SEQ ID No.22, 3H6 scFv having the amino acid sequence SEQ ID No.23 as the anti-CEA antibody, a CD 8a hinge region and transmembrane region having the amino acid sequence SEQ ID No.24, and an immunoreceptor tyrosine activation motif having the amino acid sequence SEQ ID No.25 as the intracellular domain.

10. A cell comprising a membrane-bound polypeptide of claim 9, which cell is a T lymphocyte and/or NK cell;

and/or, when the polypeptide binds to a CEA antigen, the T lymphocytes and/or NK cells can be activated and/or stimulated to proliferate;

and/or, the T lymphocytes and/or NK cells express the anti-CEA antibody on the surface.

11. A diagnostic kit comprising a diagnostically effective dose of the anti-CEA antibody and/or immunoconjugate thereof according to any one of claims 1-2.