CN116440252A - Application of neurotrophic factor 3 in preparation of medicament for improving testosterone content in testes - Google Patents
Application of neurotrophic factor 3 in preparation of medicament for improving testosterone content in testes Download PDFInfo
- Publication number
- CN116440252A CN116440252A CN202310585145.1A CN202310585145A CN116440252A CN 116440252 A CN116440252 A CN 116440252A CN 202310585145 A CN202310585145 A CN 202310585145A CN 116440252 A CN116440252 A CN 116440252A
- Authority
- CN
- China
- Prior art keywords
- neurotrophic factor
- testes
- testicular
- testosterone
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 title claims abstract description 60
- 108010025020 Nerve Growth Factor Proteins 0.000 title claims abstract description 54
- 102000007072 Nerve Growth Factors Human genes 0.000 title claims abstract description 54
- 239000003900 neurotrophic factor Substances 0.000 title claims abstract description 54
- 229960003604 testosterone Drugs 0.000 title claims abstract description 30
- 210000001550 testis Anatomy 0.000 title claims abstract description 29
- 239000003814 drug Substances 0.000 title claims abstract description 17
- 238000012360 testing method Methods 0.000 title abstract description 11
- 238000002360 preparation method Methods 0.000 title description 10
- 230000001965 increasing effect Effects 0.000 claims abstract description 13
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 3
- 210000002901 mesenchymal stem cell Anatomy 0.000 abstract description 24
- 230000002381 testicular Effects 0.000 abstract description 21
- 210000004027 cell Anatomy 0.000 abstract description 17
- 210000002966 serum Anatomy 0.000 abstract description 10
- 230000000694 effects Effects 0.000 abstract description 8
- 201000003585 eunuchism Diseases 0.000 abstract description 7
- 208000037106 male hypogonadism Diseases 0.000 abstract description 7
- 239000004480 active ingredient Substances 0.000 abstract description 4
- 230000004936 stimulating effect Effects 0.000 abstract description 3
- 230000004663 cell proliferation Effects 0.000 abstract description 2
- 230000036299 sexual function Effects 0.000 abstract description 2
- 208000011580 syndromic disease Diseases 0.000 abstract 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 37
- 102000004230 Neurotrophin 3 Human genes 0.000 description 18
- 108090000742 Neurotrophin 3 Proteins 0.000 description 18
- 229940032018 neurotrophin 3 Drugs 0.000 description 18
- 230000035755 proliferation Effects 0.000 description 16
- 210000002332 leydig cell Anatomy 0.000 description 14
- 238000005406 washing Methods 0.000 description 13
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 12
- 239000000463 material Substances 0.000 description 11
- 210000002863 seminiferous tubule Anatomy 0.000 description 11
- 239000002609 medium Substances 0.000 description 10
- 150000001875 compounds Chemical class 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- 230000004069 differentiation Effects 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 108010084976 Cholesterol Side-Chain Cleavage Enzyme Proteins 0.000 description 7
- 102100027516 Cholesterol side-chain cleavage enzyme, mitochondrial Human genes 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 229920002472 Starch Polymers 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 239000008107 starch Substances 0.000 description 5
- 235000019698 starch Nutrition 0.000 description 5
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 4
- 229940098773 bovine serum albumin Drugs 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 210000002570 interstitial cell Anatomy 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 239000008096 xylene Substances 0.000 description 4
- 241000283707 Capra Species 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 239000000796 flavoring agent Substances 0.000 description 3
- 235000013355 food flavoring agent Nutrition 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000012151 immunohistochemical method Methods 0.000 description 3
- 239000007928 intraperitoneal injection Substances 0.000 description 3
- 239000012188 paraffin wax Substances 0.000 description 3
- -1 patch Substances 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000007789 sealing Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 239000001993 wax Substances 0.000 description 3
- PRDFBSVERLRRMY-UHFFFAOYSA-N 2'-(4-ethoxyphenyl)-5-(4-methylpiperazin-1-yl)-2,5'-bibenzimidazole Chemical compound C1=CC(OCC)=CC=C1C1=NC2=CC=C(C=3NC4=CC(=CC=C4N=3)N3CCN(C)CC3)C=C2N1 PRDFBSVERLRRMY-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 239000008186 active pharmaceutical agent Substances 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 239000003098 androgen Substances 0.000 description 2
- 229940030486 androgens Drugs 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 108090000623 proteins and genes Proteins 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000013222 sprague-dawley male rat Methods 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 230000009469 supplementation Effects 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- XCJGLBWDZKLQCY-UHFFFAOYSA-N 2-methylpropane-2-sulfonic acid Chemical compound CC(C)(C)S(O)(=O)=O XCJGLBWDZKLQCY-UHFFFAOYSA-N 0.000 description 1
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 1
- 206010002261 Androgen deficiency Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 229920002785 Croscarmellose sodium Polymers 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 206010058359 Hypogonadism Diseases 0.000 description 1
- 241001138401 Kluyveromyces lactis Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102000004317 Lyases Human genes 0.000 description 1
- 108090000856 Lyases Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 208000028389 Nerve injury Diseases 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 208000008601 Polycythemia Diseases 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 206010041277 Sodium retention Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 235000011114 ammonium hydroxide Nutrition 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 235000001465 calcium Nutrition 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000001767 crosslinked sodium carboxy methyl cellulose Substances 0.000 description 1
- 235000010947 crosslinked sodium carboxy methyl cellulose Nutrition 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000002354 daily effect Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 210000003298 dental enamel Anatomy 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- FPAFDBFIGPHWGO-UHFFFAOYSA-N dioxosilane;oxomagnesium;hydrate Chemical compound O.[Mg]=O.[Mg]=O.[Mg]=O.O=[Si]=O.O=[Si]=O.O=[Si]=O.O=[Si]=O FPAFDBFIGPHWGO-UHFFFAOYSA-N 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000012154 double-distilled water Substances 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 230000008451 emotion Effects 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- DZGCGKFAPXFTNM-UHFFFAOYSA-N ethanol;hydron;chloride Chemical compound Cl.CCO DZGCGKFAPXFTNM-UHFFFAOYSA-N 0.000 description 1
- RESSOZOGQXKCKT-UHFFFAOYSA-N ethene;propane-1,2-diol Chemical compound C=C.CC(O)CO RESSOZOGQXKCKT-UHFFFAOYSA-N 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000000834 fixative Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000002710 gonadal effect Effects 0.000 description 1
- 238000005469 granulation Methods 0.000 description 1
- 230000003179 granulation Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 229940031703 low substituted hydroxypropyl cellulose Drugs 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 229940037627 magnesium lauryl sulfate Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- HBNDBUATLJAUQM-UHFFFAOYSA-L magnesium;dodecyl sulfate Chemical compound [Mg+2].CCCCCCCCCCCCOS([O-])(=O)=O.CCCCCCCCCCCCOS([O-])(=O)=O HBNDBUATLJAUQM-UHFFFAOYSA-L 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 230000027939 micturition Effects 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 239000011259 mixed solution Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 230000008764 nerve damage Effects 0.000 description 1
- 230000019581 neuron apoptotic process Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 210000003899 penis Anatomy 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000003257 protein preparation method Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000005067 remediation Methods 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 208000012201 sexual and gender identity disease Diseases 0.000 description 1
- 208000015891 sexual disease Diseases 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 239000012224 working solution Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/185—Nerve growth factor [NGF]; Brain derived neurotrophic factor [BDNF]; Ciliary neurotrophic factor [CNTF]; Glial derived neurotrophic factor [GDNF]; Neurotrophins, e.g. NT-3
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Reproductive Health (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pregnancy & Childbirth (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Psychology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Gynecology & Obstetrics (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention provides an application of neurotrophic factor 3 in preparing a medicament for improving testosterone content in testes, belonging to the technical field of sexual function medicaments. The neurotrophic factor 3 provided by the invention has the effects of stimulating organism testicular mesenchymal stem cell proliferation, increasing testicular mesenchymal cell number, improving or treating low testosterone in serum and/or testes, and treating male hypogonadism syndrome by taking the neurotrophic factor as an active ingredient.
Description
The application is a divisional application of the neurotrophic factor 3 in preparing the medicine for treating male hypogonadism, wherein the application date is 16 months of 2020, the application number is 202010547497.4.
Technical Field
The invention belongs to the technical field of sexual function medicines, and particularly relates to application of neurotrophic factor 3 in preparation of medicines for improving testosterone content in testes.
Background
Male hypogonadism is a sexual disorder caused by a lack, decrease or inability to exert its effects in androgens. The testicular interstitial cell cytoplasm contains abundant mitochondria and a sliding surface endoplasmic reticulum, and has the main function of synthesizing testosterone and is the most main source of androgens in the male body. Testicular stromal cells are divided into four distinct phases during differentiation and development: mesenchymal stem cells (StemLeydig cells), progenitor mesenchymal cells (Progenitor Leydig cell), juvenile mesenchymal cells (Immature Leydig cell) and adult mesenchymal cells (Adult Leydig cell). In these developmental processes, androgen deficiency in vivo is also caused by abnormal proliferation and differentiation, reduced number, and reduced hormone synthesis and secretion functions.
Currently, the clinical treatment of hypogonadism is mainly by testosterone supplementation therapy, however, this therapy has significant safety problems in addition to the need for regular testosterone injections. First, chronic quantitative supplementation of testosterone can predispose patients to acne and erythrocytosis; secondly, the concentration of the testosterone in the serum is easy to fluctuate greatly, and obvious fluctuation of symptoms of the patients with the symptoms of the low-grade gonadal function of the emotion and the tardive is caused; again, patients are prone to adverse reactions such as water and sodium retention, abnormal erection of penis, difficult urination and the like, and even diseases such as impaired liver and kidney functions and prostate cancer initiation.
Neurotrophin 3 (NT-3) is a protein that plays an important role in the development, survival and apoptosis of neurons, and is a potential drug target for treating diseases such as nerve injury. No study of neurotrophin 3 in the treatment of male hypogonadism has been found.
Disclosure of Invention
In view of the above, the invention aims to provide an application of neurotrophic factor 3 in preparing a medicament for improving testosterone content in testes, wherein the neurotrophic factor 3 can obviously promote proliferation of testicular mesenchymal stem cells and increase of testicular mesenchymal cell number, so that testosterone content in testes and serum of patients is improved, and an effect of obviously treating male hypogonadism is achieved.
In order to achieve the above object, the present invention provides the following technical solutions:
the invention provides application of neurotrophic factor 3 in preparation of a medicament for improving testosterone content in testes.
Preferably, said neurotrophic factor 3 is derived from human, mouse or rat.
Preferably, the amino acid sequence of the neurotrophic factor 3 is shown in SEQ ID No. 1.
Compared with the prior art, the invention has the following beneficial effects:
the application of the neurotrophic factor 3 in preparing the medicine for improving the testosterone content in the testis provided by the invention has the advantages that the neurotrophic factor 3 stimulates the organism testis mesenchymal stem cell proliferation and increases the number of the testis mesenchymal stem cells, so that the testosterone content in the testis and/or serum is increased, and the male hypogonadism is finally improved or cured.
The invention adopts an immunohistochemical method to dye the specific protein cholesterol side chain lyase (CYP 11A 1) of the testicular interstitial cells and calculate the positive cell number, which shows that after the treatment of the neurotrophic factor 3, the positive cell number of the CYP11A1 can be effectively increased, namely the neurotrophic factor 3 has the function of increasing the number of the testicular interstitial cells.
According to the invention, the neurotrophic factor 3 is adopted to treat the seminiferous tubules with the surface containing the testicular mesenchymal stem cells for 7 days, and the proliferation condition is detected by using the EdU proliferation kit, so that the neurotrophic factor 3 is found to increase the number of EdU positive cells on the surface of the seminiferous tubules, namely the neurotrophic factor 3 can stimulate the proliferation of the testicular mesenchymal stem cells, and has the effect of increasing the number of the testicular mesenchymal stem cells.
The invention adopts the neurotrophic factor 3 to treat the seminiferous tubules containing the testicular mesenchymal stem cells on the surface for 7 days, removes the neurotrophic factor 3 after increasing the number of the testicular mesenchymal stem cells, continues to use the testicular mesenchymal stem cells to induce the differentiation medium to culture, and measures the testosterone level of the medium, and the result shows that the neurotrophic factor 3 is differentiated into the testicular mesenchymal stem cells by stimulating the proliferation of the testicular mesenchymal stem cells, thereby increasing the testosterone yield.
Drawings
FIG. 1 shows the increase in the number of testicular interstitial cells by neurotrophin 3; wherein, the data is expressed by mean ± standard error, and the sample size is 6; ", denotes P <0.001;
FIG. 2 shows the stimulation of proliferation of mesenchymal stem cells by neurotrophin 3; wherein, the data is expressed by mean ± standard error, and the sample size is 6; ". Times" means P <0.05; ", denotes P <0.001;
FIG. 3 shows the production of testosterone by neurotrophin 3 by stimulation of proliferation of mesenchymal stem cells and subsequent differentiation into mesenchymal cells; wherein, the data is expressed by mean ± standard error, and the sample size is 6; ". Times" means P <0.05; ", denotes P <0.001;
Detailed Description
The invention provides application of neurotrophic factor 3 in preparation of a medicament for improving testosterone content in testes.
The source of the neurotrophic factor 3 is not particularly limited, and the neurotrophic factor 3 can be isolated from a natural organism and chemically synthesized by polypeptide; the neurotrophic factor 3 can also be obtained by in vitro recombinant expression, for example, purification after expression by prokaryotic microorganism (such as escherichia coli) genetic engineering bacteria, purification after expression by eukaryotic microorganism (such as beer yeast, pichia pastoris, kluyveromyces lactis Wei Jiaomu and the like) genetic engineering bacteria or expression and purification by animal cells (such as Chinese hamster CHO, hamster BHK, mouse myeloma cells, monkey CV1 cells, human lymphocytes and the like) and the like. The neurotrophic factor 3 is preferably derived from human, mouse or rat.
In the present invention, the method for preparing the neurotrophic factor 3 is not particularly limited, and a recombinant protein preparation method well known in the art may be used. The neurotrophic factor 3 also includes modifications in the form of covalent or ionic bonds or the like by chemical or biological means, for example, pegylation for the purpose of stability, safety and longevity of the polypeptide.
The invention also provides application of the neurotrophic factor 3 in preparing a medicament for stimulating proliferation of testicular mesenchymal stem cells.
In the present invention, the neurotrophic factor 3 is identical to the neurotrophic factor 3 in the above application, and will not be described herein.
The invention also provides application of the neurotrophic factor 3 in preparing medicines for increasing the number of testicular interstitial cells.
In the present invention, the neurotrophic factor 3 is identical to the neurotrophic factor 3 in the above application, and will not be described herein.
The invention also provides application of the neurotrophic factor 3 in preparing a medicament for treating male hypogonadism.
In the present invention, the neurotrophic factor 3 is identical to the neurotrophic factor 3 in the above application, and will not be described herein.
In the present invention, the amino acid sequence of the neurotrophic factor 3 is preferably shown in SEQ ID No.1, and is specifically as follows:
MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLG EIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQC KTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT。
in the present invention, the dosage of neurotrophic factor 3 is not less than 100 ng/testis/d or 10ng/ml.
In the present invention, the term "drug" refers to a single compound, a composition formed of a plurality of compounds, a Chinese medicinal material and an extract thereof, which can be used for preventing or treating a certain disease, or refers to a composition or preparation containing a single compound as a main active ingredient, and also refers to a composition or preparation containing a plurality of compounds as active ingredients. "pharmaceutical" is understood to mean not only the products approved and approved for production by the authorities established in accordance with the legal regulations of the country, but also the forms of the various substances formed in order to obtain the products approved and approved for production, which contain the single compound as active ingredient. "formed" is understood to mean obtained by chemical synthesis, bioconversion or purchase, among other means.
The medicament comprises various pharmaceutical auxiliary materials which are suitable for the contained compounds so as to prepare dosage forms which are favorable for administration, such as: but not limited to, aqueous injection, powder for injection, pill, powder, tablet, patch, suppository, emulsion, cream, gel, granule, capsule, aerosol, spray, powder fog, sustained release agent, controlled release agent, etc. These pharmaceutical excipients may be used conventionally in various formulations, such as: but are not limited to isotonic agents, buffers, flavoring agents, excipients, fillers, binders, disintegrants, lubricants, and the like; may also be selected for adaptation to the substance, such as: the auxiliary materials can effectively improve the stability and the solubility of the compounds contained in the composition or change the release rate, the absorption rate and the like of the compounds, thereby improving the metabolism of various compounds in organisms and further enhancing the administration effect of the composition. In addition, specific purposes or modes of administration may be achieved, such as: sustained release administration, controlled release administration, pulse administration, etc., and auxiliary materials used, such as: but are not limited to, gelatin, albumin, chitosan, polyethers and polyesters such as: but are not limited to, polyethylene glycol, polyurethane, polycarbonate, copolymers thereof, and the like. The main expression "advantageous administration" is referred to as: but not limited to, improving therapeutic effect, improving bioavailability, reducing toxic side effects, improving patient compliance, and the like.
In aqueous injection solutions, the auxiliary materials generally comprise isotonic agents and buffers, and necessary emulsifying agents (such as Tween-80, pluronic, and Poloxamer), solubilizers, and bacteriostats. In addition, the composition also comprises other pharmaceutically acceptable pharmaceutical excipients, such as: antioxidants, pH adjusters, analgesics, and the like. The auxiliary materials for preparing the oral liquid preparation generally comprise solvents, necessary flavoring agents, bacteriostats, emulsifying agents, coloring agents and the like. The auxiliary materials for preparing the tablet generally comprise a filler (such as starch, sugar powder, dextrin, lactose, compressible starch, microcrystalline cellulose, calcium sulfate, calcium hydrophosphate, mannitol and the like), a binder (such as ethanol, starch slurry, sodium carboxymethyl cellulose, hydroxypropyl cellulose, methyl cellulose, ethyl cellulose, hydroxypropyl methyl cellulose, gelatin solution, sucrose solution, aqueous or alcoholic solution of polyvinylpyrrolidone and the like), a disintegrating agent (such as dry starch, sodium carboxymethyl starch, low-substituted hydroxypropyl cellulose, crosslinked polyvinylpyrrolidone and crosslinked sodium carboxymethyl cellulose) and a lubricant (such as magnesium stearate, micro-powder silica gel, talcum powder, hydrogenated vegetable oil, polyethylene glycol 4,000, polyethylene glycol 6,000, magnesium lauryl sulfate and the like) and the like. The auxiliary materials for preparing the emulsion are water, oil (such as fatty acid), emulsifying agent, necessary preservative, flavoring agent and the like. The auxiliary materials used for preparing the granules are similar to tablets, but the granulation process is different. Mixing the granule with glidant, and encapsulating to obtain capsule.
The technical solutions provided by the present invention are described in detail below with reference to examples, but they should not be construed as limiting the scope of the present invention.
Example 1
1. Effects of neurotrophin 3 on the number of testicular interstitial cells.
Male Sprague-Dawley rats (90 days old) were harvested 18. Intraperitoneal injection of dimethylethane sulfonic acid (EDS, at a dose of 75mg/kg body weight) killed the testicular interstitial cells without affecting the testicular interstitial stem cells, followed by 3 groups (6 per group). The grouping situation is as follows: 1) Blank (normal saline); 2) Neurotrophic factor 3 (10 ng/testis/d); 3) Neurotrophic factor 3 (100 ng/testis/d). The composition and dose specified in the above group were injected daily intratesticular after the 14 th day of EDS injection to the 28 th day after EDS injection (this stage is regeneration differentiation of testicular mesenchymal stem cells into new testicular mesenchymal cells). After carbon dioxide is killed, testes are taken and fixed for 48 hours through Bouin's liquid, then dehydrated paraffin is embedded into a tissue chip, and a tissue chip is prepared by staining and counting a testis interstitial cell specific protein CYP11A1 through an immunohistochemical method, and the influence of neurotrophin 3 on the number of new testis interstitial cells is detected, and the result is shown in figure 1.
2. The specific steps of the immunohistochemical staining of the testicular interstitial cells CYP11A1 are as follows:
(1) Dehydrating the fixed sample, taking out testis fixed in Bouin's liquid for 48h, cutting into small blocks, and washing with clear water for 10min,75% alcohol for 80min,85% alcohol for 80min,95% alcohol for 80min,100% alcohol for 1h each of I and II, 30min each of xylene for I and II, soft wax for 1h, hard wax for 1h, and hard wax for I2h each of I and II.
(2) Embedding the dehydrated sample into paraffin wax to prepare a tissue chip with the thickness of 6 mu m;
(3) Baking slices: placing paraffin sections in a 60 ℃ oven for 2 hours;
(4) Dewaxing and rehydration: xylene I, II each for 5min with 100% ethanol I, 100% ethanol II,95% ethanol, 85% ethanol, 75% ethanol, and 0.01mol/L Phosphate Buffer (PBS) 3 times each for 5min, (PBS water wash can be performed on a shaker at a speed of 100 rpm);
(5) Endogenous peroxidase blockade: dropwise adding 3% hydrogen peroxide for 10min, and washing with PBS for 3 times and 5min each time (PBS water washing can be performed on a shaking table at a speed of 100 rpm);
(6) High temperature thermal remediation antigen: placing an enamel jar containing citrate repairing liquid into an autoclave containing water, boiling, placing a slide frame into the citrate, covering a pot cover, starting timing for 3min after air injection, closing a heat source, naturally cooling to room temperature, and then placing in PBS for soaking for 10min;
(7) Serum blocking: placing the glass slide into a wet box after soft spin-drying, rapidly dripping normal serum blocking liquid (10% goat serum), and blocking for 30min at room temperature;
(8) Adding an antibody: gently throwing off serum, placing into a wet box, and dripping primary antibody CYP11A1 (Cell Signaling Technology company), wherein the primary antibody is diluted by 1% goat serum volume ratio of 1:200, and standing overnight at 4 ℃;
(9) And (3) rewarming: rewarming the wet box in a 37 ℃ water bath for 30min, washing with PBS for 3 times and 5min each time, (PBS washing can be performed on a shaker at a speed of 100 rpm);
(10) Adding a secondary antibody: adding goat anti-rabbit horseradish peroxidase IgG secondary antibody (Hangzhou Union) into a wet box, incubating for 20min at room temperature, and washing with PBS for 3 times, each time for 5min;
(11) Color development: dropwise adding the bi-aniline (DAB), controlling the time under a microscope, and immediately washing off the DAB by water after color development;
(12) Counterstaining: washing in water for 2min, hematoxylin staining, washing in water for 5min, differentiating with 1% ethanol hydrochloride for 4s, washing in water for 10min, and reversing blue with ammonia water for 1-2s;
(13) Dehydrating and transparentizing: 75% ethanol 1min,85% ethanol 2min,95% ethanol 3min,100% ethanol I, II each for 3min, followed by xylene I, II each for 10min (dehydration of low to high concentration ethanol, xylene transparency);
(14) Sealing piece: sealing the neutral resin;
(15) Microscope pictures were taken and counted.
FIG. 1 shows the increase in the number of testicular interstitial cells by neurotrophin 3; wherein, the data is expressed by mean ± standard error, and the sample size is 6; ". Times." indicates that P <0.05, neurotrophin 3 significantly increased the number of CYP11A1 positive (testosterone mesenchymal cells) cells compared to control group concentration; "+" indicates that P <0.001, neurotrophin 3 was able to significantly increase CYP11A1 positive (testicular interstitial cells) cell number compared to control group concentration; after the rats are given intraperitoneal injection of 75mg/kg EDS for 14d, neurotrophic factor 3 (0, 10 and 100 ng/testis) is injected into testis every day to 28d after EDS injection, the animals are sacrificed, testis is taken, and the testis interstitial cell specific protein CYP11A1 is stained by adopting an immunohistochemical method and the number of the testis interstitial cells is calculated; neurotrophic factor 3 at 100 ng/testis/d significantly increased the number of testicular interstitial cells compared to the control.
Example 2
1. Effects of neurotrophin 3 on the number of mesenchymal stem cells and testosterone levels in testis Male Sprague-Dawley rats (90 days old) were given 7d before the experiment by intraperitoneal injection of 75mg/kg EDS, after carbon dioxide sacrifice, testes were removed, placed in ice-cold phosphate buffer, the capsule was sheared off, the blood vessels were peeled off from the seminiferous tubules, the seminiferous tubules were separated into individual pieces, the seminiferous tubules were divided equally into 12 well plates, and DMEM/12 medium (sigma) containing different concentrations of neurotrophin 3 was added for treatment for 7d, specifically groups of 0ng/ml (control), 10ng/ml and 100ng/ml of neurotrophin 3. After 7d, a portion of the seminiferous tubules were assayed for proliferation using the EdU (Life technologies) proliferation kit (see FIG. 2 for results), another portion of the seminiferous tubules were depleted of neurotrophic factor 3, and further cultured for 2 weeks using a testicular mesenchymal stem cell induced differentiation medium (5 mmol/L of lithium chloride and 5ng/ml of LH were added to DMEM/12 medium), the medium was collected, and analyzed for testosterone content using a chemiluminescent immunoassay (IMMULITE 2000 automated chemiluminescent immunoassay was started and warmed up for at least 2 hours, and centrifuged with shaking after thawing at room temperature; at least 300ul of standard serum or sample was added to each of the separate cup tubes dedicated to testosterone assay, and the total testosterone assay kit from Ximen was added to the chemiluminescent immunoassay in sequence, and testosterone was assayed on the machine) (see FIG. 3 for results).
2. EdU proliferation assay step (1) material:
A：EdU
B：AlaxaFluorazide
C：DMSO
D：Click-iTEdUreactionbuffer
E：CuSO 4
F：Click-iTEdUbufferadditive
G：Hoechst33342
(2) A material preparation step:
1) 10-mM stock EdU (A): adding 2 mM DS (2 mM DS) to EdU for preservation at (-20deg.C);
2) Working solution B: 70 mu LDMSO (-20 ℃) was added to B;
3) 1XClick-iTEdUreactionbuffer (D) working fluid: adding the original D (4 mL) into 36mL distilled water (washing the bottle, and storing at 2-6 ℃);
4) 10XF stock solution: 2mL of double distilled water was added to F (-20 ℃);
(3) The seminiferous tubules were cultured with 0ng/ml, 10ng/ml and 100ng/ml neurotrophic factor 3 for seven days;
(4) Adding A (EdU, 1:1000) coloring agent into 12-hole plate, and keeping away from light for 24h;
(5) Transferring the fine curved spermatids to 1.5ml EP (ethylene propylene glycol) tubes, wherein each tube ensures 7-8 fine curved spermatids, and the culture solution is not too much during transferring, so that the fine curved spermatids are not attached to the wall;
(6) Washing 2 times with 500 μl of 3% Bovine Serum Albumin (BSA);
(7) 500 μl of 4% paraformaldehyde was fixed for 30min;
(8) The fixative was removed and washed twice with 0.5ml3% BSA;
(9) Adding 0.5% triton 1ml, and fixing at normal temperature for 45min;
(10) The triamcinolone is blotted off and washed 2 times with 3% bsa;
(11) 250 μl of the mixture in the following table is added and protected from light for 45min;
table 1 preparation of the mixed solution
(12) 1ml of 3% BSA was washed 4 times;
(13) Washing with PBS once;
(14) Preparing G (Hoechst 33342, 1:2000), adding 400 μl into each tube, and keeping out of light for 30min;
(15) PBS1ml was washed twice;
(16) Adding 10 μl of glycerol for sealing;
(17) Microscope count.
FIG. 2 shows the stimulation of proliferation of mesenchymal stem cells by neurotrophin 3; in the figure, data are expressed by mean ± standard error, and the sample size is 6; ". Times" means P <0.05; by "+" is meant that P <0.001, neurotrophin 3 stimulated proliferation of testicular stem cells statistically significant compared to the control group. After isolation of the seminiferous tubules, different concentrations of neurotrophic factor 3 (0 ng/ml, 10ng/ml and 100 ng/ml) were added for 7d, proliferation was detected with the EdU proliferation kit, and 10ng/ml and 100ng/ml neurotrophic factor 3 significantly increased the number of EdU positive (testicular mesenchymal stem cells) cells.
FIG. 3 shows the production of testosterone by stimulation of proliferation of mesenchymal stem cells and subsequent differentiation into mesenchymal stem cells by neurotrophin 3, wherein the data are expressed as mean.+ -. Standard error and the sample size is 6; ". Times" means P <0.05; ", indicates that P <0.001, the increase in neurotrophin 3 in medium testosterone compared to control group is statistically significant. After isolation of the seminiferous tubules, different concentrations of neurotrophic factor 3 (0 ng/ml, 10ng/ml and 100 ng/ml) were added for 7d followed by withdrawal of neurotrophic factor 3, continued culture with testicular mesenchymal stem cell induced differentiation medium for 2 weeks, and the medium was collected to determine testosterone levels, 10ng/ml and 100ng/ml neurotrophic factor 3 significantly increased the medium testosterone levels.
The foregoing is merely a preferred embodiment of the present invention and it should be noted that modifications and adaptations to those skilled in the art may be made without departing from the principles of the present invention, which are intended to be comprehended within the scope of the present invention.
Claims (3)
1. The application of neurotrophic factor 3 in preparing medicine for increasing testosterone content in testis is provided.
2. The use according to claim 1, wherein said neurotrophic factor 3 is derived from human, mouse or rat.
3. The use according to claim 1, wherein the amino acid sequence of neurotrophic factor 3 is shown in SEQ ID No. 1.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202310585145.1A CN116440252A (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicament for improving testosterone content in testes |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202310585145.1A CN116440252A (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicament for improving testosterone content in testes |
| CN202010547497.4A CN111514279B (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicine for treating male hypogonadism |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202010547497.4A Division CN111514279B (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicine for treating male hypogonadism |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN116440252A true CN116440252A (en) | 2023-07-18 |
Family
ID=71909885
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202310585145.1A Withdrawn CN116440252A (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicament for improving testosterone content in testes |
| CN202010547497.4A Active CN111514279B (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicine for treating male hypogonadism |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202010547497.4A Active CN111514279B (en) | 2020-06-16 | 2020-06-16 | Application of neurotrophic factor 3 in preparation of medicine for treating male hypogonadism |
Country Status (1)
| Country | Link |
|---|---|
| CN (2) | CN116440252A (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112121049B (en) * | 2020-08-28 | 2022-02-01 | 嘉兴市第一医院 | Application of cis-atracurium in preparation of medicine for treating male hypogonadism |
| CN112316121A (en) * | 2020-11-24 | 2021-02-05 | 温州医科大学附属第二医院、温州医科大学附属育英儿童医院 | Application of glucagon-like peptide-1 in preparing medicine for treating male hypogonadism syndrome |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP3519096B2 (en) * | 1992-07-02 | 2004-04-12 | 武田薬品工業株式会社 | Monoclonal antibodies, hybridomas and their uses |
| AU2460595A (en) * | 1994-05-06 | 1995-11-29 | Regeneron Pharmaceuticals, Inc. | Methods based on the role of neurotrophin 3 in female reproduction |
| US5770577A (en) * | 1994-11-14 | 1998-06-23 | Amgen Inc. | BDNF and NT-3 polypeptides selectively linked to polyethylene glycol |
| US7160924B2 (en) * | 2002-07-19 | 2007-01-09 | The General Hospital Corporation | Protein conjugates with a water-soluble biocompatible, biodegradable polymer |
| ATE542904T1 (en) * | 2001-10-29 | 2012-02-15 | Crucell Holland Bv | METHOD AND MEANS FOR PRODUCING PROTEINS WITH PREDEFINED POST-TRANSLATIONAL MODIFICATIONS |
| CA2740736A1 (en) * | 2008-10-15 | 2010-04-22 | Ridge Diagnostics, Inc. | Human biomarker hypermapping for depressive disorders |
| EP2558024B1 (en) * | 2010-04-12 | 2017-03-08 | The University Of Miami | Macroporous bioengineered scaffolds for cell transplantation |
| CN103861087B (en) * | 2012-12-14 | 2016-04-20 | 广州暨南大学医药生物技术研究开发中心 | Nerve growth factor is for the preparation of the purposes in treatment middle-aging male sexual disorder syndromic medicine |
| CN107375910B (en) * | 2017-07-12 | 2020-03-24 | 温州医科大学附属第二医院、温州医科大学附属育英儿童医院 | Application of PTHrP in preparation of medicine for treating male hypogonadism syndrome |
| SG11202003285PA (en) * | 2017-10-20 | 2020-05-28 | Res Inst Nationwide Childrens Hospital | Methods and materials for nt-3 gene therapy |
-
2020
- 2020-06-16 CN CN202310585145.1A patent/CN116440252A/en not_active Withdrawn
- 2020-06-16 CN CN202010547497.4A patent/CN111514279B/en active Active
Also Published As
| Publication number | Publication date |
|---|---|
| CN111514279A (en) | 2020-08-11 |
| CN111514279B (en) | 2023-07-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10786531B2 (en) | Mineral salt-sulfonic acid compositions and methods of use | |
| AU2012212992B2 (en) | Treatment for lipodystrophy | |
| CN111514279B (en) | Application of neurotrophic factor 3 in preparation of medicine for treating male hypogonadism | |
| EP3603660A1 (en) | New application for long-acting mutant human fibroblast growth factor | |
| CA2605651C (en) | Compositions and methods for treating or preventing overweight or obesity with zinc-charged protein fragments | |
| CN107375910B (en) | Application of PTHrP in preparation of medicine for treating male hypogonadism syndrome | |
| US20130203762A1 (en) | Veterinary antiprolactinic composition for ruminants | |
| CN111529691A (en) | Use of parathyroid hormone (1-34) in preparing medicine for treating male hypogonadism | |
| EA019814B1 (en) | Composition useful for the prevention or reduction of the progression of prostate cancer | |
| WO1999055325A1 (en) | Drugs for reducing vaginal acidity and treatment of vaginitis, and the use thereof | |
| JPH0995445A (en) | Medicine for treating cerebral neurocyte disorder | |
| AU2019202876B2 (en) | Administration of Recombinant Collagen 7 for the Treatment of Age Related Disorders | |
| CN110946986B (en) | Application of oligopeptide in preparation of medicine for preventing and treating non-alcoholic fatty liver disease | |
| NL2031393B1 (en) | Use of neurotrophic factor 3 (nt-3) in preparation of drug for treatment of male hypogonadism | |
| CN117442603B (en) | Application of schaftoside in preparation of heart failure resistant medicines | |
| EP2253228B1 (en) | Composition for controlling and improving female and male gametogenesis | |
| RU2785582C2 (en) | Use of pegylated recombinant chimeric mouse fibroblast-21 growth factor or its pharmaceutically acceptable salt in composition of drugs for treatment of non-alcoholic steatohepatitis | |
| CN112121049B (en) | Application of cis-atracurium in preparation of medicine for treating male hypogonadism | |
| KR102498401B1 (en) | Eye drops composition for treating and preventing cataract | |
| EP4375278A1 (en) | Immunoregulatory amide derivative with improved material properties | |
| KR20120125754A (en) | Pharmaceutical composition comprising melittin for treatment of liver disease | |
| CN106581151B (en) | Application of traditional Chinese medicine composition for promoting blood circulation and removing stasis | |
| CN111744006A (en) | Pharmaceutical composition for preventing and treating diabetic retinopathy | |
| TW202005664A (en) | Composition containing lotus seedpot extract and its application for head/neck cancer treatment capable of inhibiting growth of cancel cells and reducing possibility of cancer recurrence | |
| Hernandez | Serotonin and the Physiology of Calcium Homeostasis During the Transition Period |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20230718 |
|
| WW01 | Invention patent application withdrawn after publication |