CN116003530A - D-protein inhibitor for interleukin-6 and application thereof - Google Patents
D-protein inhibitor for interleukin-6 and application thereof Download PDFInfo
- Publication number
- CN116003530A CN116003530A CN202211684805.3A CN202211684805A CN116003530A CN 116003530 A CN116003530 A CN 116003530A CN 202211684805 A CN202211684805 A CN 202211684805A CN 116003530 A CN116003530 A CN 116003530A
- Authority
- CN
- China
- Prior art keywords
- amino acid
- acid sequence
- interleukin
- protein inhibitor
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 229940100601 interleukin-6 Drugs 0.000 title claims abstract description 60
- 102000004889 Interleukin-6 Human genes 0.000 title claims abstract description 56
- 108090001005 Interleukin-6 Proteins 0.000 title claims abstract description 56
- 229940121649 protein inhibitor Drugs 0.000 title claims abstract description 34
- 239000012268 protein inhibitor Substances 0.000 title claims abstract description 34
- 150000001413 amino acids Chemical group 0.000 claims abstract description 43
- 201000010099 disease Diseases 0.000 claims abstract description 11
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 11
- 238000001727 in vivo Methods 0.000 claims abstract description 6
- 230000001404 mediated effect Effects 0.000 claims abstract description 6
- 239000003814 drug Substances 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 238000006467 substitution reaction Methods 0.000 claims description 8
- 238000002360 preparation method Methods 0.000 claims description 6
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 4
- 206010002556 Ankylosing Spondylitis Diseases 0.000 claims description 3
- 208000005024 Castleman disease Diseases 0.000 claims description 3
- 208000007465 Giant cell arteritis Diseases 0.000 claims description 3
- 208000003456 Juvenile Arthritis Diseases 0.000 claims description 3
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 claims description 3
- 206010065159 Polychondritis Diseases 0.000 claims description 3
- 206010003230 arteritis Diseases 0.000 claims description 3
- 206010052015 cytokine release syndrome Diseases 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 208000030533 eye disease Diseases 0.000 claims description 3
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 claims description 3
- 230000000306 recurrent effect Effects 0.000 claims description 3
- 208000011580 syndromic disease Diseases 0.000 claims description 3
- 206010043207 temporal arteritis Diseases 0.000 claims description 3
- 208000001528 Coronaviridae Infections Diseases 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims description 2
- 239000000700 radioactive tracer Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 16
- 108091005804 Peptidases Proteins 0.000 abstract description 6
- 239000004365 Protease Substances 0.000 abstract description 6
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 abstract description 6
- 230000002401 inhibitory effect Effects 0.000 abstract description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 abstract description 4
- 239000004471 Glycine Substances 0.000 abstract description 2
- 229940126585 therapeutic drug Drugs 0.000 abstract description 2
- 239000000470 constituent Substances 0.000 abstract 1
- 238000002474 experimental method Methods 0.000 description 11
- 229940079593 drug Drugs 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 9
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 9
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 7
- 102000010781 Interleukin-6 Receptors Human genes 0.000 description 6
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 6
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 102000004196 processed proteins & peptides Human genes 0.000 description 6
- 230000019491 signal transduction Effects 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 229960002685 biotin Drugs 0.000 description 5
- 235000020958 biotin Nutrition 0.000 description 5
- 239000011616 biotin Substances 0.000 description 5
- 210000004027 cell Anatomy 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000000034 method Methods 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- 239000011347 resin Substances 0.000 description 4
- 229920005989 resin Polymers 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- BDNKZNFMNDZQMI-UHFFFAOYSA-N 1,3-diisopropylcarbodiimide Chemical compound CC(C)N=C=NC(C)C BDNKZNFMNDZQMI-UHFFFAOYSA-N 0.000 description 3
- 101001065501 Escherichia phage MS2 Lysis protein Proteins 0.000 description 3
- KPFBUSLHFFWMAI-HYRPPVSQSA-N [(8r,9s,10r,13s,14s,17r)-17-acetyl-6-formyl-3-methoxy-10,13-dimethyl-1,2,7,8,9,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-17-yl] acetate Chemical compound C1C[C@@H]2[C@](CCC(OC)=C3)(C)C3=C(C=O)C[C@H]2[C@@H]2CC[C@](OC(C)=O)(C(C)=O)[C@]21C KPFBUSLHFFWMAI-HYRPPVSQSA-N 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 230000007062 hydrolysis Effects 0.000 description 3
- 238000006460 hydrolysis reaction Methods 0.000 description 3
- 239000002808 molecular sieve Substances 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 3
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 150000008575 L-amino acids Chemical class 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 102000057297 Pepsin A Human genes 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000012505 Superdex™ Substances 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 229950001565 clazakizumab Drugs 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000007783 downstream signaling Effects 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 230000008105 immune reaction Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 229950010006 olokizumab Drugs 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000006916 protein interaction Effects 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 229960003323 siltuximab Drugs 0.000 description 2
- 229950006094 sirukumab Drugs 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- HNKJADCVZUBCPG-UHFFFAOYSA-N thioanisole Chemical compound CSC1=CC=CC=C1 HNKJADCVZUBCPG-UHFFFAOYSA-N 0.000 description 2
- 229960003989 tocilizumab Drugs 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- VYMPLPIFKRHAAC-UHFFFAOYSA-N 1,2-ethanedithiol Chemical compound SCCS VYMPLPIFKRHAAC-UHFFFAOYSA-N 0.000 description 1
- -1 9-fluorenylmethoxycarbonyl) protecting group Chemical group 0.000 description 1
- 208000023761 AL amyloidosis Diseases 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 230000004163 JAK-STAT signaling pathway Effects 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- QUOGESRFPZDMMT-UHFFFAOYSA-N L-Homoarginine Natural products OC(=O)C(N)CCCCNC(N)=N QUOGESRFPZDMMT-UHFFFAOYSA-N 0.000 description 1
- QUOGESRFPZDMMT-YFKPBYRVSA-N L-homoarginine Chemical compound OC(=O)[C@@H](N)CCCCNC(N)=N QUOGESRFPZDMMT-YFKPBYRVSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 206010050513 Metastatic renal cell carcinoma Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 238000001142 circular dichroism spectrum Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 230000011132 hemopoiesis Effects 0.000 description 1
- 229940116886 human interleukin-6 Drugs 0.000 description 1
- 230000005661 hydrophobic surface Effects 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 229940059237 olamkicept Drugs 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 229950006348 sarilumab Drugs 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 108010004034 stable plasma protein solution Proteins 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 229950007269 vobarilizumab Drugs 0.000 description 1
Images
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a D-protein inhibitor aiming at interleukin-6 and application thereof. The D-protein inhibitor illustratively has the amino acid sequence shown in SEQ ID No. 1, with the constituent amino acids thereof all being in the D configuration except glycine. The D-protein inhibitor is not easy to hydrolyze by protease in vivo, has better thermal stability, simultaneously shows better inhibiting activity on interleukin-6, and can be developed into a therapeutic drug for related diseases mediated by interleukin-6.
Description
Technical Field
The invention belongs to the field of biochemistry, and particularly relates to a D-protein inhibitor aiming at interleukin-6 and application thereof.
Background
Compared with small molecular medicines, the biological macromolecular medicines such as polypeptide, antibody and the like have better bioactivity and target protein specificity, and especially when the target protein has large and flat hydrophobic surface, the small molecules are difficult to prepare medicines and can only be inhibited by the protein medicines. The polypeptide and protein medicine is composed of L-amino acid, and has various limitations, such as easy hydrolysis by protease, easy immune reaction, etc. There is a need for a protein drug that is resistant to hydrolysis and does not elicit an immune response to fill the gap of L-protein drugs.
The D-protein medicine is a protein which is natural and chiral and symmetrical with the L-protein medicine, has the characteristics of difficult immune reaction, incapability of being degraded by protease in vivo, easy chemical modification and the like, is focused in recent years, and a plurality of D-protein medicines are marketed in clinical trials at present.
Since interleukin-6 was first discovered in 1973, recent 50 years of research have shown that interleukin-6 is involved in a variety of biological events, such as immunomodulation, tumor growth, hematopoiesis, emergency response, and the like. Disruption of the hexamer formation of interleukin-6 with interleukin-6 receptor (IL-6 receptor) and gp130 is critical to inhibiting interleukin-6 signaling. However, the binding interface of such hexamers is too complex and extensive, making it very challenging to inhibit their formation with small molecules. Interleukin-6 has three sites involved in the formation of hexamer complexes, site I, site IIa and site IIIa, respectively. Wherein site I is the site where interleukin-6 binds to interleukin-6 receptor, which consists of two alpha-helices A and C, site IIa is the junction surface consisting of two alpha-helices A and C of interleukin-6, responsible for binding to gp130, site IIIa is the plane of the top of the alpha-helix bundle of interleukin-6, binding to gp 130.
Siltuximab (currently the only FDA approved interleukin-6 mab in the united states of america) and both monoclonal antibodies, sirukumab and Clazakizumab, which are still in clinical trials, bind to site I of interleukin-6, and such monoclonal antibodies can effectively inhibit downstream signaling by inhibiting interleukin-6 binding to its receptor and thus blocking its binding to the membrane protein gp 130. However, three signaling pathways are currently known for interleukin-6, the classical signaling pathway (trans-signaling) and trans-presentation (trans-presentation), respectively. Since transfer presentation is where one cell binds interleukin-6 with interleukin-6 receptor while being presented to bind gp130 on an adjacent cell membrane, this pathway is not interfered with by interleukin-6 site I binding antibodies. These three signaling pathways can be inhibited simultaneously for interleukin-6 site IIIa (Olokizumab), or for interleukin-6 receptor (Tocilizumab, sarilumab and Vobarilizumab.) or for gp130 (Olamkizept). By 2022, antibodies that bind to interleukin-6 site IIa have not been reported.
Since interleukin-6 is involved in numerous immune responses, each drug directed against inhibiting interleukin-6 signaling pathway has one or more corresponding therapeutic conditions. For example, the earliest interleukin-6 receptor inhibiting drug, tocilizumab, has passed clinical trials as a symptomatic: rheumatoid arthritis, juvenile idiopathic arthritis, multicenter Castleman's disease, giant cell arteritis, cytokine release syndrome and high-whisker arteritis, adult stills syndrome, graves' eye disease, recurrent polychondritis and ankylosing spondylitis are in clinical stage two to three.
Among them, the monoclonal antibody Siltuximab bound to interleukin-6 has passed the FDA certification, and is a multicenter postleman disease, which is being developed for the treatment of multiple myeloma and amyloid light chain amyloidosis in clinical secondary trials, and in addition, in clinical primary to secondary trials for solid tumors, prostate cancer, metastatic renal cell carcinoma and metastatic renal cancer. Sirukumab, olokizumab and Clazakizumab are in the third, third and second phases of the rheumatoid arthritis clinical trial, respectively. Monoclonal antibodies to gp130, olamkicept, are currently in clinical second-phase trials for symptomatic inflammatory bowel disease.
Disclosure of Invention
The technical object of the present invention is to provide a D-protein inhibitor against interleukin-6 (IL-6).
It is another technical object of the present invention to provide a pharmaceutical composition comprising the D-protein inhibitor of the present application.
Another technical object of the present invention is to provide the use of said D-protein inhibitors in the preparation of a medicament.
In one aspect, the present invention provides a D-protein inhibitor against interleukin-6, the amino acid sequence of which is selected from the following cases (1) to (4):
(1) An amino acid sequence shown in SEQ ID No. 1;
(2) An amino acid sequence with the same function, wherein any 1-10 amino acids in amino acid sequences shown in SEQ ID No. 1 are replaced by the same kind of amino acids respectively, and the amino acid sequences are selected from 35, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64 and 65;
(3) An amino acid sequence having the same function, which is obtained by substituting any one or more amino acids other than amino acids at positions 35, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64, 65 in the amino acid sequence shown in SEQ ID No. 1 with the same kind of amino acids; and
(4) The amino acid sequence shown in SEQ ID No. 1 has the same function as the amino acid sequence obtained by substitution in any combination of the substitution in the above case (2) and the substitution in the above case (3),
wherein the amino acids of the same class are classified into the same class by amino acid side chain groups, and
the same function means that the amino acid sequence obtained by substitution has the function of binding with interleukin-6 as the unsubstituted amino acid sequence.
In the amino acid sequence shown in SEQ ID No. 1, the 35, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64, 65 amino acids are positioned on the binding surface of the D-protein inhibitor and the interleukin-6.
In some embodiments, the amino acid sequence of the D-protein inhibitor against interleukin-6 of the present invention is the amino acid sequence having the same function, which is obtained by substituting 1 to 5, such as 1,2,3,4,5 amino acids in amino acids 1 to 5, such as 1,2,3,4,5 amino acids, of amino acids 1, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64, 65 of the amino acid sequence shown in SEQ ID No. 1.
In a specific embodiment, the amino acid sequence of the D-protein inhibitor is SEQ ID No. 1.
In specific embodiments, the secondary structure of the D-protein inhibitor is as follows: the novel double-helix composite material consists of 4 alpha-helices, wherein the first alpha-helix sequence is SEQ ID No. 2, the second alpha-helix sequence is SEQ ID No. 3, the third alpha-helix sequence is SEQ ID No. 4, and the fourth alpha-helix sequence is SEQ ID No. 5.
In a specific embodiment, the secondary structural sequence of the D-protein inhibitor is LHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHLLLHHHHHHHHHH HHHHHLLHHHHHHHHHHHL.
In another aspect, the invention provides a pharmaceutical composition comprising a therapeutically effective amount of the above-described D-protein inhibitor and a pharmaceutically acceptable carrier.
In another aspect, the present invention provides the use of the above D-protein inhibitor and the above pharmaceutical composition for the preparation of a medicament for the treatment of a disease.
In particular embodiments, the disease is an interleukin-6 mediated related disease.
In specific embodiments, the disease is selected from the group consisting of rheumatoid arthritis, juvenile idiopathic arthritis, multicenter Castleman's disease, giant cell arteritis, cytokine release syndrome, high whisker arteritis, adult stills syndrome, graves' eye disease, recurrent polychondritis, ankylosing spondylitis, and novel coronavirus infection.
In yet another aspect, the present invention provides the use of the above-described D-protein inhibitor and the above-described pharmaceutical composition for the preparation of an interleukin-6 in vivo tracer.
Advantageous effects
1: the D-protein inhibitor solves the problem that L-protein is easy to hydrolyze by in vivo protease.
2 the D-protein inhibitor has better thermal stability, and is beneficial to the transportation and the preservation of medicines.
3. The D-protein inhibitor provided by the invention has good inhibiting activity on interleukin-6 and has the potential of developing therapeutic drugs for interleukin-6 immune related diseases.
Drawings
Fig. 1: the chemical synthesis of D-25367, A is RP-HPLC elution curve and B is D-25367 mass spectrum, which shows that the measured molecular weight is 7329.67 and the calculated molecular weight is 7330.48.
Fig. 2: d-25367 thermal temperature change CD spectrogram.
Fig. 3: d-25367 and interleukin-6 on molecular sieve Superdex 200Increase 10/300column co-migration curve (A), and SDS-PAGE gel (B), in the figure, on: d-25367 alone; in (a): interleukin-6 alone; the following steps: d-25367 and interleukin-6 in a 1.1:1 molar ratio.
Fig. 4: the binding constants of D-25367 and interleukin-6 were determined by using a biofilm interference experiment.
Fig. 5: the effect of the point mutation (A) designed at the binding interface of D-25367 and the point mutation (B) designed at the binding interface of interleukin-6 on the interaction between proteins was studied by using a biological membrane interference experiment.
Fig. 6: the effect of D-25367 on interleukin-6 mediated downstream signaling pathway expression was verified using HEK-293T cells. The column height of each histogram in the graph is the average of every three sets of experiments, and the variance of every three sets of data is shown with thin lines protruding from the column height.
Fig. 7: SDS-PAGE gel of L-25367 and D-25367.
Detailed Description
Terminology
In the present application, the term "D-protein inhibitor" means that all amino acids constituting the protein are in the D configuration except glycine.
In the present application, in the secondary structural sequence, the letter "L" represents an irregular region, and the letter "H" represents an α -helix.
In this application, the term "pharmaceutically acceptable carrier" refers to any kind of solid, semi-solid or inert fluid excipient, filler, encapsulating or formulation auxiliary material known to those skilled in the art.
In the present application, the term "therapeutically effective amount" means an amount of the D-protein inhibitor of the invention contained in a pharmaceutical composition sufficient to achieve the intended purpose.
The present invention is described in detail below by way of specific examples to better understand the present invention by those skilled in the art, however, these examples are not intended to limit the scope of the present invention.
Preparation example 1
The preparation of the interleukin-6-directed D-protein inhibitor (hereinafter referred to as D-25367) of the present application is described in detail below by way of specific examples.
D-25367 was prepared by standard Fmoc solid phase peptide synthesis (Fmoc SPPS) and synthesized automatically by a Liberty blue microwave polypeptide synthesizer (CEM Corporation). The amino acid derivatives used for the experiments were purchased from Jiangsu Shen Lang Biotechnology Co., ltd (south China), N-Dimethylformamide (DMF), triisopropylsilane (TIPS), trifluoroacetic acid (TFA) and thioanisole were purchased from J & K Scientific Ltd. (Beijing.). N, N-Diisopropylcarbodiimide (DIC) and ethyl 2-oxime cyanoacetate (Oxyma) were purchased from Shanghai Tech Co., ltd., 1, 2-Ethanedithiol (EDT) was purchased from TCI (Shangghai, china) Development Co., ltd., diethyl ether was purchased from modern Development Co., ltd., ethyl ether was purchased from Oriental Chemicals, and acetonitrile was purchased from Mallinckrodt Baker, inc..
First, rink Amide AM resin was freed from Fmoc (9-fluorenylmethoxycarbonyl) protecting group with DMF solution containing 10% piperidine and 0.1M Oxyma at 90℃for 1 min. Then, the resin was washed 3 times with DMF. The resin (0.25 mmol), 4-fold equivalents of Fmoc protected amino acid (0.2 mM,5ml in DMF), 4-fold equivalents of Oxyma (1 mM,1ml in DMF), and 4-fold equivalents of DIC (0.5 mM,2ml in DMF) were mixed and coupled under microwave heating at 90℃for 2 minutes. At the end of the procedure, the peptide was cleaved from the resin with cleavage liquid (TFA/TIPS/thioanisole/water/EDT in a volume ratio of 82.5:5:5:2.5, vol/vol/vol/vol) for 3 hours. The solution was then concentrated under nitrogen stirring, precipitated with cold diethyl ether, then centrifuged and the supernatant was decanted, and repeated 3 times. The resulting precipitate was a crude peptide, which was then further purified by HPLC (high Performance liquid chromatography) to give D-25367 (amino acid sequence: GEEEVKEYLTRKFKDDPELVRLLREAIEVLLKAGEDPELVLSLIESLIHITGDPRAAVKLAKEFG (SEQ ID No: 1)). Reverse phase HPLC was performed on Shimadzu ProminenceHPLC. The a pump mobile phase was acetonitrile (0.1% tfa) and the B pump mobile phase was deionized water (0.1% tfa). The crude polypeptide was dissolved in water containing 50% acetonitrile and 0.1% TFA, filtered through a 0.22 μm filter, and the purified solution was lyophilized to give a pure polypeptide powder designated as D-25367. HPLC and mass spectrometry detection results of D-25367 are shown in FIG. 1.
Test example 1: structural identification of D-25367
The secondary structure of D-25367 was measured by a circular dichroism spectrometer (Chirascan V100/applied photophysics). The CD spectrum tests three CD curves at 25 deg.C, at 95 deg.C and at 25 deg.C back down, at 2 deg.C/min, respectively, in the interval of 260 to 180 nm. The D-25367 test concentration was 0.2mg/ml dissolved in PBS buffer (pH 7.4).
The results are shown in FIG. 2. The results show that negative peaks at 208 and 222 nm are exhibited at 25 ℃,95 ℃ and back to 25 ℃, typical α -helical secondary structure. Through further analysis, D-25367 consists of 4 alpha-helices, the first alpha-helix sequence is SEQ ID No. 2 (EEEVKEYLTRKF), the second alpha-helix sequence is SEQ ID No. 3 (PELVRLLREAIEVLLKA), the third alpha-helix sequence is SEQ ID No. 4 (PELVLSLIESLIHIT), and the fourth alpha-helix sequence is SEQ ID No. 5 (PRAAVKLAKEF), so that its secondary structural sequence is LHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHLLHHHHHHHHHHHL.
The experimental result also proves that the D-25367 has good thermal stability.
Test example 2: binding assays for D-25367 and Interleukin-6
D-25367 and interleukin binding analysis respectively use analytical molecular sieve chromatographic column co-migration experiment and biological membrane interference technology.
Analytical molecular sieve chromatographic column method
The D-25367 and interleukin-6 alone or in a 1.1:1 mixture were passed through a column (Superdex 200 increasing 10/300 column) with the same amount of substance, and then eluted samples were subjected to SDS-PAGE running to verify that D-25367 co-migrates with interleukin-6 as a target protein.
The results are shown in FIG. 3. As can be seen from FIG. 3, when interleukin-6 is mixed with D-25367, the peak position of the complex is higher than the peak position of each monomer, which means that the complex has a larger volume. And from the gel map can correspond to complexes where the peaks at the complexes are both.
Biological film interference technique (Octet RED96 e/ForteBio)
Biofilm interference techniques use an Octet instrument, using SA (streptavidin) probes that specifically bind biotin to bind biotinylated L-or D-interleukin-6. For D-interleukin-6, a biotin molecule is attached to the amino terminus of the protein during synthesis. Whereas the biotinylation of L-interleukin-6 is based on an Avi tag at the amino terminus, biotin is linked to L-interleukin-6 by biotin ligase.
The experimental procedure is as follows:
(1) Baseline 1: the SA probe was immersed in a phosphate buffer solution containing two parts per million of Tween-20 at pH7.4 (hereinafter abbreviated as PBST) for 60 seconds,
(2) Curing: biotinylated interleukin-6 was diluted in PBST to a final concentration of 10. Mu.g/ml, and SA probe was immersed in this solution for 120 seconds;
(3) Closing: (blocking solution 10. Mu.g/ml of biotin in PBST), immersing the SA probe in the blocking solution for 60 seconds,
(4) Baseline 2: immersed in the PBST for 60 seconds,
(5) Combining: immersed in a solution of D-25367 diluted in PBST at different concentrations of 250, 125, 62.5, 31.1, 15.6nM for 180 seconds (duration of single point mutation, fig. 5), or 300 seconds (duration of binding constant measurement, fig. 4),
(6) Dissociation: immersed in PBST for 180 seconds,
(7) The binding constant was measured to be 28.3.+ -. 0.3nM (see FIG. 4).
In addition, point mutations were designed at the binding interface of D-25367 or interleukin-6, respectively, to verify the effect of these point mutations on protein interaction performance.
The results are shown in FIG. 5. From FIG. 5 it can be seen that the binding interface of D-25367 with interleukin-6 is consistent with the design.
Test example 3: d-25367 cell Activity experiment
Interleukin-6 mediated JAK-STAT signaling pathway has been demonstrated to be useful in measuring human placental secreted alkaline phosphatase (SEAP) expression to quantify signaling pathways.
In this experiment, a plasmid containing PhCMV-h interleukin-6R-pA (40 ng), phCMV-hSTAT3-pA (40 ng) and PhSTAT3-SEAP-pA (20 ng) was transfected into 1X 10 4 SEAP was expressed in HEK-293T cells to sense extracellular interleukin-6. The transfected cells were combined with different concentrations of D-25367 and human interleukin-6 were incubated in Dulbecco's Modified Eagle Medium (DMEM) medium containing 10% Fetal Bovine Serum (FBS) at 37℃in an incubator with 5% carbon dioxide for 48 hours. The cell culture supernatant was then heat-inactivated (65 ℃ C., 30 min) and 80. Mu.l of the supernatant was combined with 120. Mu.l of a substrate solution [ 100. Mu.l of a double concentration SEAP detection buffer containing 20mmol of homoarginine, 1mmol of magnesium chloride, 21% (v/v) diethanolamine pH 9.8 and 20. Mu.l of a substrate solution containing 120mmol of p-nitrophenylphosphoric acid]Mixing. Interleukin-6 signaling was assessed by measuring SEAP production in the cell culture medium. Absorbance in enzyme activity units/L was recorded at 405nmol (37 ℃) using a Synergy H1 hybrid multimode microplate reader (BioTek instruments).
The results are shown in FIG. 6, from which it can be seen that D-25367 can significantly inhibit interleukin-6 mediated signaling pathway.
Test example 4: hydrolysis experiments of D-25367 protease
In the proteolytic experiments, the protein concentration was 0.2mg/ml, incubated at 37℃in trypsin and pepsin solutions, respectively, while the chiral mirror polypeptide L-25367 of D-25367 (identical in amino acid sequence but composed of L-amino acids) was used as a control. In the experiments, the final concentrations of trypsin and pepsin were 2.2 and 0.22mg/ml, respectively, and samples were taken at 6 and 20 hours of incubation, and verified by SDS-PAGE running.
The results are shown in FIG. 7. As can be seen from FIG. 7, D-25367 of the present application is not easily hydrolyzed by protease, showing good in vivo stability.
Claims (9)
1. A D-protein inhibitor against interleukin-6, the amino acid sequence of which is selected from the following cases (1) - (4):
(1) An amino acid sequence shown in SEQ ID No. 1;
(2) An amino acid sequence with the same function, wherein any 1-10 amino acids in amino acid sequences shown in SEQ ID No. 1 are replaced by the same kind of amino acids respectively, and the amino acid sequences are selected from 35, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64 and 65;
(3) An amino acid sequence having the same function, which is obtained by substituting any one or more amino acids other than amino acids at positions 35, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64, 65 in the amino acid sequence shown in SEQ ID No. 1 with the same kind of amino acids; and
(4) The amino acid sequence shown in SEQ ID No. 1 has the same function as the amino acid sequence obtained by substitution in any combination of the substitution in the above case (2) and the substitution in the above case (3),
wherein the amino acids of the same class are classified into the same class by amino acid side chain groups, and
the same function means that the amino acid sequence obtained by substitution has the function of binding with interleukin-6 as the unsubstituted amino acid sequence.
2. The D-protein inhibitor according to claim 1, wherein the amino acid sequence of the D-protein inhibitor shown in the amino acid sequence of SEQ ID No. 1 has the same function as an amino acid sequence obtained by substituting 1 to 5 amino acids in amino acids at positions 35, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 50, 51, 53, 56, 59, 60, 63, 64, 65 with the respective amino acids of the same class.
3. The D-protein inhibitor according to claim 1, wherein the amino acid sequence of the D-protein inhibitor is SEQ ID No. 1.
4. The D-protein inhibitor according to claim 1, wherein the D-protein inhibitor consists of 4 a-helices, the first a-helix sequence being SEQ ID No. 2, the second a-helix sequence being SEQ ID No. 3, the third a-helix sequence being SEQ ID No. 4, the fourth a-helix sequence being SEQ ID No. 5.
5. A pharmaceutical composition comprising a therapeutically effective amount of the D-protein inhibitor of any one of claims 1-4 and a pharmaceutically acceptable carrier.
6. Use of a D-protein inhibitor according to any one of claims 1-4 or a pharmaceutical composition according to claim 5 in the manufacture of a medicament for the treatment of a disease.
7. The use according to claim 6, wherein the disease is an interleukin-6 mediated related disease.
8. The use according to claim 6, wherein the disease is selected from rheumatoid arthritis, juvenile idiopathic arthritis, multicenter Castleman's disease, giant cell arteritis, cytokine release syndrome, high whisker arteritis, adult stills syndrome, graves' eye disease, recurrent polychondritis, ankylosing spondylitis and novel coronavirus infection.
9. Use of a D-protein inhibitor according to any one of claims 1-4 or a pharmaceutical composition according to claim 5 for the preparation of an interleukin-6 in vivo tracer.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211684805.3A CN116003530B (en) | 2022-12-27 | 2022-12-27 | D-protein inhibitor for interleukin-6 and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211684805.3A CN116003530B (en) | 2022-12-27 | 2022-12-27 | D-protein inhibitor for interleukin-6 and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN116003530A true CN116003530A (en) | 2023-04-25 |
CN116003530B CN116003530B (en) | 2023-12-15 |
Family
ID=86032114
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211684805.3A Active CN116003530B (en) | 2022-12-27 | 2022-12-27 | D-protein inhibitor for interleukin-6 and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116003530B (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999060013A2 (en) * | 1998-05-18 | 1999-11-25 | Applied Research Systems Ars Holding N.V. | Il-6 antagonist peptides |
US20060094663A1 (en) * | 2004-05-05 | 2006-05-04 | Sylvain Chemtob | Interleukin-1 receptor antagonists, compositions, and methods of treatment |
WO2009143865A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
-
2022
- 2022-12-27 CN CN202211684805.3A patent/CN116003530B/en active Active
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999060013A2 (en) * | 1998-05-18 | 1999-11-25 | Applied Research Systems Ars Holding N.V. | Il-6 antagonist peptides |
US20060094663A1 (en) * | 2004-05-05 | 2006-05-04 | Sylvain Chemtob | Interleukin-1 receptor antagonists, compositions, and methods of treatment |
WO2009143865A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
Also Published As
Publication number | Publication date |
---|---|
CN116003530B (en) | 2023-12-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US5240912A (en) | Transforming growth factor (TGF) peptides | |
US4816561A (en) | Biologically active polypeptides | |
FI90255C (en) | A method of producing a polypeptide which is complementary to at least a portion of an original peptide or protein and utilizing the complementary polypeptide | |
US4863899A (en) | Biologically active polypeptides | |
EP3091028A1 (en) | Fibronectin based scaffold proteins having improved stability | |
AU623589B2 (en) | Platelet related growth regulator | |
EP0227619A2 (en) | New protein and its use | |
CA2089212C (en) | Antibodies to human gastrin-releasing peptide precusor and use thereof | |
CN116003530B (en) | D-protein inhibitor for interleukin-6 and application thereof | |
US5789382A (en) | Retro-peptide fibroblast growth factor which blocks FGF receptor | |
EP0132021B1 (en) | Tgf polypeptides, antigenic oligopeptides derived therefrom and antibodies produced therefrom | |
EP0811683B1 (en) | Antibodies to human gastrin-releasing peptide precursor and use thereof | |
CN118126136A (en) | D-protein inhibitor for interleukin-6 and application thereof | |
CA2285700C (en) | Renin-active substance | |
JPH07508494A (en) | Peptides representing R-IFN-beta epitope sites, antibodies thereto, and uses thereof | |
JPH02504579A (en) | Methods and compositions for producing ACSF and ACSF antagonists | |
JPH07508510A (en) | Platelet-derived growth factor (PDGF) activity | |
WO2023030408A1 (en) | TGFβRII MUTANT AND APPLICATION THEREOF | |
JPH0570484A (en) | Peptide and its salt | |
JPH02152988A (en) | Peptide compound and antiserum and antibody produced by using the peptide compound | |
CN114099423A (en) | Preparation of targeting CD47 and PD-L1 bifunctional fusion protein | |
JPH0578391A (en) | Peptide and its salt | |
CN116253774A (en) | TIM-3 affinity peptide and application thereof | |
CN118047851A (en) | High-affinity D-protein inhibitor aiming at tropomyosin receptor kinase D5 structural domain and application thereof | |
JPH0570482A (en) | Peptide and its salt |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |