CN116536282A - Human uricase gene, cloning expression method thereof and application of human uricase - Google Patents
Human uricase gene, cloning expression method thereof and application of human uricase Download PDFInfo
- Publication number
- CN116536282A CN116536282A CN202310736039.9A CN202310736039A CN116536282A CN 116536282 A CN116536282 A CN 116536282A CN 202310736039 A CN202310736039 A CN 202310736039A CN 116536282 A CN116536282 A CN 116536282A
- Authority
- CN
- China
- Prior art keywords
- uricase
- human
- gene
- expression
- recombinant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108010092464 Urate Oxidase Proteins 0.000 title claims abstract description 118
- 238000000034 method Methods 0.000 title claims abstract description 35
- 238000010367 cloning Methods 0.000 title claims abstract description 20
- 238000003259 recombinant expression Methods 0.000 claims abstract description 23
- 239000013612 plasmid Substances 0.000 claims abstract description 15
- 239000006228 supernatant Substances 0.000 claims abstract description 15
- 238000012258 culturing Methods 0.000 claims abstract description 12
- 230000001939 inductive effect Effects 0.000 claims abstract description 8
- 241001052560 Thallis Species 0.000 claims abstract description 7
- 239000002773 nucleotide Substances 0.000 claims abstract description 7
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 7
- 241000894006 Bacteria Species 0.000 claims abstract description 6
- 230000001131 transforming effect Effects 0.000 claims abstract description 4
- 108090000623 proteins and genes Proteins 0.000 claims description 23
- 239000013598 vector Substances 0.000 claims description 15
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 claims description 14
- 229960000723 ampicillin Drugs 0.000 claims description 14
- 238000005119 centrifugation Methods 0.000 claims description 13
- 239000003814 drug Substances 0.000 claims description 13
- 239000002609 medium Substances 0.000 claims description 11
- 238000001976 enzyme digestion Methods 0.000 claims description 10
- 102000003960 Ligases Human genes 0.000 claims description 6
- 108090000364 Ligases Proteins 0.000 claims description 6
- 230000000593 degrading effect Effects 0.000 claims description 6
- 108091008146 restriction endonucleases Proteins 0.000 claims description 6
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 5
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 claims description 5
- 230000008569 process Effects 0.000 claims description 5
- 230000003197 catalytic effect Effects 0.000 claims description 4
- 239000001963 growth medium Substances 0.000 claims description 4
- 239000002054 inoculum Substances 0.000 claims description 4
- 238000009210 therapy by ultrasound Methods 0.000 claims description 4
- 230000006698 induction Effects 0.000 claims description 3
- 238000002360 preparation method Methods 0.000 claims description 2
- 230000000694 effects Effects 0.000 abstract description 26
- 201000005569 Gout Diseases 0.000 abstract description 11
- 201000001431 Hyperuricemia Diseases 0.000 abstract description 10
- 241000124008 Mammalia Species 0.000 abstract description 4
- 238000010353 genetic engineering Methods 0.000 abstract description 2
- 230000005965 immune activity Effects 0.000 abstract description 2
- 208000024891 symptom Diseases 0.000 abstract description 2
- 108700026220 vif Genes Proteins 0.000 abstract description 2
- TVWHNULVHGKJHS-UHFFFAOYSA-N Uric acid Natural products N1C(=O)NC(=O)C2NC(=O)NC21 TVWHNULVHGKJHS-UHFFFAOYSA-N 0.000 description 39
- 229940116269 uric acid Drugs 0.000 description 39
- LEHOTFFKMJEONL-UHFFFAOYSA-N Uric Acid Chemical compound N1C(=O)NC(=O)C2=C1NC(=O)N2 LEHOTFFKMJEONL-UHFFFAOYSA-N 0.000 description 38
- 102000004190 Enzymes Human genes 0.000 description 18
- 108090000790 Enzymes Proteins 0.000 description 18
- 102000004169 proteins and genes Human genes 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 12
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 10
- 239000000047 product Substances 0.000 description 8
- 108020004705 Codon Proteins 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 210000004027 cell Anatomy 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 229910052759 nickel Inorganic materials 0.000 description 5
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 238000010828 elution Methods 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 241000282412 Homo Species 0.000 description 3
- 230000009102 absorption Effects 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 229910021538 borax Inorganic materials 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- UQGFMSUEHSUPRD-UHFFFAOYSA-N disodium;3,7-dioxido-2,4,6,8,9-pentaoxa-1,3,5,7-tetraborabicyclo[3.3.1]nonane Chemical compound [Na+].[Na+].O1B([O-])OB2OB([O-])OB1O2 UQGFMSUEHSUPRD-UHFFFAOYSA-N 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 235000010339 sodium tetraborate Nutrition 0.000 description 3
- 239000004328 sodium tetraborate Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 238000012795 verification Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 108020004485 Nonsense Codon Proteins 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- POJWUDADGALRAB-UHFFFAOYSA-N allantoin Chemical compound NC(=O)NC1NC(=O)NC1=O POJWUDADGALRAB-UHFFFAOYSA-N 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 239000000287 crude extract Substances 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 210000003097 mucus Anatomy 0.000 description 2
- 230000037434 nonsense mutation Effects 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- MWBWWFOAEOYUST-UHFFFAOYSA-N 2-aminopurine Chemical compound NC1=NC=C2N=CNC2=N1 MWBWWFOAEOYUST-UHFFFAOYSA-N 0.000 description 1
- 208000009304 Acute Kidney Injury Diseases 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- 208000007848 Alcoholism Diseases 0.000 description 1
- POJWUDADGALRAB-PVQJCKRUSA-N Allantoin Natural products NC(=O)N[C@@H]1NC(=O)NC1=O POJWUDADGALRAB-PVQJCKRUSA-N 0.000 description 1
- 241000228197 Aspergillus flavus Species 0.000 description 1
- 101000767281 Aspergillus flavus Uricase Proteins 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241001251371 Betula chinensis Species 0.000 description 1
- 206010004716 Binge eating Diseases 0.000 description 1
- 208000032841 Bulimia Diseases 0.000 description 1
- 206010007027 Calculus urinary Diseases 0.000 description 1
- 235000010523 Cicer arietinum Nutrition 0.000 description 1
- 244000045195 Cicer arietinum Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 241000235646 Cyberlindnera jadinii Species 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 241001025319 Etheostoma collis Species 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 101000821903 Homo sapiens Solute carrier family 22 member 12 Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 208000000913 Kidney Calculi Diseases 0.000 description 1
- 208000001145 Metabolic Syndrome Diseases 0.000 description 1
- 206010029148 Nephrolithiasis Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 108700020962 Peroxidase Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 208000033626 Renal failure acute Diseases 0.000 description 1
- 102100021495 Solute carrier family 22 member 12 Human genes 0.000 description 1
- 101000608029 Sus scrofa Uricase Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 208000009911 Urinary Calculi Diseases 0.000 description 1
- 108010093894 Xanthine oxidase Proteins 0.000 description 1
- 102100033220 Xanthine oxidase Human genes 0.000 description 1
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 201000011040 acute kidney failure Diseases 0.000 description 1
- 208000012998 acute renal failure Diseases 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 201000007930 alcohol dependence Diseases 0.000 description 1
- 229960000458 allantoin Drugs 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- OFCNXPDARWKPPY-UHFFFAOYSA-N allopurinol Chemical compound OC1=NC=NC2=C1C=NN2 OFCNXPDARWKPPY-UHFFFAOYSA-N 0.000 description 1
- 229960003459 allopurinol Drugs 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 238000009412 basement excavation Methods 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 210000000941 bile Anatomy 0.000 description 1
- 208000014679 binge eating disease Diseases 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000009776 industrial production Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 235000021374 legumes Nutrition 0.000 description 1
- 230000031700 light absorption Effects 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 230000005976 liver dysfunction Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 239000005445 natural material Substances 0.000 description 1
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 1
- 210000002824 peroxisome Anatomy 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 230000009103 reabsorption Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical class OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000003064 xanthine oxidase inhibitor Substances 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
- C12N9/0044—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on other nitrogen compounds as donors (1.7)
- C12N9/0046—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on other nitrogen compounds as donors (1.7) with oxygen as acceptor (1.7.3)
- C12N9/0048—Uricase (1.7.3.3)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/06—Antigout agents, e.g. antihyperuricemic or uricosuric agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y107/00—Oxidoreductases acting on other nitrogenous compounds as donors (1.7)
- C12Y107/03—Oxidoreductases acting on other nitrogenous compounds as donors (1.7) with oxygen as acceptor (1.7.3)
- C12Y107/03003—Factor-independent urate hydroxylase (1.7.3.3), i.e. uricase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/185—Escherichia
- C12R2001/19—Escherichia coli
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Abstract
The invention provides a human uricase gene, a cloning expression method thereof and application of the human uricase, and relates to the technical field of genetic engineering, wherein the nucleotide sequence of the human uricase gene is shown as SEQ ID NO.3, and the cloning expression method of the human uricase gene comprises the following steps: preparing recombinant plasmid pET32a-Uricase from the humanized Uricase gene; transforming into host bacteria to obtain recombinant expression strain pET32a-Uricase-E.coliBL21 (DE 3) codonplus RIL; culturing and then inducing expression; collecting induced expression thalli, carrying out ultrasonic crushing, and collecting supernatant to obtain the humanized uricase solution. The uricase expressed by the humanized uricase gene disclosed by the invention maintains the activity of the uricase from mammals, reduces the immune activity applicable to human bodies, and is more applicable to gout treatment caused by hyperuricemia and other symptoms.
Description
Technical Field
The invention relates to the technical field of genetic engineering, in particular to a humanized uricase gene, a cloning expression method thereof and application of the humanized uricase.
Background
Uric acid is a metabolic catalyst product of purine formation in general human and higher and primate mammals through metabolic catalysis. Uric acid has two main sources: one is uric acid (endogenous) produced in vivo by the catabolism of a nucleic acid-rich protein, accounting for about 80% of total uric acid; another uric acid is the catabolism of amino purine-rich foods to nucleotide (purine exogenous) nucleic acids in vitro, accounting for only about 20% of total uric acid in vitro and in vivo. Uric acid in humans fed at normal times forms an uric acid pool in an average of 1200mg, and can be produced in an average of about 750mg daily, with 500-l 000mg excreted. 70% of the uric acid in the body is excreted by mucus through the kidneys and 30% by mucus through bile and other intestinal tracts.
The human uricase pseudogene assumes that the codons can be transcribed in the human liver cell code, but the uricase with good functionality cannot be expressed normally due to nonsense mutations at the 33 and 187 positions of the gene, and transcripts are unstable due to the incorporation of nonsense gene mutations, so that researchers correct the nonsense mutations, but fail to restore uricase activity. Primate uricase coding regions also undergo a number of deleterious mutations during evolution that render them incapable of forming tetramers in active form. Functional uricase cannot be expressed due to false inheritance of human uricase. Thus, human serum uric acid levels are high. Hyperuricemia can lead to hyperuricemia, patients with long-term uricemia can develop gout, and kidney stones can also be formed directly. Gout is formed in response to a variety of factors, such as binge eating adenine-rich acidic foods, alcoholism, age, sex, etc. Along with the continuous improvement of the living standard of people, the clinical incidence rate of gout worldwide is in an annual rising trend. For patients after tumor cell therapy, a large number of tumor cells die and release a large amount of DNA and RNA, resulting in a dramatic increase in uric acid levels in the patient. Problems that would occur without analytical treatment would directly result in acute renal failure in the patient. Long-term hyperuricemia in humans is associated with the degree of morbidity of metabolic disorder syndrome and bronchitis in heart blood. Thus, long-term uricase inhibition inactivation in primate mammals has in the past probably been another important selective evolutionary advantage in primate mammalian individuals throughout the course of their evolution, but now is more likely to cause gout and other diseases in humans, and the like. Therefore, developing uricase medicine can effectively compensate the loss of related diseases (gout, hyperuricemia, metabolic syndrome and the like) caused by human uricase deficiency.
Currently, methods for reducing uric acid accumulation to treat gout and hyperuricemia include three types, mainly classified into uric acid production inhibiting drugs (Xanthine oxidase inhibitors, XOIs) targeting xanthine oxidase, uric acid excretion promoting drugs (urecosucs) targeting URAT1 to inhibit renal uric acid reabsorption, and uric acid oxidase drugs (urecase). The medicament for inhibiting uric acid generation and the medicament for promoting uric acid excretion have different degrees of adverse effects, wherein the medicament for inhibiting uric acid generation has low standard reaching rate of treatment effect in the process of reducing uric acid and allopurinol allergy syndrome. Uric acid excretion-promoting drugs are prone to urinary calculus formation during uric acid lowering and interact with a variety of drugs, including beta-lactams and non-steroidal anti-inflammatory drugs. And is prone to liver dysfunction. However, uricase is capable of efficiently degrading uric acid to form allantoin with higher solubility, and has irreplaceable significance in treating gout and hyperuricemia.
It has now been found that species of active uricase include nodules of legumes (soybean, chick pea), livers of mammals (rabbit, rat, pig, cow, dog, baboon) and many microorganisms (Bacillus fastistidio-sus, candidautilis, aspergillusflavus). Uricase is widely available from a variety of sources, and can be present in mammalian peroxidases in the form of crystals of natural material in a major component of peroxisome pseudocores. The enzyme activities of uricase from different sources vary significantly. The most active uricase is recombinant Aspergillus flavus uricase, and the activity reaches 18.2U/mg. Uricase from mammals, after recombinant expression, can reach 5U/mg of pig uricase activity. In addition, in uricase of homogeneous origin, the activity of the naturally extracted uricase is lower than that of the recombinant expressed uricase. The reason may be due to different aggregate forms and different tetrameric structures of uricase. The differences in activity and thus uricase efficacy are also evident due to the different aggregation modes.
Therapeutic proteins are recognized by antigens and taken up by cells after entering the human body, degraded in lysosomes within the cells into polypeptide fragments having different sequences, and some polypeptides having specific sequences bind to specific molecules in the cells and are delivered to the cell surface, by activating T cells and further activating B cells, specific antibodies are produced which bind to therapeutic proteins and produce a series of immunogenic reactions. Humanization of uricase is the primary method of deimmunization. The appearance of immunogenicity is mainly that of exogenous genes by substituting the exogenous genes with human amino acid sequences. Research shows that the humanized gene is favorable to the immunity eliminating effect, and the humanized modification makes the uricase similar to the original uricase gene, so that the uricase has longer half life and brings innumerable welfare to the patient.
Therefore, the excavation of human uricase with high enzyme activity is of great significance to the future defense of diseases caused by uric acid.
Disclosure of Invention
The invention aims to provide a humanized uricase gene and a cloning expression method thereof, wherein the uricase expressed by the humanized uricase gene maintains the activity of uricase from mammals, reduces the immune activity applicable to human bodies, improves the physicochemical properties of uricase, and is more applicable to gout treatment caused by hyperuricemia and other symptoms.
In order to achieve the above object, the present invention provides the following technical solutions:
the invention provides a humanized uricase gene, the nucleotide sequence of which is shown in SEQ ID NO. 3:
atggcccattatcacaacaactacaaaaaaaacgacgaagtggaatttgtgcgtaccggttatggtaaagaaatggttaaagtgctgcatattcagcgcgacggtaaatatcatagcattaaagaagttgcaaccagcgttcagctgaccctgagcagcaaaaaagattatctgcatggtgataacagcgatattattccgaccgataccattaaaaacaccgttcatgttctggccaagtttaaagagatcaaaagcattgaagccttcggcgtgaatatctgtgaacattttctgagcagcttcaaccatgttattcgtgcacaggtttatatggaagaaatcccgtggaaacatctgggtaaaattggtgttaaacacgtgcatgcctttattgaaaccccgaccggtacacatttttgtgaagttgaacagctgcgtagcggtccgcaggttattcatagcggtattaaagatctgaaggtgctgaaaaccacacagagcggttttgaaggttttatcaaagatcagtttaccacactgccggaagttaaagatcgttgttttgcaacccaggtgtattgcaaatggcgttatcatcagtgtcgtgatgttgattttaaagcaacctgggataccattcgtgatctggtgatggaaaaatttgcaggtccgtatgataaaggcgaatatagcaccagcgtgcagaaaaccctgtatgatattcaggttctgagcctgagccgtgttccggcaattgaagatatggaaattagcctgccgaacatccactatttcaacatcgatatgagcaaaatgggcctgatcaacaaagaagaagttctgctgccgctggataatccgtatggtaaaatcaccggcaccgttaaacgtaaactgagcagccgtctgtaa。
the invention also provides the human uricase with catalytic activity expressed by cloning the human uricase gene, and the amino acid sequence of the human uricase is shown as SEQ ID NO. 4:
MAHYHNNYKKNDEVEFVRTGYGKEMVKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKEIKSIEAFGVNICEHFLSSFNHVIRAQVYMEEIPWKHLGKIGVKHVHAFIETPTGTHFCEVEQLRSGPQVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQCRDVDFKATWDTIRDLVMEKFAGPYDKGEYSTSVQKTLYDIQVLSLSRVPAIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVKRKLSSRL。
the invention also provides a recombinant vector for expressing the human uricase gene, which comprises an initial vector and the human uricase gene.
The invention also provides a recombinant strain for expressing the human uricase gene, and the recombinant strain is transformed with the recombinant vector.
The invention also provides a clone expression method of the humanized uricase gene, which comprises the following steps:
(1) Respectively carrying out enzyme digestion on the humanized Uricase gene and the pET32a vector, and connecting to obtain a recombinant plasmid pET32a-Uricase;
(2) Transforming the recombinant plasmid pET32 a-UIICAse into host bacteria to obtain a recombinant expression strain pET32 a-UIICAse-E.coli BL21 (DE 3) code plus RIL;
(3) Culturing the recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL in the step (2), and then inducing expression;
(4) And (3) centrifugally collecting the induced expression thalli in the step (3), performing ultrasonic crushing, and collecting the supernatant to obtain the humanized uricase solution.
Preferably, the restriction enzyme in step (1) is a double restriction enzyme using restriction enzymes Nco I and Xho I, and the ligation ligase is a 2X ClonExpress Mix ligase.
Preferably, the specific method for culturing the recombinant expression strain in step (3) comprises the steps of:
inoculating recombinant expression strain pET32 a-Uricase-E.coll BL21 (DE 3) codon plus RIL into an LB medium containing ampicillin, culturing overnight at 37 ℃ for 12-18 h, and inoculating the strain into the LB medium containing ampicillin according to an inoculum size of 0.5-1.5%;
the concentration of ampicillin in the LB culture medium containing the ampicillin is 40-60 mg/mL.
Preferably, the specific step of inducing expression in step (3) comprises:
OD of recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL 600 When the expression is carried out in the range of 0.6 to 0.8, IPTG with the concentration of 0.05 to 0.15mM is added, and the induction expression is carried out for 3 to 5 hours at 37 ℃.
Preferably, in the step (4), the temperature of the centrifugation is 0-8 ℃, the rotating speed of the centrifugation is 7000-7800 rpm, and the time of the centrifugation is 20-30 min; the temperature of the ultrasonic crushing is 0-4 ℃, intermittent ultrasonic treatment is carried out in the ultrasonic crushing process, the ultrasonic is carried out for 1S, and the interval is 2S; the total time of ultrasonic crushing is 15-25 min; the supernatant is collected by adopting a mode of centrifugation at 11000-13000 rpm for 20-30 min at 0-8 ℃.
The invention also provides the application of the human uricase and the human uricase obtained by the cloning expression method of the human uricase gene in preparing medicaments for degrading uricase.
The invention has the technical effects and advantages that:
1. the invention obtains the nucleotide sequence of the humanized uricase gene for the first time, has low cost, simple molecular level operation, easy clone expression and good repeatability, and has potential application value in industrial production;
2. the invention constructs the humanized uricase nuclear expression vector, successfully obtains the enzyme protein with the molecular weight of about 54kDa, has good protein expression effect, high enzyme activity and simple preparation process, and provides a simple method for the function recovery research of the humanized uricase;
3. the humanized uricase has higher degradation activity on the uricase, is a protein for specifically degrading uric acid, and has good production prospect in industrialized production of the uricase and high-efficiency application in human bodies to form the medicine for treating gout and hyperuricemia.
Drawings
FIG. 1 shows the SDS-PAGE detection result of the human uricase of the invention (M: color Prestained Protenin Marker;1: total protein after cell disruption; 2: crude extract of human uricase as cell-disrupted supernatant; 3: nickel column flow-through; 4: hybrid protein after elution of nickel column with 10ml of 20mM imidazole; 5: hybrid protein after elution of nickel column with 100ml of 20mM imidazole; 6: hybrid protein after elution of nickel column with 200ml of 20mM imidazole; 7: target protein after elution of nickel column with 500mM imidazole);
FIG. 2 is a graph showing the standard curve of the activity of the human uricase of the present invention.
Detailed Description
The invention provides a humanized uricase gene, the nucleotide sequence of which is shown in SEQ ID NO. 3:
atggcccattatcacaacaactacaaaaaaaacgacgaagtggaatttgtgcgtaccggttatggtaaagaaatggttaaagtgctgcatattcagcgcgacggtaaatatcatagcattaaagaagttgcaaccagcgttcagctgaccctgagcagcaaaaaagattatctgcatggtgataacagcgatattattccgaccgataccattaaaaacaccgttcatgttctggccaagtttaaagagatcaaaagcattgaagccttcggcgtgaatatctgtgaacattttctgagcagcttcaaccatgttattcgtgcacaggtttatatggaagaaatcccgtggaaacatctgggtaaaattggtgttaaacacgtgcatgcctttattgaaaccccgaccggtacacatttttgtgaagttgaacagctgcgtagcggtccgcaggttattcatagcggtattaaagatctgaaggtgctgaaaaccacacagagcggttttgaaggttttatcaaagatcagtttaccacactgccggaagttaaagatcgttgttttgcaacccaggtgtattgcaaatggcgttatcatcagtgtcgtgatgttgattttaaagcaacctgggataccattcgtgatctggtgatggaaaaatttgcaggtccgtatgataaaggcgaatatagcaccagcgtgcagaaaaccctgtatgatattcaggttctgagcctgagccgtgttccggcaattgaagatatggaaattagcctgccgaacatccactatttcaacatcgatatgagcaaaatgggcctgatcaacaaagaagaagttctgctgccgctggataatccgtatggtaaaatcaccggcaccgttaaacgtaaactgagcagccgtctgtaa。
the humanized uricase gene (SEQ ID NO. 3) is obtained by modifying an original gene sequence SEQ ID NO.1, and the original gene sequence is shown as SEQ ID NO. 1:
atggcccactaccataacaactataaaaagaatgatgaggtggagtttgtccgaactggctatgggaaggaaatggtaaaagttctccatattcagtgagatggaaaatatcacagcattaaagaggtggcaacttcagtgcaacttactctaagttccaaaaaagattacctgcatggagataattcagacatcatccctacagacaccatcaagaacacagttcatgtcttggcaaagtttaaagaaatcaaaagcatagaagcctttggtgtgaatatttgtgagcattttctttcttcttttaaccatgtaatccgagctcaagtctacatggaagaaatcccttggaagcatcttggaaagaatggagttaagcatgtccatgcatttattcacactcccactggaacacacttctgtgaagttgaacagctgagaagtggaccccaagtcattcattctggaatcaaagacctcaaggtcttgaaaacaacacagtctggatttgaaggtttcatcaaggaccagttcactaccctccctgaggtgaaggactgatgctttgccacccaagtgtactgcaagtggcgctaccaccagtgcagggatgtggacttcaaggctacctgggacaccattcgggaccttgtcatggagaaatctgctgggccctatgacaaaggtgaatacttgacctctgtgcagaagaccctctgtgatatccaggtgctctccctgagccgagttcctgggatagaagatatggaaatcagcctgccaaacattcactacttcaacatagacatgtccaaaatgggtctgatcaacaaggaagaggtcttgctgccattagacaatccatatggaaaaattactggtacagtcaagaggaagttgtcttcaagactgtga。
the invention also provides the human uricase with catalytic activity expressed by cloning the human uricase gene, and the amino acid sequence of the human uricase is shown as SEQ ID NO. 4:
MAHYHNNYKKNDEVEFVRTGYGKEMVKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKEIKSIEAFGVNICEHFLSSFNHVIRAQVYMEEIPWKHLGKIGVKHVHAFIETPTGTHFCEVEQLRSGPQVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQCRDVDFKATWDTIRDLVMEKFAGPYDKGEYSTSVQKTLYDIQVLSLSRVPAIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVKRKLSSRL。
the original amino acid sequence of the humanized uricase (SEQ ID NO. 4) is shown as SEQ ID NO. 2:
MAHYHNNYKKNDEVEFVRTGYGKEMVKVLHIQDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKEIKSIEAFGVNICEHFLSSFNHVIRAQVYMEEIPWKHLGKNGVKHVHAFIHTPTGTHFCEVEQLRSGPQVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDCFATQVYCKWRYHQCRDVDFKATWDTIRDLVMEKSAGPYDKGEYLTSVQKTLCDIQVLSLSRVPGIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVKRKLSSRL。
the invention also provides a recombinant vector for expressing the human uricase gene, which comprises an initial vector and the human uricase gene.
The invention also provides a recombinant strain for expressing the human uricase gene, and the recombinant strain is transformed with the recombinant vector.
The invention also provides a clone expression method of the humanized uricase gene, which comprises the following steps:
(1) Respectively carrying out enzyme digestion on the humanized Uricase gene and the pET32a vector, and connecting to obtain a recombinant plasmid pET32a-Uricase;
(2) Transforming the recombinant plasmid pET32 a-UIICAse into host bacteria to obtain a recombinant expression strain pET32 a-UIICAse-E.coli BL21 (DE 3) code plus RIL;
(3) Culturing the recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL in the step (2), and then inducing expression;
(4) And (3) centrifugally collecting the induced expression thalli in the step (3), performing ultrasonic crushing, and collecting the supernatant to obtain the humanized uricase solution.
In the cloning and expressing method of the humanized Uricase gene, the step (1) is to respectively carry out enzyme digestion on the humanized Uricase gene and the pET32a vector, and obtain recombinant plasmid pET32a-Uricase after connection; the preferable PCR method is adopted to amplify the human uricase gene before the treatment in the step (1); the humanized uricase gene in the step (1) is preferably a nucleotide sequence shown as SEQ ID NO. 3; the enzyme used for the enzyme digestion is preferably restriction enzymes Nco I and Xho I, and double enzyme digestion is carried out; the ligase for ligation is preferably 2X ClonExpress Mix ligase.
In the cloning and expressing method of the humanized Uricase gene, the step (2) converts the recombinant plasmid pET32a-Uricase obtained in the step (1) into host bacteria to obtain a recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL; after transformation, preferably performing PCR screening to obtain positive transformants, and determining target clone strains after sequencing; the host bacterium is preferably E.coli DH5a; then converting plasmid pET32a-Uricase extracted from clone strain pET32 a-Uricase-E.colli DH5a into E.colli BL21 (DE 3) code plus RIL, extracting positive transformant and directly culturing so as to obtain recombinant expression strain pET32 a-Uricase-E.colli BL21 (DE 3) code plus RIL.
In the cloning and expressing method of the humanized Uricase gene, step (3) is to culture the recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL in step (2), and then induce the expression; preferably, the specific method of culturing the recombinant expression strain comprises the steps of: inoculating recombinant expression strain pET32 a-Uricase-E.coll BL21 (DE 3) codon plus RIL into an LB medium containing ampicillin, culturing overnight at 37 ℃ for 12-18 h, and inoculating the strain into the LB medium containing ampicillin according to an inoculum size of 0.5-1.5%; the ampicillin concentration in the LB medium containing the ampicillin is preferably 40-60 mg/mL, more preferably 45-55 mg/mL, and even more preferably 48-52 mg/mL; the time of the culture is preferably 12 to 18 hours, more preferably 13 to 17 hours, still more preferably 14 to 16 hours; the inoculation amount is preferably 0.5 to 1.5%, more preferably 0.6 to 1.4%, still more preferably 0.8 to 1.2%.
In the cloning and expressing method of the humanized Uricase gene, the step (3) is to culture a recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL and then induce the expression, and preferably, the specific steps of the expression induction in the step (3) comprise the following steps: OD of recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) code plus RIL 600 When the concentration is=0.6 to 0.8, adding IPTG with the concentration of 0.05 to 0.15mM, and inducing the expression for 3 to 5 hours at the temperature of 37 ℃; the OD is 600 The value is further preferably 0.7; the concentration of IPTG is 0.05-0.15 mM, more preferably 0.08-0.12 mM; the time for inducing expression is 3 to 5 hours, more preferably 3.5 to 4.5 hours.
In the cloning and expressing method of the humanized uricase gene, the step (4) is to centrifugally collect the induced expression thalli in the step (3), ultrasonically crush and collect the supernatant to obtain the humanized uricase solution; the temperature of the centrifugation is preferably 0 to 8 ℃, more preferably 2 to 6 ℃, still more preferably 3 to 5 ℃; the rotational speed of the centrifugation is preferably 7000 to 7800rpm, more preferably 7200 to 7600rpm, still more preferably 7300 to 7500rpm; the centrifugation time is preferably 20 to 30 minutes, more preferably 22 to 28 minutes, and still more preferably 24 to 26 minutes; the temperature of the ultrasonic crushing is preferably 0-4 ℃, more preferably 1-3 ℃, and even more preferably 2 ℃; the intermittent ultrasonic treatment in the ultrasonic crushing process is preferably ultrasonic 1S with an interval of 2S; the total time of the ultrasonic crushing is preferably 15-25 min, more preferably 16-24 min, and still more preferably 18-22 min; the supernatant is collected in a centrifugal mode; the temperature of the collected supernatant is preferably 0 to 8 ℃, more preferably 2 to 6 ℃, still more preferably 4 ℃; the centrifugation speed of the collected supernatant is preferably 11000 to 13000rpm, more preferably 11500 to 12500rpm, still more preferably 12000rpm; the centrifugation time for collecting the supernatant is preferably 20 to 30 minutes, more preferably 22 to 28 minutes, and still more preferably 24 to 26 minutes.
The invention also provides the human uricase and the application of the human uricase obtained by the cloning and expressing method of the human uricase gene in preparing medicaments for degrading the uricase; the enzymolysis temperature in application is preferably 37 ℃, and the pH value is preferably 8.0; the crude enzyme activity can reach 10.81U/mg,3g of bacterial amount can be purified to obtain 3mg of purified target protein, and the purified target protein can efficiently degrade uric acid, and the pure enzyme activity is 10.45U/mg.
The technical solutions provided by the present invention are described in detail below with reference to examples, but they should not be construed as limiting the scope of the present invention.
Example 1
Materials, reagents and the like used in the examples are commercially available unless otherwise specified.
Designing and synthesizing a target gene SEQ ID No.3, and recovering an enzyme-digested and purified product (5746 bp) by using a restriction enzyme NcoI and XhoI double-enzyme-digested carrier pET32 a; the cleavage system of the vector pET32a is shown in table 1;
table 1 vector pET32a cleavage system:
and carrying out homologous recombination connection on the obtained gene SEQ ID No.3 amplification product and the enzyme digestion purification product by using 2X ClonExpress Mix to obtain a recombinant plasmid pET32a-Uricase. The homologous recombination system of the amplified product and the enzyme digestion purification product is shown in table 2;
table 2 amplification product and cleavage purification product homologous recombination systems:
the recombinant plasmid pET32a-Uricase was transformed into E.coli DH5a (purchased from Thermo Fisher Scientific); the specific process of the conversion method comprises the following steps: e. coli DH5a was kept in an ice box, 2.5ul of the homologous recombinant plasmid was added to an EP tube containing 100ul E.coli DH5a, and the mixture was ice-washed for 30min. And (5) after the ice bath is finished, carrying out water bath for 90 seconds in a water bath kettle at 42 ℃, and rapidly cooling for 3 minutes in the ice bath. The centrifuge tube was inhibited from shaking. After cooling, 700ul of sterile LB medium was added and incubated for 1h at 37℃with shaking at 220 rpm. The bacterial solution was spread on LB medium plates containing resistance (Amp), and cultured overnight in an incubator at 37 ℃.
The plasmid pET32 a-UICA extracted from the cloned strain pET32 a-UICA-E.coli DH5a is subjected to enzyme digestion, verification and screening to obtain a positive transformant, and the positive transformant is determined to be a target strain after sequencing; the system for enzyme digestion verification screening positive transformants is shown in table 3;
table 3 cleavage verification system:
plasmid pET32 a-UICCase extracted from clone strain pET32 a-UICCase-E.coli DH5a is transformed into E.coli BL21 (DE 3) code plus RIL (purchased from Sigma-Aldrich Corporation) by the method described above; and extracting positive transformants, and directly culturing to obtain a recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) codon plus RIL.
Recombinant expression strain pET32a-Uricase-E.coli BL21 (DE 3) codon plus RIL is inoculated into 10ml LB culture medium containing ampicillin (50 mg/ml), cultured overnight at 37 ℃ for 15 hours, inoculated into 500ml LB culture medium containing ampicillin (50 mg/ml) according to an inoculum size of 1%, when OD600 = 0.7, added with IPTG with a final concentration of 0.1mM, and induced for 4 hours at 190rpm at 37 ℃; the LB medium formula is shown in Table 4:
TABLE 4 Luria-Bertani (LB) Medium formulation
After the in vitro induced expression is finished, centrifuging at 4 ℃ and 7400rpm for 25min, collecting thalli, re-suspending thalli by using Tris salt buffer solution, performing ultrasonic crushing on ice for 30min, performing ultrasonic treatment for 1s at intervals of 2s, and then centrifuging at 4 ℃ and 12000rpm for 25min, collecting supernatant, thus obtaining crude extract enzyme solution of human Uricase; the collected supernatant was subjected to protein purification using Ni-NTA Beads 6FF column, and the purified recombinant protein solution was subjected to SDS-PAGE gel electrophoresis to obtain a 54kDa protein band, as shown in FIG. 1.
Experimental example 1
Determination of human uricase enzyme activity
1. Drawing uric acid standard curve
A quantity of uric acid was weighed and dissolved in 100mM sodium tetraborate solution and formulated as a standard reagent with a final concentration of 200 mM. Uric acid standard reagent and 100mM sodium tetraborate solution were added in this order according to Table 2, and mixed well, and the average value was obtained by repeating 3 times for each group, and the results are shown in Table 5. 200 μl of liquid was added to the 96-well plate for each gradient, and the absorbance at 293nm was measured on a microplate reader. 100mM sodium tetraborate is used as blank control, uric acid solutions with different concentrations are used as abscissa, OD 293 The absorbance is ordinate, and the correlation coefficient obtained by linearly fitting uric acid standard curve is R 2 The linear regression equation was y=0.0076 x-0.8778, 0.9933, and the result is shown in fig. 2.
TABLE 5 correspondence between uric acid content and absorbance change
Since uric acid has a characteristic absorption peak at 293nm, the product has no absorption peak in this wavelength range, and different uric acid concentrations correspond to different absorption values and change linearly. As uric acid is degraded by uricase, the decrease in absorbance at 293nm is periodically detected for conversion of enzyme activity. The enzyme activity of human uricase is measured by taking 100mM uric acid solution as a substrate, 800 mu L of the substrate (pH 8.0) is taken, 200 mu L of crude enzyme solution is added, after the reaction is carried out for 1h in a 37 ℃ water bath, 200 mu L of crude enzyme solution is respectively taken and transferred into a 96-well plate, and the light absorption value of time change at the wavelength of 293nm is measured on an enzyme labeling instrument. The absorbance at 293nm was measured from the supernatant using an equivalent amount of inactivated enzyme solution as a blank.
The definition of the enzyme activity unit (U) is: under the above conditions, the amount of enzyme required to consume 1. Mu. Mol uric acid per minute.
As a result, the amount of decrease in uric acid was calculated from the standard curve, and the specific activity of the crude enzyme was calculated to be 10.81U/mg and the activity of the pure enzyme was calculated to be 10.45U/mg, as shown in Table 5.
TABLE 6 control of uricase activity in prior studies
The enzymatic activity data of RhUOX-17Mutant and porcine uricase are derived from the prior art under the application number CN112662640A, entitled "catalytic uricase", chen Jianhua, jiang Nan, xu Chunqin.
From the above examples, the invention provides a protein capable of specifically degrading uric acid, which has good production prospects in industrialized production of uricase and high-efficiency application in human body to form a therapeutic effect on gout and hyperuricemia.
The foregoing is merely a preferred embodiment of the present invention and it should be noted that modifications and adaptations to those skilled in the art may be made without departing from the principles of the present invention, which are intended to be comprehended within the scope of the present invention.
Claims (10)
1. A human uricase gene is characterized in that the nucleotide sequence of the gene is shown as SEQ ID NO. 3.
2. The human uricase with catalytic activity expressed by cloning of the human uricase gene according to claim 1, wherein the amino acid sequence of the human uricase is shown in SEQ ID NO. 4.
3. A recombinant vector for expressing a human uricase gene, comprising a starting vector and the human uricase gene of claim 1.
4. A recombinant strain expressing a human uricase gene, wherein the recombinant strain is transformed with the recombinant vector of claim 3.
5. The method for cloning and expressing a human uricase gene according to claim 1, comprising the steps of:
(1) Respectively carrying out enzyme digestion on the humanized Uricase gene and the pET32a vector according to claim 1, and connecting to obtain a recombinant plasmid pET32a-Uricase;
(2) Transforming the recombinant plasmid pET32a-Uricase into host bacteria to obtain a recombinant expression strain pET32a-Uricase-E.coliBL21 (DE 3) codonplus RIL;
(3) Culturing the recombinant expression strain pET32a-Uricase-E.coliBL21 (DE 3) codonplus RIL in the step (2), and then inducing expression;
(4) And (3) centrifugally collecting the induced expression thalli in the step (3), performing ultrasonic crushing, and collecting the supernatant to obtain the humanized uricase solution.
6. The method of claim 5, wherein in the step (1), restriction enzymes NcoI and XhoI are used for double restriction, and the ligation ligase is 2XClonExpress mix ligase.
7. The method for cloning and expressing a human uricase gene according to claim 5, wherein the specific method for culturing the recombinant expression strain in step (3) comprises the steps of:
inoculating recombinant expression strain pET32a-Uricase-E.coliBL21 (DE 3) codonplus RIL into LB medium containing ampicillin, culturing overnight at 37 ℃ for 12-18 h, and inoculating the strain into LB medium containing ampicillin according to 0.5-1.5% of inoculum size;
the concentration of ampicillin in the LB culture medium containing the ampicillin is 40-60 mg/mL.
8. The method for the clonal expression of a human uricase gene of claim 7, wherein the step of inducing expression in step (3) comprises the specific steps of:
OD of recombinant expression Strain pET32a-Uricase-E.coliBL21 (DE 3) codonplus RIL 600 When the expression is carried out in the range of 0.6 to 0.8, IPTG with the concentration of 0.05 to 0.15mM is added, and the induction expression is carried out for 3 to 5 hours at 37 ℃.
9. The method for cloning and expressing a human uricase gene according to claim 5, wherein in the step (4), the temperature of the centrifugation is 0 to 8 ℃, the rotational speed of the centrifugation is 7000 to 7800rpm, and the time of the centrifugation is 20 to 30min; the temperature of the ultrasonic crushing is 0-4 ℃, intermittent ultrasonic treatment is carried out in the ultrasonic crushing process, the ultrasonic is carried out for 1S, and the interval is 2S; the total time of ultrasonic crushing is 15-25 min; the supernatant is collected by adopting a mode of centrifugation at 11000-13000 rpm for 20-30 min at 0-8 ℃.
10. Use of a human uricase according to claim 2, or a human uricase obtained by the cloning and expression method of the human uricase gene according to any one of claims 5 to 9, in the preparation of a medicament for degrading uricase.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2022109760264 | 2022-08-15 | ||
| CN202210976026 | 2022-08-15 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN116536282A true CN116536282A (en) | 2023-08-04 |
Family
ID=87447322
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202310736039.9A Pending CN116536282A (en) | 2022-08-15 | 2023-06-21 | Human uricase gene, cloning expression method thereof and application of human uricase |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN116536282A (en) |
-
2023
- 2023-06-21 CN CN202310736039.9A patent/CN116536282A/en active Pending
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN113481185B (en) | Salt-tolerant beta-galactosidase GalNC2-13 and preparation method and application thereof | |
| US10829755B2 (en) | Genetically engineered arginine deiminase modified by site-directed mutagenesis | |
| CN109593805B (en) | Method for synthesizing L-carnosine by using L-amino acid ligase one-step method | |
| JP2022535648A (en) | Use of thermostable β-glucosidase in the production of gentiooligosaccharides | |
| CN113637660B (en) | Beta-galactosidase GalNC3-89, and preparation method and application thereof | |
| CN105062987B (en) | Recombined human/baboon is fitted into uricase protein and preparation method thereof | |
| CN106939315B (en) | Preparation method and application of oxalate decarboxylase | |
| CN103114110B (en) | Method for synthesizing bilirubin by utilizing immobilized enzyme | |
| CN114350691A (en) | Gene for efficiently expressing hyaluronidase and expression method thereof | |
| CN113801240B (en) | D-psicose-3-epimerase activity aggregate and preparation method and application thereof | |
| CN111269899B (en) | Human urate oxidase with catalytic activity and application thereof | |
| CN108977455B (en) | Recombinant plasmid for producing oxalate decarboxylase, escherichia coli expression system, method and application | |
| CN116200355B (en) | Mutant uricase, uric acid specific conjugate, and preparation method and application thereof | |
| CN112226481A (en) | Method for preparing glycyrrhetinic acid by using novel glucuronidase through biocatalysis | |
| CN116536282A (en) | Human uricase gene, cloning expression method thereof and application of human uricase | |
| CN115109795B (en) | Recombinant human-derived type III collagen injection and application thereof in skin collagen regeneration | |
| CN100406560C (en) | Method for expression of Aspergillus flavus urate oxidase and the special gene thereof | |
| JPH08504580A (en) | Recombinant dog gastric lipase and pharmaceutical composition | |
| CN113234741A (en) | High-concentration recombinant expression of novel feruloyl esterase and application of novel feruloyl esterase in preparation of high-efficiency feruloyl enzyme method | |
| CN107988191B (en) | Low-temperature acidic protease and coding gene and application thereof | |
| CN113735942B (en) | Recombinant hypoglycemic polypeptide and preparation method and application thereof | |
| CN100334207C (en) | Process for preparing aspergillus flavus urate oxidase | |
| CN104630168A (en) | Construction and expression of recombinant human/pig chimeric uricase | |
| CN114181920B (en) | Rhodobacter capsulatus 5-aminoacetylpropionic acid synthetase mutant and application thereof | |
| CN116621968B (en) | Purification method of recombinant III type humanized collagen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination |