CN116731136A - Application of H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of Saccharomyces cerevisiae - Google Patents
Application of H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of Saccharomyces cerevisiae Download PDFInfo
- Publication number
- CN116731136A CN116731136A CN202310974394.XA CN202310974394A CN116731136A CN 116731136 A CN116731136 A CN 116731136A CN 202310974394 A CN202310974394 A CN 202310974394A CN 116731136 A CN116731136 A CN 116731136A
- Authority
- CN
- China
- Prior art keywords
- histone
- saccharomyces cerevisiae
- acetic acid
- strain
- h3k23a
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 title claims abstract description 96
- 108010033040 Histones Proteins 0.000 title claims abstract description 76
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 title claims abstract description 68
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 title claims abstract description 34
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 title claims abstract description 34
- 240000004808 Saccharomyces cerevisiae Species 0.000 title claims abstract description 32
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 title claims abstract description 32
- 238000000855 fermentation Methods 0.000 title claims abstract description 30
- 230000004151 fermentation Effects 0.000 title claims abstract description 30
- 230000035772 mutation Effects 0.000 title claims abstract description 28
- 238000012216 screening Methods 0.000 claims abstract description 13
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims abstract description 4
- 235000004279 alanine Nutrition 0.000 claims abstract description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 claims description 70
- 239000013612 plasmid Substances 0.000 claims description 14
- 238000004519 manufacturing process Methods 0.000 claims description 6
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 2
- 239000004472 Lysine Substances 0.000 claims description 2
- 101900207313 Saccharomyces cerevisiae Histone H3 Proteins 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 102000006947 Histones Human genes 0.000 abstract description 16
- 150000001413 amino acids Chemical class 0.000 abstract description 9
- 239000003112 inhibitor Substances 0.000 abstract description 8
- 230000004048 modification Effects 0.000 abstract description 8
- 238000012986 modification Methods 0.000 abstract description 8
- 235000001014 amino acid Nutrition 0.000 abstract description 5
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 abstract description 4
- 229910052799 carbon Inorganic materials 0.000 abstract description 4
- 238000010353 genetic engineering Methods 0.000 abstract description 2
- 230000035479 physiological effects, processes and functions Effects 0.000 abstract description 2
- 108090000623 proteins and genes Proteins 0.000 description 19
- 239000007788 liquid Substances 0.000 description 18
- 108020004414 DNA Proteins 0.000 description 16
- 230000001580 bacterial effect Effects 0.000 description 12
- 239000012634 fragment Substances 0.000 description 11
- 239000001963 growth medium Substances 0.000 description 11
- 239000002609 medium Substances 0.000 description 10
- 241000894006 Bacteria Species 0.000 description 8
- 238000000034 method Methods 0.000 description 8
- 239000007787 solid Substances 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 7
- 238000012408 PCR amplification Methods 0.000 description 7
- 239000008103 glucose Substances 0.000 description 7
- 102220471944 Interferon-induced helicase C domain-containing protein 1_K23A_mutation Human genes 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 238000010276 construction Methods 0.000 description 6
- 238000012258 culturing Methods 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 238000001514 detection method Methods 0.000 description 5
- 238000009630 liquid culture Methods 0.000 description 5
- 230000008859 change Effects 0.000 description 4
- 230000001973 epigenetic effect Effects 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 244000005700 microbiome Species 0.000 description 4
- 238000003752 polymerase chain reaction Methods 0.000 description 4
- 235000018102 proteins Nutrition 0.000 description 4
- 102000004169 proteins and genes Human genes 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 238000012795 verification Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 108010077544 Chromatin Proteins 0.000 description 3
- 108700040099 Xylose isomerases Proteins 0.000 description 3
- 210000003483 chromatin Anatomy 0.000 description 3
- 239000000446 fuel Substances 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000002994 raw material Substances 0.000 description 3
- 238000005070 sampling Methods 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 239000002028 Biomass Substances 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 108010047956 Nucleosomes Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102220469115 Thymosin beta-10_K36A_mutation Human genes 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- HYBBIBNJHNGZAN-UHFFFAOYSA-N furfural Chemical compound O=CC1=CC=CO1 HYBBIBNJHNGZAN-UHFFFAOYSA-N 0.000 description 2
- 239000006481 glucose medium Substances 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000005342 ion exchange Methods 0.000 description 2
- PHTQWCKDNZKARW-UHFFFAOYSA-N isoamylol Chemical compound CC(C)CCO PHTQWCKDNZKARW-UHFFFAOYSA-N 0.000 description 2
- 230000037353 metabolic pathway Effects 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 210000001623 nucleosome Anatomy 0.000 description 2
- 238000007747 plating Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- 239000007222 ypd medium Substances 0.000 description 2
- PKAUICCNAWQPAU-UHFFFAOYSA-N 2-(4-chloro-2-methylphenoxy)acetic acid;n-methylmethanamine Chemical compound CNC.CC1=CC(Cl)=CC=C1OCC(O)=O PKAUICCNAWQPAU-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- NOEGNKMFWQHSLB-UHFFFAOYSA-N 5-hydroxymethylfurfural Chemical compound OCC1=CC=C(C=O)O1 NOEGNKMFWQHSLB-UHFFFAOYSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 235000016068 Berberis vulgaris Nutrition 0.000 description 1
- 241000335053 Beta vulgaris Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 229920002488 Hemicellulose Polymers 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 229910009891 LiAc Inorganic materials 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 208000032818 Microsatellite Instability Diseases 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- GZCGUPFRVQAUEE-SLPGGIOYSA-N aldehydo-D-glucose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O GZCGUPFRVQAUEE-SLPGGIOYSA-N 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000006242 butyrylation Effects 0.000 description 1
- 238000010514 butyrylation reaction Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000033629 detection of yeast Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000002803 fossil fuel Substances 0.000 description 1
- 239000002816 fuel additive Substances 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- RJGBSYZFOCAGQY-UHFFFAOYSA-N hydroxymethylfurfural Natural products COC1=CC=C(C=O)O1 RJGBSYZFOCAGQY-UHFFFAOYSA-N 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 238000009776 industrial production Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 229920005610 lignin Polymers 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 238000012269 metabolic engineering Methods 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000011259 mixed solution Substances 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000000243 photosynthetic effect Effects 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 238000011197 physicochemical method Methods 0.000 description 1
- 230000006289 propionylation Effects 0.000 description 1
- 238000010515 propionylation reaction Methods 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000012807 shake-flask culturing Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000010902 straw Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000009750 upstream signaling Effects 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 230000004127 xylose metabolism Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/37—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
- C07K14/39—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from yeasts
- C07K14/395—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from yeasts from Saccharomyces
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/02—Preparation of oxygen-containing organic compounds containing a hydroxy group
- C12P7/04—Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic
- C12P7/06—Ethanol, i.e. non-beverage
- C12P7/08—Ethanol, i.e. non-beverage produced as by-product or from waste or cellulosic material substrate
- C12P7/10—Ethanol, i.e. non-beverage produced as by-product or from waste or cellulosic material substrate substrate containing cellulosic material
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/645—Fungi ; Processes using fungi
- C12R2001/85—Saccharomyces
- C12R2001/865—Saccharomyces cerevisiae
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Mycology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The application relates to an application of saccharomyces cerevisiae H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of saccharomyces cerevisiae, belonging to the technical fields of genetic engineering, molecular biology and physiology. The adopted histone modification disturbance means respectively replaces amino acids which can be subjected to covalent modification in histone H3/H4 in saccharomyces cerevisiae with alanine which cannot be subjected to any modification, so that histone point mutants with different sites are constructed. And then screening histone mutation sites capable of improving acetic acid tolerance and xylose fermentation performance of the saccharomyces cerevisiae. The strain tolerance under the condition of adding inhibitor acetic acid culture and the strain fermentation performance under the condition of taking xylose as the sole carbon source are detected, so that the H3K23A histone point mutation can simultaneously improve the performances of the strain.
Description
Technical Field
The application relates to an application of saccharomyces cerevisiae H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of saccharomyces cerevisiae, belonging to the technical fields of genetic engineering, molecular biology and physiology.
Background
The increasing scarcity of fossil fuels and the growing energy demand have prompted the development of renewable liquid fuels. As a novel renewable fuel additive, the ethanol has wide application prospect. The first-generation fuel ethanol is produced by taking sugar (such as sugarcane, beet and the like) and starch (such as corn, cassava and the like) agricultural raw materials as substrates and fermenting the substrates by microorganisms. The disadvantage of this production mode is obvious, namely the embarrassing situation of 'competing with people for grain and competing with land' caused by the massive consumption of agricultural raw materials, so the idea of producing second-generation fuel ethanol by taking cheap and easily available renewable lignocellulose as fermentation raw materials is favored.
The total amount of lignocellulose produced on the earth annually accounts for about 60% -80% of the total amount of photosynthetic synthetic biomass, and is widely distributed in forest trees, crop straws, urban household garbage and other fiber wastes. Lignocellulose consists of cellulose, hemicellulose and lignin, and because the internal chemical bonds of the high molecular polymer are complex, microorganisms are difficult to directly decompose and utilize the high molecular polymer, and therefore pretreatment (including physical method, chemical method, physicochemical method, subsection combination method, biological method and the like) and hydrolysis are needed, so that the high molecular polymer can be utilized by the microorganisms after being degraded into fermentable monosaccharides. However, in addition to releasing fermentable monosaccharides, primarily glucose and xylose, various fermentation inhibitors, including acetic acid, formic acid, furfural, hydroxymethylfurfural, peroxides, and phenols, etc., are produced, which inhibit the growth of microorganisms and the fermentation process, reducing ethanol yield. Therefore, the micro-ethanol fermentation method is suitable for producing the second-generation ethanol by taking lignocellulose as a raw materialThe organism must not only have the fermentation properties of hydrolyzing the holose component with lignocellulose, but also have a strong inhibitor tolerance. Due to the saccharomyces cerevisiaeSaccharomyces cerevisiae) The strain has the advantages of strong tolerance to ethanol and low pH conditions, insensitivity to phage infection, clear study on physiological characteristics and genetic background, safety, environmental protection and the like, and becomes one of the most potential strains in the field of industrial production of the second-generation ethanol. However, saccharomyces cerevisiae also faces two major challenges in the production of secondary ethanol from lignocellulose: firstly, the saccharomyces cerevisiae has weak tolerance to inhibitors generated in the pretreatment process of lignocellulose; and secondly, the xylose produced by lignocellulose degradation cannot be utilized by the wild saccharomyces cerevisiae, and the xylose utilization capacity of the strain transformed by metabolic pathways is still lower. Therefore, improving the tolerance of Saccharomyces cerevisiae to fermentation inhibitors and the xylose fermentation performance by biotechnology means has become an effective way to solve the bottleneck of lignocellulosic ethanol fermentation.
Classical genetics mainly uses gene function and expression level change caused by gene sequence change as research core, such as gene mutation, gene heterozygous loss, microsatellite instability and the like. Epigenetic is the concept corresponding to classical genetics, and uses the change of gene function and expression level caused by non-gene sequence change as the main research content, such as the generation and erasure of DNA and histone modification, nucleosome translocation, non-coding RNA interference, etc. As one of the important branches of epigenetic science, histone modification mainly occurs in the free N short "tail" of histone, and the modification types include more than 20 kinds of methylation, acetylation, phosphorylation, ubiquitination, thresh, proline isomerization, propionylation, butyrylation, and the like. In addition to directly affecting the interaction between nucleosomes and the structure of chromatin, histone modifications are involved in the physiological metabolic processes of cells in an indirect manner, such as activating or inhibiting effector proteins associated with upstream and downstream signaling pathways, mediating the binding of chromatin remodeling proteins or transcription factors to chromatin, and the like. Currently, there is little research on improving Saccharomyces cerevisiae inhibitor tolerance or xylose fermentation performance by means of epigenetic means, and as a leading edge discipline, the application space of the method in solving the bottleneck of lignocellulose ethanol fermentation is very large.
Disclosure of Invention
Aiming at the problems that the prior saccharomyces cerevisiae strain for producing second-generation ethanol has weak acetic acid tolerance and low xylose fermentation performance in the pretreatment process of lignocellulose, the application discloses a construction method of a histone point mutant, and the obtained H3K23A point mutation can obviously improve the acetic acid tolerance and the xylose fermentation performance of the strain.
The technical scheme of the application is as follows:
a histone point mutation, which is an H3K23A histone point mutation; the H3K23A is formed by mutating lysine at the 23 rd position of saccharomyces cerevisiae histone H3 into alanine;
the amino acid sequence of the H3 histone is shown as SEQ ID No. 1;
the amino acid sequence of the histone after the histone point mutation is shown as SEQ ID No. 2.
Another object of the application is to protect a histone point mutant; the histone point mutant has the H3K23A histone point mutation; then transferring pJFE3-XI plasmid into the plasmid, and screening positive clone by using a flat plate to obtain the plasmid.
The application of the histone point mutant in improving the acetic acid tolerance of saccharomyces cerevisiae.
The application of the histone spot mutant in improving the xylose fermentation performance of saccharomyces cerevisiae.
The application of the histone point mutant in improving the production efficiency of the saccharomyces cerevisiae lignocellulose ethanol is provided.
The construction and screening of the mutant are as follows:
(1) Construction of histone H3/H4 Point mutant
Amino acid sites capable of modification in 19H 3/H4 histones were collected; then BSPC039 strain (available from the university of Shandong Bao Xiaoming teacher, see for details Metabolic Engineering (2012) 9-18) for a set of copies of the H3/H4 encoding geneHHT1-HHF1By usingNatMX4The resistance marker gene was replaced and the modified strain was designated BSPC040. The BSPC040 is taken as an original strain, and the amino acids of the 19 selected sites are respectively replaced by the amino acids which cannot be subjected to any repairDecorated alanine, thereby constructing 19 histone H3/H4 point mutants. The histone point mutant used in the application is constructed based on a Dai Junbiao laboratory presented histone H3/H4 mutant library (Cell 134, 1066-1078, september 19, 2008), and pJFE3-XI plasmid capable of over-expressing Xylose Isomerase (XI) is transferred into 19 histone H3/H4 point mutants and BSPC040 strain serving as a starting strain, so that Saccharomyces cerevisiae has certain xylose metabolism capability, and the 19 histone point mutants and a control strain (BSPC 040 strain transferred into pJFE3-XI plasmid) are obtained for acetic acid tolerance and xylose fermentation performance detection.
(2) Screening of high acetate tolerance histone Point mutants
Firstly, adopting a relatively simple flat plate titration experiment to detect the tolerance of the inhibitor acetic acid of 19H 3/H4 histone point mutants introduced into XI xylose metabolic pathway. The growth of the H3K9A, H K23A and H3K36A mutants on solid media supplemented with 100 mM and 125 mM acetic acid, respectively, was found to be significantly better than that of the control strain. The three histone point mutants and the control bacteria are subjected to shake flask culture in a liquid culture medium taking glucose as a carbon source, and a growth curve is drawn, so that the growth trend of the mutants is nearly consistent with that of the control bacteria. The above strain was cultured in glucose liquid medium supplemented with 50 mM acetic acid, and the obtained growth curve results were consistent with the drop plate experiment results. The H3K9A, H3K23A and H3K36A mutants were shown to be more acetic acid tolerant than the control strain.
(3) Screening of histone point mutants with high xylose fermentation performance
In order to obtain mutant strains with simultaneously improved acetic acid tolerance and xylose fermentation performance, three high acetic acid tolerance histone point mutants obtained by screening are subjected to detection of xylose fermentation performance. After the strain is cultured in a culture medium taking xylose as a sole carbon source and xylose consumption and ethanol yield are detected every 12H samples, only the xylose consumption rate and the ethanol yield of the H3K23A point mutant are higher than those of a control strain, and the growth conditions of other mutant strains are almost consistent with those of the control strain. Through the experiment, the acetic acid tolerance and xylose fermentation performance of the H3K23A point mutant obtained by screening from 19 histone mutants are obviously better than those of a control strain.
The beneficial effects of the application are that
The application obtains the H3K23A mutation site capable of improving the xylose fermentation performance and acetic acid tolerance of the strain for the first time, and the research thinking widens the application value of epigenetic science in the field of second-generation ethanol, and provides technical reference and basis for optimizing the special saccharomyces cerevisiae performance of the second-generation ethanol.
The improvement of the xylose fermentation performance of the saccharomyces cerevisiae can improve the production efficiency of the lignocellulose ethanol of the strain. The improvement of the acetic acid tolerance of the saccharomyces cerevisiae can obviously improve the tolerance of the strain to lignocellulose hydrolysis small molecule inhibitors. The experimental scheme can effectively solve the bottleneck problem of lignocellulose ethanol fermentation.
Drawings
The marker loci in FIG. 1 are the mutation sites of histone H3/H4;
FIG. 2 shows the genes encoding histones H3 and H4HHT1-HHF1AndHHT2-HHF2is a model of the transformation. "four" represents the amino acid mutation site,hhtSrepresents the mutated H3-encoding gene,HHFSrepresents the H4 coding gene which is not mutated,HHT2the gene encoding the histone H3 is provided,HHF2a gene encoding histone H4;
FIG. 3 shows the growth of control strain and 19 histone spot mutants on glucose solid medium without acetic acid and with 100 mM and 125 mM acetic acid, respectively;
FIG. 4 is a plot of growth of control strain and H3K9A, H K23A, H K36A histone spot mutant in glucose medium (20 g/L glucose) without addition of acetic acid and with addition of 50 mM acetic acid, wherein A: strain growth curves without acetic acid addition; b: strain growth curve under culture conditions with addition of 50 mM acetic acid;
FIG. 5 shows the oxygen limiting fermentation capacity of control strain and H3K9A, H K23A, H K36A histone point mutation in liquid medium with xylose as sole carbon source (20 g/L xylose); in the figure, the solid line represents the xylose consumption rate, and the broken line represents the ethanol production rate.
Detailed Description
The types and formulations of the culture media used in this example
YPD medium: 10 g/L yeast powder, 20 g/L peptone, 20 g/L agar powder (solid medium), sterilizing at 115deg.C for 15 min, and adding 20 g/L sterile glucose solution before use to obtain YPD medium.
SC-Ura medium: 1.7 g/L Yeast Nitrogen Base,5 g/L ammonium sulfate, 0.77 g/L CSM-Ura,20 g/L agar powder (solid Medium), and sterilizing at 115℃for 15 min. Adding 20G/L glucose to prepare Sc-Ura+G culture medium, or adding 20G/L xylose to prepare Sc-Ura+X culture medium.
EXAMPLE 1 construction of histone Point mutants Using BSPZ040 as starting Strain
The specific experimental method involved in the histone point mutation construction scheme of the application is as follows:
(1) Extraction of histone Point mutant DNA of S288C as background Strain
To a 1.5 mL EP tube was added 200. Mu.L of DNA extract (2% Triton X-100,1% SDS,100 mM NaCl,10 mM Tris-Cl,1 mM EDTA, pH 8.0). Histone point mutant cells (Cell 134, 1066-1078, september 19, 2008) with S288C as background strain were taken into an EP tube to which 200 μl of DNA extract had been added (fig. 1), while 1.0 g glass beads were added to the EP tube, and 200 μl of phenol was added: chloroform: isoamyl alcohol (25:24:1) solution, vortex shaking, and centrifuging at 12000 and g for 5 min after uniform mixing. Transferring the supernatant to an EP tube containing 1 mL absolute ethanol, mixing, standing for more than 10 min, centrifuging for 10 min at 12000 g, removing supernatant, drying, and adding 35 μl ddH 2 O was prepared as a template DNA solution.
(2) PCR amplification to obtain target fragments H1 and H2
One copy of the gene encoding H3/H4HHT1-HHF1Gene useNatMX4Gene substitution, another copyHHT2-HHF2S288C strain DNA carrying group protein point mutation is used as a template, and PCR amplification is carried out to obtain the DNA containing the left sideHHT1- HHF1The upstream homologous sequence of the gene contains on the right sideHHT1-HHF1Homologous sequence downstream of the gene, comprisingNatMX4Long DNA fragment of geneH1, HHT1F1-A (base sequence shown in SEQ ID No.3, specifically 5'-GTTCTTCATCTCCGGTTCTG-3') and HHT1F1-B (base sequence shown in SEQ ID No.4, specifically 5'-ATTCCGTA ACTCT TCTACCTTC-3') were used as primers. Also as described aboveHHT2-HHF2The DNA of S288C strain carrying group protein point mutation is used as a template, and the primers P3 (the base sequence is shown as SEQ ID No.5, and 5'-CTTGGTACTAATTCCGGAAG-3' in particular) and P4 (the base sequence is shown as SEQ ID No.6, and 5'-TGGTGGATTTTGGAAGG-3' in particular) are used for PCR amplification to obtainHHT2-HHF2DNA sequence H2 containing histone codon mutation, whereinHHT2-HHF2Gene non-coding region carryingURA4A selectable marker gene. Table 1 shows the PCR amplification procedure, and Table 2 shows the PCR amplification conditions.
TABLE 1 PCR amplification procedure
TABLE 2 KOD PCR amplification System
(3) Transfer of H1 fragment into Saccharomyces cerevisiae strain and PCR verification of transformant
Activating BSPC040 original strain, inoculating into YPD liquid culture medium, and adjusting to OD 600 0.2. 30. Culturing cells at temperature of 5000g, centrifuging for 5 min to collect thallus, removing supernatant, adding water to resuspend thallus, centrifuging for 1min at 5000g, and removing supernatant. After re-suspending the cells with 1 mL of 0.1M LiAC, the bacterial suspension was transferred to a 1.5 mL EP tube, centrifuged at 5000g for 1min, the supernatant was removed, then 240 μl of 50% PEG was added to the EP tube, after vortexing, 36 μl of 1M LiAC solution, 30 μl of 2 mg/mL salmon sperm DNA (ssDNA), boiled for 5 min before use, 30 μl of H1 fragment, and vortexing. The EP tube with the mixed solution is placed in a water bath kettle at 30 ℃ for incubation for 30 min, and then transferred to the water bath kettle at 42 ℃ for placement for 20 min. Centrifuging at 5000g for 1min, collecting thallus, removing supernatant, adding 200 μl sterile water, resuspending thallus, and plating 100 μl of thallus solutionSingle colonies were picked from the screening plates on YPD solid plates supplemented with 100 mg/L Nat antibiotic for 3 days at 30℃and shaken using YPD liquid medium at a shaking speed of 200 rpm at 30 ℃. Collecting 2 mL bacteria liquid, extracting genome DNA, and extracting according to the method for extracting histone point mutant DNA. The obtained genomic DNA was used as a template, and HHT1F1-C (base sequence shown as SEQ ID No.7, specifically 5'-GACCAATGTTACTTTGCCTG-3') and HHT1F1-D (base sequence shown as SEQ ID No.8, specifically 5'-GCTCTCAGATATTAATGCCG-3') were used as primers to verify whether the H1 fragment was integrated at the correct site by PCR (FIG. 2), thereby obtaining a positive clone with the genome correctly inserted into the H1 fragment.
(4) Transfer of H2 fragment into Saccharomyces cerevisiae strain and PCR verification of transformant
Transferring H2 fragment into Saccharomyces cerevisiae strain inserted with H1 fragment by LiAC transformation method, screening positive clone by using Ura-deficient plate, picking single colony from the screening plate, shaking by using YPD liquid culture medium, and controlling shaking rotation speed at 200 rpm and temperature at 30deg.C. Collecting 2 mL bacteria liquid, extracting genome DNA, and extracting according to the method for extracting histone point mutant DNA. Using the obtained genomic DNA as a template, the correct integration of the H2 fragment was verified by using P5 (base sequence shown as SEQ ID No.9, specifically 5'-GAGATATACCGTAGC AG TTTCCC-3') and P6 (base sequence shown as SEQ ID No.10, specifically 5'-CTGGAGTAATTTTGAGATTGCG-3') as primers (FIG. 2). Wherein the amino acid sequence before H3 mutation is shown as SEQ ID No.1, specifically MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALR EIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS, the amino acid sequence of H3K23A histone obtained after point mutation is shown as SEQ ID No.2, specifically MARTKQTARKSTGGKAPRKQL ASaAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS, wherein lower case letters are mutation sites.
Table 3 shows the PCR amplification procedure used in PCR verification, and Table 4 shows the PCR amplification conditions used in PCR verification.
TABLE 3 PCR amplification procedure
TABLE 4 PCR amplification System
(5) Transfer of pJFE3-XI plasmid into histone Point mutant
A proper amount of the correctly identified histone spot mutant bacteria was inoculated into YPD liquid medium and cultured overnight at 30℃in a shaking table at 200 rpm. Collecting 10 mL bacteria liquid, plating onto solid plate with 1 g/L5-FOA to obtain genome inserted H2 fragment and missing loxp-URA4The strain of loxp was cultured at 30℃for 3 days. Positive clones were grown overnight at 30℃in a 200 rpm shaker and transformed with LiAcURA4For screening the marked pJFE3-XI plasmid, transferring the plasmid into a correct histone point mutant, screening positive clones by using a plate of Sc-Ura+G after transformation, and completing the construction of the histone point mutant.
Example 2 detection of Yeast tolerance to acetic acid Using plate titration
Control strain CK: BSPC040 starting strain transformed into pJFE3-XI plasmid;
and inoculating a proper amount of constructed 19 histone point mutation bacteria into Sc-Ura+G liquid culture medium, and culturing overnight in a shaking table at 30 ℃ and 200 rpm. Culturing the bacterial liquid to logarithmic phase (OD) 600 0.5-1.0), the bacterial liquid is diluted to OD by the culture medium 600 At 0.5, the concentration of the bacterial liquid at this time was 10 0 Diluting bacterial liquid from left to right ten times to 10 -1 、10 -2 、10 -3 、10 -4 . And (3) dripping 5 mu L of bacterial liquid from each sample on the diluted bacterial liquid from a point plate from left to right to Sc-Ura+G and a Sc-Ura+G solid flat plate added with 100 Mm and 125 mM acetic acid according to the concentration. The plates were left at 30℃for 3 days and the photographed results showed that the growth of the H3K9A, H K23A and H3K36A point mutants on acetic acid solid medium was significantly better than the control strain (FIG. 3).
Example 3 detection of acetic acid tolerance of strains Using growth curves
An appropriate amount of BSPC040 (control strain CK) transferred into pJFE3-XI plasmid and point mutant yeasts H3K9A, H K23A and H3K36A were inoculated into Sc-Ura+G liquid medium and cultured overnight in a shaking table at 30℃and 200 rpm. Culturing the bacterial liquid to logarithmic phase (OD) 600 0.5-1.0), the bacterial liquid is diluted to OD by Sc-Ura+G culture medium 600 Each strain was equally divided into two equal parts after 0.2, acetic acid was added to one part to 50 mM, the two bacterial solutions were continued to be cultured overnight, and samples were taken every 3 h to measure OD 600 After plotting the growth curves, the mutant showed a nearly identical trend in glucose medium with the control bacteria (fig. 4A). Whereas in glucose broth supplemented with 50 mM acetate, the growth of the H3K9A, H K23A and H3K36A mutants was significantly better than the control strain (FIG. 4B).
Example 4 Saccharomyces cerevisiae xylose fermentation Performance detection
Control strain CK: BSPC040 starting strain transformed into pJFE3-XI plasmid;
a proper amount of yeast is inoculated into Sc-Ura+G liquid culture medium and cultured overnight at 30 ℃ in a shaking table at 200 rpm. Culturing the bacterial liquid to logarithmic phase (OD) 600 0.5-1.0), sc-Ura+X is used to dilute the bacterial solution to OD 600 Culturing at 30deg.C and 200 rpm with shaker at 30deg.C, sampling every 12H, centrifuging at 12000 g for 15 min, filtering the supernatant with 0.22 μm filter membrane, and testing the content of xylose and ethanol in the supernatant by high performance liquid chromatograph and Aminex HPX-87H ion exchange column. The column temperature of the ion exchange column was controlled at 45℃using 5 mM H 2 SO 4 As a mobile phase, the flow rate was set to 0.6. 0.6 mL/min, and the measurement of parameters was performed by using a differential refractometer, and the following was a calculation formula of the sample consumption or generation rate.
Note that: r is the utilization or generation rate of the detection object ratio at the time of sampling points m to n; A. b and t are the metabolite concentration, biomass concentration and time at sampling time points n, i and m, respectively.
After examining the xylose consumption and ethanol yield, only the H3K23A mutant showed higher xylose consumption rate and ethanol yield than the control strain, and the other mutant strains showed almost the same growth as the control strain (FIG. 5).
Claims (5)
1. A histone point mutation characterized by a point mutation of histone to an H3K23A histone point mutation; the H3K23A is formed by mutating lysine at the 23 rd position of saccharomyces cerevisiae histone H3 into alanine;
the amino acid sequence of the H3 histone is shown as SEQ ID No. 1;
the amino acid sequence of the histone after the histone point mutation is shown as SEQ ID No. 2.
2. A histone point mutant, characterized in that the histone point mutant carries the H3K23A histone point mutation of claim 1; then transferring pJFE3-XI plasmid into the plasmid, and screening positive clone by using a flat plate to obtain the plasmid.
3. Use of a histone spot mutant according to claim 2 for increasing acetic acid tolerance of saccharomyces cerevisiae.
4. Use of the histone spot mutant according to claim 2 for improving the xylose fermentation performance of saccharomyces cerevisiae.
5. Use of the histone spot mutant according to claim 2 for increasing the efficiency of production of lignocellulosic ethanol by saccharomyces cerevisiae.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310974394.XA CN116731136B (en) | 2023-08-04 | 2023-08-04 | Application of H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of Saccharomyces cerevisiae |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202310974394.XA CN116731136B (en) | 2023-08-04 | 2023-08-04 | Application of H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of Saccharomyces cerevisiae |
Publications (2)
Publication Number | Publication Date |
---|---|
CN116731136A true CN116731136A (en) | 2023-09-12 |
CN116731136B CN116731136B (en) | 2023-12-05 |
Family
ID=87906209
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310974394.XA Active CN116731136B (en) | 2023-08-04 | 2023-08-04 | Application of H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of Saccharomyces cerevisiae |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116731136B (en) |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2003284567A (en) * | 2002-03-29 | 2003-10-07 | Japan Science & Technology Corp | 1 amino acid variant protein of histone h3 and h4, its variant cell and use thereof |
JP2005312462A (en) * | 2005-07-11 | 2005-11-10 | Japan Science & Technology Agency | 1 amino acid variant protein of histone h3 and h4, its variant cell and use thereof |
JP2006129872A (en) * | 2005-12-26 | 2006-05-25 | Japan Science & Technology Agency | Single amino acid mutated protein of histone h4, its mutant cell and use thereof |
CN106755077A (en) * | 2016-12-30 | 2017-05-31 | 华智水稻生物技术有限公司 | Using CRISPR CAS9 technologies to the method for paddy rice CENH3 site-directed point mutations |
WO2017132661A2 (en) * | 2016-01-29 | 2017-08-03 | Oncoceutics, Inc. | G protein-coupled receptor (gpcr) modulation by imipridones |
CN112646020A (en) * | 2019-10-11 | 2021-04-13 | 南通睿科医药科技有限公司 | Antigenic peptide based on histone H3K27M mutant peptide and application thereof |
CN115974990A (en) * | 2023-02-27 | 2023-04-18 | 山东大学 | Saccharomyces cerevisiae Rim15 protein mutant and application thereof |
-
2023
- 2023-08-04 CN CN202310974394.XA patent/CN116731136B/en active Active
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2003284567A (en) * | 2002-03-29 | 2003-10-07 | Japan Science & Technology Corp | 1 amino acid variant protein of histone h3 and h4, its variant cell and use thereof |
JP2005312462A (en) * | 2005-07-11 | 2005-11-10 | Japan Science & Technology Agency | 1 amino acid variant protein of histone h3 and h4, its variant cell and use thereof |
JP2006129872A (en) * | 2005-12-26 | 2006-05-25 | Japan Science & Technology Agency | Single amino acid mutated protein of histone h4, its mutant cell and use thereof |
WO2017132661A2 (en) * | 2016-01-29 | 2017-08-03 | Oncoceutics, Inc. | G protein-coupled receptor (gpcr) modulation by imipridones |
CN106755077A (en) * | 2016-12-30 | 2017-05-31 | 华智水稻生物技术有限公司 | Using CRISPR CAS9 technologies to the method for paddy rice CENH3 site-directed point mutations |
CN112646020A (en) * | 2019-10-11 | 2021-04-13 | 南通睿科医药科技有限公司 | Antigenic peptide based on histone H3K27M mutant peptide and application thereof |
CN115974990A (en) * | 2023-02-27 | 2023-04-18 | 山东大学 | Saccharomyces cerevisiae Rim15 protein mutant and application thereof |
Non-Patent Citations (1)
Title |
---|
何斐: "组蛋白位点或修饰对细胞自噬的调控研究", 中国优秀硕士学位论文全文数据库基础科学辑, pages 21 * |
Also Published As
Publication number | Publication date |
---|---|
CN116731136B (en) | 2023-12-05 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Herring et al. | Strain and bioprocess improvement of a thermophilic anaerobe for the production of ethanol from wood | |
US10686205B2 (en) | Biofuel and electricity producing fuel cells and systems and methods related to same | |
CN109207373B (en) | Microbial strain for high yield of citric acid and method for producing citric acid by fermenting starch sugar through microbial strain | |
JP2013545491A (en) | Enhancement of ethanol production by xylose-utilizing zymomonas mobilis in biomass hydrolyzate medium | |
US8329444B2 (en) | Strains of zymomonas mobilis for fermentation of biomass | |
CN106460004A (en) | Biological platform for production of commodity chemicals | |
Sidana et al. | Assessment of the ability of Meyerozyma guilliermondii P14 to produce second-generation bioethanol from giant reed (Arundo donax) biomass | |
CN112280700B (en) | Acetic acid and formic acid resistant fermentation strain and construction method thereof | |
CN116731136B (en) | Application of H3K23A histone point mutation in improving acetic acid tolerance and xylose fermentation performance of Saccharomyces cerevisiae | |
CN102229966B (en) | Method for preparing ethanol by fermenting jerusalem artichoke through recombinant saccharomyces cerevisiae | |
CN109609540B (en) | Recombinant saccharomyces cerevisiae strain and preparation method and application thereof | |
CN115806922A (en) | Genetically engineered strain of zymomonas mobilis and application thereof | |
CN105176904A (en) | Genetic engineering strain Streptomyces tsukubaensis L21 and application thereof | |
KR101599997B1 (en) | A novel thermostable yeast Pichia guilliermondii Y-2 and use thereof | |
CN109182185A (en) | The ethyl alcohol production Zymomonas mobilis strain and its separating screening method of the low pH of one plant of tolerance and application | |
CN110713940B (en) | High-yield heavy oil aureobasidium pullulans strain and construction method and application thereof | |
CN116716321B (en) | Application of HMX1 and encoding gene thereof in improving fermentation performance and acetic acid tolerance of saccharomyces cerevisiae xylose | |
CN114854607B (en) | High-temperature-resistant saccharomyces cerevisiae, fermenting agent, application of high-temperature-resistant saccharomyces cerevisiae and fermenting agent, and ethanol production method | |
CN116103178B (en) | Copper-resistant pichia pastoris strain with high copper enrichment and application thereof | |
CN117070379B (en) | Recombinant Neurospora crassa and application thereof | |
CN113773973B (en) | Yeast capable of tolerating high-concentration furfural and application thereof | |
US20230227861A1 (en) | Gene duplications for crabtree-warburg-like aerobic xylose fermentation | |
CN112322513A (en) | Acetic acid and furfural resistant fermentation strain and construction method thereof | |
de Melo Pereira et al. | Microorganisms and Genetic Improvement for First and Second Generation Bioethanol Production | |
CN116121141A (en) | High-yield inositol bacillus amyloliquefaciens and construction method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |