CN115960216A - Anti-respiratory syncytial virus antibodies and uses thereof - Google Patents
Anti-respiratory syncytial virus antibodies and uses thereof Download PDFInfo
- Publication number
- CN115960216A CN115960216A CN202211182850.9A CN202211182850A CN115960216A CN 115960216 A CN115960216 A CN 115960216A CN 202211182850 A CN202211182850 A CN 202211182850A CN 115960216 A CN115960216 A CN 115960216A
- Authority
- CN
- China
- Prior art keywords
- seq
- variable region
- chain variable
- amino acid
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 241000700605 Viruses Species 0.000 title claims abstract description 13
- 230000003097 anti-respiratory effect Effects 0.000 title claims abstract description 7
- 238000000034 method Methods 0.000 claims abstract description 38
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 136
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 82
- 241000725643 Respiratory syncytial virus Species 0.000 claims description 63
- 210000004027 cell Anatomy 0.000 claims description 52
- 239000004005 microsphere Substances 0.000 claims description 45
- 238000001514 detection method Methods 0.000 claims description 37
- 238000003317 immunochromatography Methods 0.000 claims description 36
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 claims description 34
- 239000011248 coating agent Substances 0.000 claims description 32
- 238000000576 coating method Methods 0.000 claims description 32
- 210000004408 hybridoma Anatomy 0.000 claims description 27
- 239000004816 latex Substances 0.000 claims description 22
- 229920000126 latex Polymers 0.000 claims description 22
- 239000003153 chemical reaction reagent Substances 0.000 claims description 20
- 230000014509 gene expression Effects 0.000 claims description 19
- 238000002965 ELISA Methods 0.000 claims description 14
- 108090000623 proteins and genes Proteins 0.000 claims description 14
- 239000013604 expression vector Substances 0.000 claims description 11
- 108090000790 Enzymes Proteins 0.000 claims description 8
- 102000004190 Enzymes Human genes 0.000 claims description 8
- 210000003292 kidney cell Anatomy 0.000 claims description 8
- 238000009629 microbiological culture Methods 0.000 claims description 8
- 229910052799 carbon Inorganic materials 0.000 claims description 7
- 238000004321 preservation Methods 0.000 claims description 6
- 239000002096 quantum dot Substances 0.000 claims description 5
- 238000011160 research Methods 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 4
- 230000002906 microbiologic effect Effects 0.000 claims description 4
- 230000000630 rising effect Effects 0.000 claims description 4
- 241000282693 Cercopithecidae Species 0.000 claims description 3
- 241000699800 Cricetinae Species 0.000 claims description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 2
- 210000004962 mammalian cell Anatomy 0.000 claims description 2
- 239000013600 plasmid vector Substances 0.000 claims description 2
- 208000008732 thymoma Diseases 0.000 claims description 2
- 230000035945 sensitivity Effects 0.000 abstract description 28
- 238000002360 preparation method Methods 0.000 abstract description 7
- 238000011896 sensitive detection Methods 0.000 abstract description 2
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 56
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 description 26
- 239000000427 antigen Substances 0.000 description 24
- 108091007433 antigens Proteins 0.000 description 24
- 102000036639 antigens Human genes 0.000 description 24
- 238000012360 testing method Methods 0.000 description 22
- 239000012528 membrane Substances 0.000 description 20
- 239000006228 supernatant Substances 0.000 description 19
- 238000010790 dilution Methods 0.000 description 12
- 239000012895 dilution Substances 0.000 description 12
- 239000000020 Nitrocellulose Substances 0.000 description 10
- 238000002156 mixing Methods 0.000 description 10
- 229920001220 nitrocellulos Polymers 0.000 description 10
- 239000008055 phosphate buffer solution Substances 0.000 description 10
- 230000027455 binding Effects 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 238000004587 chromatography analysis Methods 0.000 description 9
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 7
- 239000002299 complementary DNA Substances 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 235000018102 proteins Nutrition 0.000 description 6
- 102000004169 proteins and genes Human genes 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000012258 culturing Methods 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 238000012163 sequencing technique Methods 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 238000003756 stirring Methods 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical group COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 4
- SXGZJKUKBWWHRA-UHFFFAOYSA-N 2-(N-morpholiniumyl)ethanesulfonate Chemical compound [O-]S(=O)(=O)CC[NH+]1CCOCC1 SXGZJKUKBWWHRA-UHFFFAOYSA-N 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 4
- 230000000712 assembly Effects 0.000 description 4
- 238000000429 assembly Methods 0.000 description 4
- 230000000903 blocking effect Effects 0.000 description 4
- 239000007853 buffer solution Substances 0.000 description 4
- 239000006285 cell suspension Substances 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 238000002372 labelling Methods 0.000 description 4
- -1 microtiter plates Substances 0.000 description 4
- 238000012123 point-of-care testing Methods 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- 238000010839 reverse transcription Methods 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 230000003248 secreting effect Effects 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 3
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 239000007987 MES buffer Substances 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- 230000002745 absorbent Effects 0.000 description 3
- 239000002250 absorbent Substances 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 238000009835 boiling Methods 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 229920000728 polyester Polymers 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 238000011725 BALB/c mouse Methods 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 108091006027 G proteins Proteins 0.000 description 2
- 102000030782 GTP binding Human genes 0.000 description 2
- 108091000058 GTP-Binding Proteins 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 2
- 101710141454 Nucleoprotein Proteins 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 206010061603 Respiratory syncytial virus infection Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 2
- 239000004327 boric acid Substances 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 229910002091 carbon monoxide Inorganic materials 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000007910 cell fusion Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000004140 cleaning Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000012136 culture method Methods 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 238000000424 optical density measurement Methods 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000007747 plating Methods 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 101710180643 Leishmanolysin Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 241000711504 Paramyxoviridae Species 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000711902 Pneumovirus Species 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920002535 Polyethylene Glycol 1500 Polymers 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000011230 antibody-based therapy Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000009668 clonal growth Effects 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000003365 glass fiber Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000012007 large scale cell culture Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 238000002796 luminescence method Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 238000000765 microspectrophotometry Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 229910021642 ultra pure water Inorganic materials 0.000 description 1
- 239000012498 ultrapure water Substances 0.000 description 1
- 239000012224 working solution Substances 0.000 description 1
Images
Landscapes
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The present invention relates to novel monoclonal anti-Respiratory Syncytial Virus (RSV) antibodies, methods for their preparation, and their related uses for immunodetection. The monoclonal anti-RSV antibody of the invention exhibits high sensitivity and high specificity against RSV, and can be used for detecting RSV at nanogram concentration in a chromatographic platform, and can realize more sensitive detection of the concentration such as picogram in other platforms such as chemiluminescence method.
Description
Technical Field
The invention relates to the field of virus detection, and in particular relates to a monoclonal anti-Respiratory Syncytial Virus (RSV) antibody, a preparation method thereof and a related application thereof in immunodetection.
Background
Respiratory syncytial virus (RSV virus) belongs to the genus Pneumovirus of the family Paramyxoviridae, and is an enveloped single-stranded negative-strand RNA virus. RSV virus causes around 6400 million infections annually, resulting in over 300 million hospitalizations for infants, leading to 16 million deaths. Therefore, sensitive and rapid detection of RSV infection is extremely important, and antibodies against RSV virus are an important part of immunodiagnosis of RSV infection.
RSV expresses two major surface glycoproteins: fusion proteins (F proteins) and attachment proteins (G proteins). The genetic variability of the F protein is less than that of the G protein, which binds to specific receptors on the surface of the host cell membrane, mediates fusion of the viral envelope with the host cell plasma membrane, and causes viral nucleic acid to enter the host cell and be replicated. Thus, RSV F protein is a very attractive target for immunodetection and antibody-based therapies.
The existing antibodies for resisting RSV F protein at present have defects in the aspects of sensitivity and specificity, can cause false negative results in clinic and still have great improvement space. Therefore, there remains a need in the art for an anti-RSV F protein antibody with high specificity and high sensitivity.
Disclosure of Invention
As previously mentioned, there is a need in the art for an anti-RSV antibody with high specificity and high sensitivity.
The inventor uses the purified RSV fusion protein as immunogen to induce mice to generate immune response, obtains hybridoma cell strains capable of secreting anti-RSV monoclonal antibodies by using a hybridoma technology, collects supernatant by using an in vitro roller bottle culture method to obtain a large number of anti-RSV monoclonal antibodies, and obtains the anti-RSV antibodies with high sensitivity and high specificity by screening. Thus, the present invention has been achieved.
In a first aspect, the invention provides a monoclonal anti-Respiratory Syncytial Virus (RSV) antibody, which is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOs: 1-3, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 4-6, respectively L CDR1、V L CDR2 and V L CDR3, wherein the sequence shown in SEQ ID NO. 6 is QQYSNFPXT, and X is C or F.
In a second aspect, the present invention provides a hybridoma cell, which is deposited at 14 days 7 months in 2022 at the common microorganism center of China general microbiological culture Collection center (CGMCC) of institute of microbiology, china institute of sciences, no. 3, west Lu 1, north Chen, korean, beijing, with the collection number of CGMCC No.45238.
In a third aspect, the present invention provides an expression vector comprising a polynucleotide encoding a monoclonal antibodyA gene of an anti-RSV antibody, wherein the monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 1-3, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 4-6, respectively L CDR1、V L CDR2 and V L CDR3, wherein the sequence shown in SEQ ID NO. 6 is QQYSNFPXT, wherein X is C or F, and especially X is F.
In a fourth aspect, the present invention provides an expression cell comprising the expression vector of the third aspect.
In a fifth aspect, the present invention provides a method of detecting Respiratory Syncytial Virus (RSV), for non-diagnostic or diagnostic purposes, comprising the step of using the monoclonal anti-RSV antibody of the first aspect.
In a sixth aspect, the invention provides the use of a monoclonal anti-RSV antibody according to the first aspect in the manufacture of a reagent for the detection of Respiratory Syncytial Virus (RSV).
In a seventh aspect, the present invention provides a monoclonal anti-RSV antibody combination for immunological detection, comprising a first monoclonal anti-RSV antibody as a labeled antibody and a second monoclonal anti-RSV antibody as a coating antibody, wherein,
the first monoclonal anti-RSV antibody is the monoclonal anti-RSV antibody of the first aspect;
the second monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3；
Or alternatively
The first sheetThe monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3，
The second monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody of the first aspect of the invention;
or
The first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3，
The second monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody of the first aspect of the invention.
In an eighth aspect, the invention provides a kit for detecting Respiratory Syncytial Virus (RSV), the kit comprising the monoclonal anti-RSV antibody of the first aspect and instructions for detecting Respiratory Syncytial Virus (RSV).
In conclusion, the invention provides a novel anti-RSV monoclonal antibody, which shows high sensitivity and high specificity aiming at RSV, can be used for RSV detection of nanogram and even picogram concentration, and greatly improves the sensitivity of RSV detection and analysis. The anti-RSV antibody of the invention can be applicable to various immunochromatography detections such as fluorescent microsphere chromatography, colloidal gold chromatography and colored microsphere chromatography; ELISA assays such as direct, indirect, sandwich and competitive; a chemiluminescence method; electrochemical luminescence method, etc. The anti-RSV antibodies of the invention exhibit high sensitivity and specificity for RSV, can be used for nanogram concentration detection in chromatographic platforms, and can achieve more sensitive detection of picogram concentrations in other platforms such as chemiluminescence.
Drawings
In order to more clearly illustrate the detailed description of the invention or the technical solutions in the prior art, the drawings that are needed in the detailed description of the invention or the prior art will be briefly described below.
FIG. 1 shows SDS-PAGE electrophorograms (loading 5. Mu.g per well) of antibodies RSV101, RSV200 and RSV300 of the invention.
FIG. 2 shows OD measurements of antibodies RSV101, RSV200 and RSV300 of the invention measured by a microplate reader 450nm Absorbance curve.
FIG. 3 shows OD measurements of antibodies RSV101 and RSV102 of the invention measured by a microplate reader 450nm Absorbance curve.
Fig. 4 shows a schematic diagram of a colloidal gold colorimetric card used in the present invention.
FIG. 5 shows sensitivity curves for exemplary fluorescent microsphere immunochromatographic test agents prepared from antibodies of the present invention to recombinant antigens of RSV fusion proteins.
Detailed Description
Hereinafter, the present invention will be described in detail with reference to the accompanying drawings. It is to be understood that the following description is intended to illustrate the present invention by way of example only and is not intended to limit the scope of the invention, which is defined by the appended claims. Also, it is understood by those skilled in the art that modifications may be made to the technical aspects of the present invention without departing from the spirit and gist of the present invention. Unless otherwise specified, the technical means used in the examples are conventional means well known to those skilled in the art.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the subject matter of this invention belongs. Before describing the present invention in detail, the following definitions are provided to better understand the present invention.
Where a range of values is provided, such as a concentration range, a percentage range, or a ratio range, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the subject matter described. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and such embodiments are also encompassed within the subject matter, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the subject matter.
In the context of the present invention, many embodiments use the expressions "comprise", "include" or "consist essentially/essentially of \8230; \8230. The expressions "comprising", "including" or "consisting essentially of (8230); 8230%" generally are to be understood as open-ended expressions that include not only the elements, components, assemblies, method steps, etc. specifically listed below in the expression, but also other elements, components, assemblies, method steps. In addition, in this document, the expressions "comprising", "including" or "consisting essentially of/8230; \8230;" 8230 ";" consisting of "may also be understood in some cases as a closed expression, meaning that it includes only the elements, components, assemblies, method steps specifically listed after the expression, and does not include any other elements, components, assemblies, method steps. At this time, the expression is equivalent to the expression "consisting of \8230; composition".
For a better understanding of the present teachings and not to limit the scope of the present teachings, unless otherwise indicated, all numbers expressing quantities, percentages or proportions used in the specification and claims, as well as other numerical values, are to be understood as being modified in all instances by the term "about". Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained. At the very least, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques.
As used herein, the term "antibody" refers to an immunoglobulin molecule typically composed of two pairs of polypeptide chains, each pair having one "light" (L) chain and one "heavy" (H) chain. Antibody light chains can be classified as kappa and lambda light chains. Heavy chains can be classified as μ, δ, γ, α or ε, and the antibody isotypes can be defined accordingly as IgM, igD, igG, igA, and IgE, respectively. Within the light and heavy chains, the variable and constant regions are connected by a "J" region (hinge region) of about 12 or more amino acids, and the heavy chain also comprises a "D" region of about 3 or more amino acids. Each heavy chain is composed of a heavy chain variable region (V) H ) And heavy chain constant region (C) H ) And (4) forming. The heavy chain constant region consists of 3 domains (C) H1 、C H2 And C H3 ) And (4) forming. Each light chain is composed of a light chain variable region (V) L ) And a light chain constant region (C) L ) And (4) forming. The light chain constant region consists of a domain C L And (4) forming. The constant region of the antibody may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component of the classical complement system (C1 q). V H And V L Regions may also be subdivided into regions of high denaturation, called Complementarity Determining Regions (CDRs), interspersed with regions that are more conserved, called Framework Regions (FRs). For each heavy or light chain, the variable region comprises three CDRs, namely CDR1, CDR2 and CDR3, respectively. Thus, each V H And V L By the following sequence: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 consist of 3 CDRs and 4 FRs arranged from amino terminus to carboxy terminus. Variable region (V) of each heavy/light chain pair H And V L ) Respectively, forming an antigen binding site.
The assignment rules for assigning amino acids to regions or domains are defined in a number of documents: kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, bethesda M.d. (1987 and 1991)); chothia & Lesk J.mol.biol.1987;196 parts by weight; chothia et al, nature 1989;342 from 878 to 883; ehrenmann, francois, quentin Kaas, and Marie-PauleLefranc, "IMGT/3Dstructure-DB and IMGT/DomainGapAlign," a database and a tool for immunoglobulin or antibodies, T cell receptors, MHC, igSF and MhcSF, "Nucleic acids research 2009;38 (Suppl _ 1) D301-D307.
The exact boundaries of the CDRs have been defined differently according to different systems, the Kabat system not only provides a clear residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining 3 CDRs, which are referred to as Kabat CDRs; chothia found that Kabat system CDR within certain sub-part, although at the amino acid sequence level has a large diversity, but with almost the same peptide backbone conformation, these sub-part is called Chothia CDR, chothia CDR with Kabat CDR overlapping boundary. The boundaries of the above overlap are again described by Padlan and maccall, and CDR boundary definitions may not strictly adhere to the above system, such as the AbM definition. Herein, the CDRs may be defined according to any of these systems, although the preferred embodiment uses the antibody numbering system of Chothia et al to define the CDRs. V of antibodies according to the Chothia numbering system H CDR1 is located at positions 26 to 32, V H CDR2 is located at positions 52 to 57, V H CDR3 is located at positions 99 to 108, and V L CDR1 is in position 24 to 39, V L CDR2 is located at positions 55 to 61 and V L CDR3 is located at positions 94 to 102.
As used herein, the term "monoclonal antibody" or "monoclonal antibody" refers to an antibody or a fragment of an antibody from a population of highly homologous antibody molecules, i.e., a population of identical antibody molecules except for natural mutations that may occur spontaneously. The antibody molecule is an immunoglobulin, whether it is a natural immunoglobulin or an immunoglobulin that is partially or wholly synthetically obtained. The antibody molecules also include all polypeptides or proteins having binding domains of antibody domains, antibody fragments having antibody domains are molecules such as Fab, scFv, fv, dAb, fd, and diabodies. The monoclonal antibody has high specificity to a single epitope on the antigen. Polyclonal antibodies are relative to monoclonal antibodies, which typically comprise at least 2 or more different antibodies that typically recognize different epitopes on an antigen. Monoclonal antibodies are generally obtained using the hybridoma technique first reported by Kohler et al (A)
G,Milstein C.Continuous cultures of fused cells secreting antibody of predefined specificity[J]Nature,1975;256 (5517): 495), but can also be obtained using recombinant DNA techniques (see, e.g., U.S. Pat. No.4,816,567). As used herein, the terms "monoclonal antibody" and "monoclonal antibody" have the same meaning and are used interchangeably; the terms "polyclonal antibody" and "polyclonal antibody" have the same meaning and are used interchangeably; the terms "polypeptide" and "protein" have the same meaning and are used interchangeably. Also, in the present invention, amino acids are generally represented by single-letter and three-letter abbreviations as is well known in the art. For example, alanine can be represented by A or Ala.
As described above, the present invention aims to provide a monoclonal anti-RSV antibody having high sensitivity and high specificity.
In a first aspect, the invention provides a monoclonal anti-Respiratory Syncytial Virus (RSV) antibody, which is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOs: 1-3, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 4-6, respectively L CDR1、V L CDR2 and V L CDR3, wherein the sequence shown in SEQ ID NO. 6 is QQYSNFPXT, and X is C or F.
In some embodiments, the antibody comprises at least six CDRs.
In some preferred embodiments, the antibody comprises:
1) A heavy chain variable region comprising or consisting of the sequence:
SEQ ID NO:19, or an amino acid sequence substantially identical to SEQ ID NO:19, or a sequence having 80% or more, 85% or more, 90% or more, or 95% or more identity, preferably 95% or more identity, to the amino acid sequence;
2) A light chain variable region comprising or consisting of the sequence:
SEQ ID NO:20, or an amino acid sequence substantially identical to SEQ ID NO:20 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more, preferably 95% or more.
In some embodiments, the antibody may be an intact antibody comprising a variable region and a constant region. For the antibodies of the invention, any Framework Region (FR) as well as any constant region may be used. The amino acid sequence of the FR or constant region used in the antibody of the present invention may be the amino acid sequence of the original FR or constant region from which it is derived, or may be a different amino acid sequence obtained by substituting, deleting, adding and/or inserting 1 or more amino acids into the amino acid sequence of the original FR or constant region. The structures used to support the CDRs or sets of CDRs of the invention are generally of antibody heavy or light chain sequence or major portion thereof, wherein the CDRs or sets of CDRs are located in naturally occurring V encoded by rearranged immunoglobulin genes H And V L The CDR or set of CDRs of an antibody variable domain are in the corresponding position.
In some embodiments, the antibody can be one of a nanobody, a Fab, a dAb, an Fd, an Fv, a scFv, and a diabody.
In some embodiments, the antibody further comprises a constant region sequence.
In some embodiments, the constant region sequence may be a constant region sequence selected from any one of IgG, lgA, igM, igE, igD.
In some embodiments, the constant region sequence species is derived from a mouse.
In an exemplary embodiment, the constant region sequence may comprise or consist of:
an amino acid sequence shown as SEQ ID NO. 25; and
26, SEQ ID NO.
In a preferred embodiment, the V of the antibody L CDR3 is QQYSNFPCT, and is deposited in Beijing at 7 months and 14 days 2022The hybridoma is produced by the hybridoma with the preservation number of CGMCC No.45238 from China general microbiological culture Collection center (CGMCC) of the microbiological research institute of China academy of sciences, no. 3 of West Lu, no. 1 of the Chancidere, city, the Chaoyang region.
In a second aspect, the present invention provides a hybridoma cell, which is deposited in the common microorganism center of China general microbiological culture Collection center (CGMCC) of the institute of microbiology, china academy of sciences, no. 3, north Chen Lu No. 1 institute of China, chaozhou, chaoyang, beijing, 7 months and 14 days in 2022, with the collection number of CGMCC No.45238.
In a third aspect, the present invention provides an expression vector comprising a gene encoding a monoclonal anti-RSV antibody, wherein the monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS: 1-3, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 4-6, respectively L CDR1、V L CDR2 and V L CDR3, wherein the sequence shown in SEQ ID NO. 6 is QQYSNFPXT, wherein X is C or F, and especially X is F.
In a preferred embodiment, for the monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO 19 or a sequence identical to SEQ ID NO:19 has a sequence with more than 80%, more than 85%, more than 90% or more than 95% identity, and the light chain variable region comprises the amino acid sequence shown in SEQ ID NO:20 or a sequence which is identical to the amino acid sequence shown in SEQ ID NO:20 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
In a preferred embodiment, the expression vector may be a plasmid vector, such as pcdna3.1, pEE12, pCAGGS.
In a fourth aspect, the present invention provides an expression cell comprising the expression vector of the third aspect.
As described above, the present inventors induced immune response in mice by using purified RSV fusion protein (F protein, SEQ ID NO: 27) as an immunogen, then obtained hybridoma cell lines capable of secreting anti-RSV monoclonal antibodies by hybridoma technology, collected supernatants by in vitro roller bottle culture method to obtain a large amount of anti-RSV antibodies, and screened to obtain monoclonal anti-RSV antibodies with high sensitivity and high specificity, which was named RSV101.
Other antibodies or chimeric molecules that retain the specificity of the original antibody can be produced using monoclonal and other antibody and recombinant DNA techniques, which can include the introduction of DNA encoding the immunoglobulin variable regions or Complementarity Determining Regions (CDRs) of an antibody into the constant regions or constant regions of a different immunoglobulin plus framework regions. On the basis, the inventor further mutates the light chain CDR3 of the RSV101 to enable the light chain CDR3 sequence QQYSNFPCT of the RSV101 to be QQYSNFPT, then constructs a recombinant antibody eukaryotic expression vector, introduces the vector into a CHO host cell, screens out a stably expressed recombinant antibody cell strain, and names the secreted antibody to RSV102.
In one embodiment, the expression cell can be a mammalian cell, such as a chinese hamster ovary cell, a small hamster kidney cell, a monkey kidney cell, a mouse thymoma cell, a human embryonic kidney cell. In a more specific embodiment, the expression cell can be, for example, a SV40 transformed monkey kidney cell (COS-7, ATCC CRL1651), a human embryonic kidney cell (HEK 293 or HEK293 cell subcloned for growth in suspension culture, graham et al, 1977, J.Gen Virol.36. In a preferred embodiment, the expression cell may be a HEK293 cell.
In a fifth aspect, the present invention provides a method of detecting Respiratory Syncytial Virus (RSV), for non-diagnostic or diagnostic purposes, comprising the step of using the monoclonal anti-RSV antibody of the first aspect.
In a specific embodiment, the detection is performed by immunochromatography, enzyme-labeled antibody method (ELISA), chemiluminescence, electrochemiluminescence.
In a preferred embodiment, the enzyme-labeled antibody method may be a direct method, an indirect method, a sandwich method, and a competition method.
In a preferred embodiment, the immunochromatography includes, but is not limited to, fluorescent microsphere immunochromatography, colloidal gold immunochromatography, immunochromatography based on colored latex microspheres, time-resolved fluorescent microsphere immunochromatography, magnetic microsphere immunochromatography, and quantum dot immunochromatography.
In the present invention, the monoclonal anti-RSV antibody can be used as a coating antibody. For example, monoclonal anti-RSV antibodies are bound to a solid phase, such as a solid support. The solid support used in the detection method of the present invention is not particularly limited, and may be a porous or non-porous material, such as magnetic beads, latex microspheres, fluorescent microspheres, microtiter plates, nitrocellulose membranes, microfluidic chips, and the like.
The detection method of the present invention can be used for point-of-care testing (POCT) or electrochemical immunoassay systems. The detection method according to the invention or any exemplary form thereof may be used in automated and semi-automated systems and optimized on a case-by-case basis.
Without wishing to be bound by theory, the monoclonal anti-RSV antibodies may also be used as labeled antibodies. For example, the monoclonal anti-RSV antibody is bound to magnetic beads, microspheres, enzymes, fluorescent dyes, biotin, streptavidin, quantum dots, colloidal gold, or the like.
For example, when an immunochromatographic test based on colored latex microspheres is performed, an immunochromatographic rapid test card can be assembled in a conventional manner using latex microspheres labeled with an anti-RSV antibody of the present invention, a nitrocellulose membrane (NC membrane) coated with another anti-RSV antibody, a sample pad, absorbent paper, a polyester plate, or the like. During detection, the substance to be detected in the positive sample is combined with the latex microspheres marked with the anti-RSV antibody, and agglutination reaction occurs at room temperature, so that after the positive sample is placed for a period of time, the result can be observed and determined through naked eyes.
For another example, when a colloidal gold immunochromatographic test is performed, an anti-RSV antibody may be labeled with colloidal gold, a nitrocellulose membrane (NC membrane) may be coated with another anti-RSV antibody, and a test line (T line) may be obtained by scribing. And assembling according to the preparation method of the immune test strip to obtain the colloidal gold test strip. During detection, an object to be detected in a positive sample is combined with the colloidal gold-labeled anti-RSV antibody to form a compound, the compound is combined with the coating antibody at the T line to form a sandwich compound, and the colloidal gold is aggregated and precipitated to show red, so that the sample is indicated to be positive.
For another example, when performing immunochromatography test using fluorescent microspheres, an immunochromatography rapid test card can be assembled by labeling time-resolved fluorescent microspheres with the monoclonal anti-RSV antibody of the present invention, coating a nitrocellulose membrane (NC membrane) with another anti-RSV antibody, and using a sample pad or the like. When the detection is carried out, an object to be detected in a sample is combined with a fluorescent microsphere labeled antibody in a combination pad and is subjected to forward chromatography through capillary action, and after the object reaches a detection area, the object is further combined with another anti-RSV antibody fixed on a T line of a detection line to form a sandwich type of double-antibody sandwich. And after the chromatography is finished, reading the fluorescence intensity of the T line and the C line by using an immunofluorometer, calculating a T/C value, and calculating the content of the object to be detected in the sample by using a standard curve built in the immunofluorometer.
Thus, in a specific embodiment, another monoclonal anti-RSV antibody is also used in the assay, and the monoclonal anti-RSV antibody is used as one of the coating antibody and the labeled antibody, and the other monoclonal anti-RSV antibody is used as the other of the coating antibody and the labeled antibody.
It is noteworthy that, in the context of the present invention, "another monoclonalThe anti-RSV antibody "refers to an antibody that binds to the same antigen, preferably to a different epitope of the same antigen, as the monoclonal anti-RSV antibody of the invention, and may or may not be the monoclonal anti-RSV antibody of the invention. For example, in an assay, when antibody RSV101 is selected as the labeled antibody, RSV101 may still be selected as the coating antibody, but it is preferred to select another different monoclonal anti-RSV antibody as the coating antibody, e.g., RSV102 may be selected as the coating antibody, or another monoclonal anti-RSV antibody may be selected as the coating antibody, e.g., comprising a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3 and light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10 to 12, respectively L CDR1、V L CDR2 and V L Monoclonal anti-RSV antibodies to CDR3, such as RSV200, or comprising a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS 13-15, respectively H CDR1、V H CDR2 and V H CDR3 and light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L Monoclonal anti-RSV antibodies to CDR3, e.g., RSV300.
Thus, in a preferred embodiment, the further monoclonal anti-RSV antibody may be a monoclonal anti-RSV antibody according to the first aspect of the invention, e.g. RSV101 or RSV102, or may be a monoclonal antibody other than a monoclonal anti-RSV antibody according to the invention.
In a further preferred embodiment, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L And (3) CDR3. In a more preferred embodiment, the following steps are carried outIn the another monoclonal anti-RSV antibody, the heavy chain variable region comprises SEQ ID NO:21 or an amino acid sequence corresponding to SEQ ID NO:21, and the light chain variable region comprises a sequence with more than 80%, more than 85%, more than 90%, or more than 95% identity to the amino acid sequence shown in SEQ ID NO:22 or an amino acid sequence corresponding to SEQ ID NO:22 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more. As a specific example, the monoclonal anti-RSV antibody can be RSV200.
In yet another preferred embodiment, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L And (3) CDR3. In a more preferred embodiment, for the alternative monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more. As a specific example, the monoclonal anti-RSV antibody can be RSV300.
Therefore, in the detection method of the present invention, the labeled antibody and the coating antibody may be the same. That is, when the monoclonal anti-RSV antibody of the present invention is used for immunochromatography for detection of RSV virus, it is used as a labeled antibody for labeling magnetic beads, microspheres, enzymes, fluorochromes, biotin, colloidal gold, etc., and at the same time, it is also used as a coating antibody for coating a solid support such as magnetic beads, latex microspheres, fluorescent microspheres, microtiter plates, nitrocellulose membranes, microfluidic chips, etc.
In a preferred embodiment, in the detection method of the present invention, the labeled antibody is different from the coating antibody.
In a more preferred embodiment, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L And (3) CDR3. In a more preferred embodiment, for the alternative monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more. As a specific example, the monoclonal anti-RSV antibody can be RSV300.
In a sixth aspect, the invention provides use of a monoclonal anti-RSV antibody of the first aspect in the manufacture of a reagent for detecting Respiratory Syncytial Virus (RSV).
In a specific embodiment, the detection is performed by immunochromatography, enzyme-linked antibody assay (ELISA), chemiluminescence, electrochemiluminescence.
In yet another preferred embodiment, the ELISA may be a direct method, an indirect method, a sandwich method and a competition method.
In a preferred embodiment, the immunochromatography includes, but is not limited to, fluorescent microsphere immunochromatography, colloidal gold immunochromatography, immunochromatography based on colored latex microspheres, time-resolved fluorescent microsphere immunochromatography, magnetic microsphere immunochromatography, and quantum dot immunochromatography.
As described above, the monoclonal anti-RSV antibody can be used as a coating antibody in detection. For example, monoclonal anti-RSV antibodies are bound to a solid phase, such as a solid support. The solid support used in the detection method of the present invention is not particularly limited, and may be a porous or nonporous material, such as magnetic beads, latex microspheres, fluorescent microspheres, microtiter plates, nitrocellulose membranes, microfluidic chips, and the like.
Similarly, the monoclonal anti-RSV antibody can be used as a labeled antibody. For example, the monoclonal anti-RSV antibody is bound to magnetic beads, microspheres, enzymes, fluorescent dyes, biotin, streptavidin, quantum dots, colloidal gold, or the like.
In a specific embodiment, another monoclonal anti-RSV antibody may also be used in the use, and the monoclonal anti-RSV antibody is used as one of the coating antibody and the labeled antibody, and the other monoclonal anti-RSV antibody is used as the other of the coating antibody and the labeled antibody.
As described above, the "another monoclonal anti-RSV antibody" refers to an antibody capable of binding to the same antigen, preferably to a different epitope of the same antigen, as the monoclonal anti-RSV antibody of the invention, and may or may not be the monoclonal anti-RSV antibody of the invention. For example, in this use, when antibody RSV101 is selected as the labeled antibody, RSV101 may still be selected as the coating antibody, but preferably another different monoclonal anti-RSV antibody is selected as the coating antibody, e.g., RSV102 may be selected as the coating antibody, or another anti-RSV monoclonal antibody is selected as the coating antibody, e.g., antibody RSV200 or RSV300 as described previously.
In a preferred embodiment, the other monoclonal anti-RSV antibody is different from the monoclonal anti-RSV antibody of the invention.
In a preferred embodiment, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L And (3) CDR3. In a more preferred embodiment, for the other monoclonal anti-RSV antibody, the heavy chain variable region comprises SEQ ID NO:21 or an amino acid sequence substantially identical to SEQ ID NO:21, and the light chain variable region comprises a sequence with more than 80%, more than 85%, more than 90%, or more than 95% identity to the amino acid sequence shown in SEQ ID NO:22 or an amino acid sequence substantially identical to SEQ ID NO:22 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more. As a specific example, the monoclonal anti-RSV antibody can be RSV200.
In yet another preferred embodiment, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L And (3) CDR3. In a more preferred embodiment, for the alternative monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO. 23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more. As a specific example, the monoclonal anti-RSV antibody can be RSV300.
The inventors have discovered that when a monoclonal anti-RSV antibody of the invention, such as RSV101 or RSV102, is conjugated to a heavy chain complementarity determining region V comprising amino acid sequences set forth in SEQ ID NOS 13-15, respectively H CDR1、V H CDR2 andV H CDR3 and light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L Monoclonal anti-RSV antibodies to CDR3, such as RSV300, when used in combination, either as labeled or coated antibodies, exhibit significantly greater sensitivity for use in immunochromatographic reactions, such as color latex microsphere-based and colloidal gold-based immunochromatographic reactions.
In a seventh aspect, the present invention provides a monoclonal anti-RSV antibody combination for immunodetection, comprising a first monoclonal anti-RSV antibody as a marker antibody and a second monoclonal anti-RSV antibody as a coating antibody, wherein the first monoclonal anti-RSV antibody and the second monoclonal anti-RSV antibody may be specifically as follows:
as a first antibody combination, the first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody of the first aspect of the invention, e.g., RSV101 or RSV102, and the second monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3。
In a preferred embodiment, for the second monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO. 23 or an amino acid sequence substantially identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
As a second antibody combination, the first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain variable region having a variable region defined by SEQ IDsHeavy chain complementarity determining region V of amino acid sequences shown in NO 13-15 H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3, the second monoclonal anti-RSV antibody being a monoclonal anti-RSV antibody of the first aspect of the invention, e.g., RSV101 or RSV102.
In a preferred embodiment, for the first monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
As a third antibody combination, the first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3, the second monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody according to the first aspect of the invention, e.g., RSV101 or RSV102.
In a preferred embodiment, the first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3, e.g. RSV200, said second monoclonalThe anti-RSV antibody is of the first aspect of the invention wherein V L Monoclonal anti-RSV antibodies with CDR3 of QQYSNFPFT, such as RSV102.
In a preferred embodiment, for the first monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID No. 21 or a sequence identical to SEQ ID NO:21, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:22 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:22 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
In an eighth aspect, the invention provides a kit for detecting Respiratory Syncytial Virus (RSV), the kit comprising the monoclonal anti-RSV antibody of the first aspect and instructions for directing how to detect Respiratory Syncytial Virus (RSV).
In a preferred embodiment, the kit may further comprise: another monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein:
the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3；
The heavy chain variable region comprises a heavy chain variable region V having amino acid sequences represented by SEQ ID NOS 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3。
In a preferred embodiment, for the alternative monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:21 or a sequence identical to SEQ ID NO:21, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:22 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:22 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
As a specific example, the monoclonal RSV antibody can be RSV200.
In a preferred embodiment, for the alternative monoclonal anti-RSV antibody, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
As a specific example, the monoclonal anti-RSV antibody can be RSV300.
The kit of the present invention can be used for point-of-care testing (POCT) or electrochemical immunoassay systems. The kits according to the invention and any exemplary form thereof may be used and optimized in automated and semi-automated systems.
Examples
In the following examples, the methods of preparation of the antibodies of the invention and characterization of relevant properties are shown. Unless otherwise specified, the test methods employed therein were all conventional methods, and the test materials used in the following examples were all purchased from a conventional reagent store. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
It should be noted that the terminology used in the description of the invention herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention. The foregoing summary of the invention, as well as the following detailed description, is intended to be illustrative of the invention only and is not intended to be in any way limiting. The scope of the invention is to be determined by the appended claims without departing from the spirit and scope of the invention.
Example 1: preparation of monoclonal antibody against RSV F protein
Antigen coupling and immunization: the purified RSV F protein (SEQ ID NO: 27) was used as an immunogen to immunize mice. The mice are selected from female BALB/c mice with the age of 6-8 weeks. Mice were immunized 4 times in total, each time at 2 weeks intervals, at an immunization dose of 100. Mu.g/mouse. First immunization RSV F protein was mixed in equal volumes with Freund's complete adjuvant (Sigma-Aldrich) by dorsal subcutaneous multiple injection, and RSV F protein was mixed in equal volumes with Freund's incomplete adjuvant (Sigma-Aldrich) by postimmunization. And 7 days after the fourth immunization, blood is collected after the tail of the mouse is cut off, serum is separated, and the antibody titer level of antiserum of the immunized mouse is detected by adopting an indirect ELISA method so as to observe the immune response effect. Selecting a serum antibody titer higher than 1:10000 mice were subjected to cell fusion experiments, which were boosted 3 days before the cell fusion experiments by intraperitoneal injection with the unadjuvanted RSV F protein (100 μ g/mouse).
Establishment of hybridoma cells: on the day of fusion, spleens from immunized mice were removed under sterile conditions and the organs were made into single cell suspensions. Mouse myeloma cells (SP 2/0) were taken and immunized BALB/c mouse splenocytes were mixed as described in 1:5, mixed well and washed twice before being fused with PEG. Add pre-warmed PEG1500, gently shake, wash cells with pre-warmed serum-free RPMI-1640 medium, and resuspend cells in HAT selective medium. Plating the cell suspension into 96-well culture plates at 200. Mu.L/well, and at 37 ℃ 5% CO 2 Culturing the cells under conditions. After 4 to 7 days of culture, the cells were cultured in HT medium, and when the fused cells grew to 1/10-1/5 of the bottom area of the wells of the 96-well plate, the supernatant was subjected to antibody detection.
Screening of positive hybridoma cells: RSV F protein was taken, diluted with coating buffer (0.05 mol/L, pH9.6, PBS) to a final concentration of 1. Mu.g/ml, added to a 96-well plate at 100. Mu.L/well and coated overnight at 4 ℃; discarding the coating solution, washing with Phosphate Buffer Solution (PBST) for 3 times, and patting to dry; blocking with PBST containing 2% BSA, 150. Mu.L/well, incubating at 37 ℃ for 2h, washing 3 times with PBST, patting dry; fusion cell supernatants, 1:1000 dilutions of mouse negative serum (as negative control) were added to the corresponding wells at 100. Mu.L/well, incubated for 1h at 37 ℃, washed 3 times with PBST, patted dry; adding 1: goat anti-mouse IgG labeled with horseradish peroxidase (HRP) at a dilution of 4000 (purchased from Sigma), 100. Mu.L/well, incubated at 37 ℃ for 1h, washed 3 times with PBST, patted dry; adding tetramethyl benzidine (3, 3', 5' -Tetramethylbenzidine, TMB) substrate, 100 μ L/hole, and developing in dark at room temperature for 10min; the reaction was stopped by adding 50. Mu.L of 2mol/L sulfuric acid per well.
Detecting the OD of all holes in the microplate at the wavelength of 450nm of the microplate reader 450nm The value is obtained. OD of negative serum 450nm Less than or equal to 0.1, to determine the absorbance OD of the wells (RSV F protein) 450nm The value is the negative well OD 450nm Positive at least 2.1 times of the total amount of the composition was determined as a criterion. Positive hybridoma cells were selected for further cloning.
Cloning of positive cell lines: sampling and counting antibody-secreting positive cell wells, diluting to 100 cells/10 mL of culture medium, plating the diluted cell suspension at 100. Mu.L/well to a 96 well cell culture plate, setting at 37 ℃ and 5% CO 2 Culturing in a cell culture box. After 6-7 days, the formation of clonal cells was observed under a microscope, individual clonal growth wells were marked, and cell supernatants were removed and tested by ELISA (the same fusion assay as described above) to select positive monoclonal cells. Limiting dilution is carried out on positive hole cells, ELISA values are measured 5-6 days after each limiting dilution, and OD obtained through ELISA detection is selected 450nm And (4) carrying out limited dilution on the monoclonal wells with higher positive values until the whole plate result of the 96-well plate is positive by ELISA (enzyme-Linked immunosorbent assay). And (4) selecting a monoclonal fixed strain with a high positive value. Finally, three cell strains which stably secrete the anti-RSV antibody are obtained and named as hybridoma cell strains F2H11, B8H12 and C5B7 respectively.
Hybridoma F2H11 is deposited in China general microbiological culture Collection center (CGMCC) of microbiological research institute of China academy of sciences No. 3, west Lu 1, beijing, the rising area, 7 months and 14 days in 2022, with the preservation number of CGMCC No.45238.
Hybridoma B8H12 is deposited in China general microbiological culture Collection center (CGMCC) of microbiological research institute of China academy of sciences No. 3, west Lu 1, beijing, the rising area, 7 months and 14 days in 2022, with the preservation number of CGMCC No.45239.
The hybridoma cell C5B7 is preserved in China general microbiological culture Collection center (CGMCC) of the institute of microbiology of China academy of sciences No. 3, west Lu 1, beijing, the rising area, 7 months and 14 days in 2022, with the preservation number of CGMCC No.45240.
Preparing and purifying cell supernatant monoclonal antibody: the three cell lines were cultured in RPMI-1640 medium containing 15% serum on a 10cm dish, and expanded to about 4X 10 7 At one/dish, centrifuge at 800rpm for 5min, discard the supernatant and transfer the cells to a 2L spinner flask and add serum-free medium to achieve a cell density of about 3X 10 5 And (4) culturing each cell per ml in a spinner flask. After further culturing for 1-2 weeks, when the cell death rate reaches 80% -90% (at this time, the cell density is about 1X 10 6 -2×10 6 Pieces/ml), collecting cell suspension, centrifuging at 6000rpm for 20min, collecting supernatant, and purifying the supernatant by Protein A immunochromatography.
A monoclonal antibody prepared from F2H11 hybridoma cells was designated RSV101; the monoclonal antibody produced by the B8H12 hybridoma cells was designated RSV200; the monoclonal antibody produced by the C5B7 hybridoma cells was designated RSV300.
The concentrations of RSV101, RSV200 and RSV300 monoclonal antibodies were approximately 2-4mg/mL as determined by microspectrophotometry. The purified monoclonal antibody was assayed for concentration and dispensed (100. Mu.L/tube, 1 mg/ml) and stored at 4 ℃ to 8 ℃.
Three antibodies (5. Mu.g per well) were identified by SDS-PAGE electrophoresis and the results are shown in FIG. 1. As can be seen from the figure, all three antibodies exhibited an antibody heavy chain band of about 51kD and an antibody light chain band of about 26 kD.
And (3) purity detection: analyzing the three monoclonal antibodies by using size exclusion chromatography (SEC-HPLC), and calculating the purity percentage of the main peak by using a peak area normalization method under the condition of ensuring that all components in a sample to be detected have peaks, wherein the purity reaches more than 98 percent.
Example 2: binding ability of antibody to RSV F protein
RSV F protein was diluted to a concentration of 1. Mu.g/ml with 0.05mol/L carbonate buffer pH9.6, added to a 96-well microplate at 100. Mu.L/well, coated overnight at 4 ℃, washed 3 times with PBST on an automatic plate washer, and patted dry. Blocking with PBST containing 2% BSA, 150. Mu.L/well, incubating at 37 ℃ for 2h, washing 3 times with PBST, and patting dry. The antibodies of the anti-RSV F protein monoclonal antibodies RSV101, RSV200 and RSV300 are subjected to gradient dilution by PBS buffer solution with pH7.4 and 0.02M, the initial concentration of the antibody is 1.5ug/ml, and the gradient dilution is sequentially carried out according to three times to obtain a series of monoclonal antibody samples with different concentrations. The diluted monoclonal antibody sample is added to the enzyme label plate at a rate of 100 mu L/well, incubated at 37 ℃ for 1h, washed 3 times and patted dry. Adding 1: horse Radish Peroxidase (HRP) -labeled goat anti-mouse IgG (purchased from sigma) at a dilution of 4000, 100. Mu.L/well, incubated at 37 ℃ for 1h, washed 3 times with PBST, and patted dry. TMB substrate was added at 100. Mu.L/well and developed in the dark at room temperature for 10min. The reaction was terminated by adding 2mol/L sulfuric acid at 50. Mu.L/well. OD determination by enzyme-linked immunosorbent assay 450nm The results of the ELISA described above were analyzed by software to obtain EC50 values of the RSV101, 200 and 300 antibodies, and the results are shown in fig. 2.
As can be seen from FIG. 2, the EC50 values for the binding of RSV101, 200, 300 antibodies to RSV-F (strain A) were 8.514ng/ml, 6.459ng/ml, and 6.035ng/ml, respectively.
Example 3: cloning and sequencing of anti-RSV antibody variable region sequences
Total RNA was isolated from the above three hybridoma cell lines, cDNA was prepared by reverse transcription to clone an immunoglobulin sequence from the hybridoma cell line, and the variable region sequence of the antibody of the hybridoma cell line was determined by the following procedure.
Extraction of RNA: total RNA extraction and immediate reverse transcription were performed on the hybridoma cell lines described above with reference to the instructions of the Total RNA M5 extraction kit (from Peking Polymermai Biotech Co., ltd.).
Reverse transcription of RNA into cDNA: the total RNA extracted in the previous step was reverse transcribed with reference to M5 First Strand cDNA Synthesis Kit, inc. (purchased from Bio-technologies, inc., beijing, inc.), to obtain cDNA, which was frozen at-20 ℃ for use.
c. And (3) PCR amplification and recovery of variable region sequences: the cDNA obtained in the above step is used as a template, and a universal heavy chain primer Mu Ig V is used H 5' -A and Mu IgG V H 3' -2, amplification of immunoglobulin heavy chain (IgH) cDNA by PCR; similarly, the light chain primer Mu Ig kappa V was used L 5' -A and Mu Ig kappa V L 3' -1, amplifying immunoglobulin light chain (IgK) cDNA by PCR, and recovering PCR products; the PCR reaction was carried out using thermostable PfuDNA polymerase throughout.
d. Cloning and sequencing of variable region sequences: according to the instructions of the Cloning vector pTOPO-Blunt Cloning kit (available from Beijing Convergence technologies, inc.), the heavy chain and light chain variable region genes were ligated to pTOPO vector, respectively, to transform E.coli DH 5. Alpha. And positive clones were picked up and subjected to sequencing by Beijing Rui Boxing, biotech, inc.
The sequences of the heavy chain variable region gene and the light chain variable region gene of the antibody of the hybridoma cell strain obtained by sequencing are analyzed, and the sequences of the complementarity determining regions of the heavy chain and the complementarity determining regions of the light chain are shown in the following table 1.
Table 1: complementarity determining region sequences of the heavy and light chains of antibodies RSV101, RSV200 and RSV300 (according to the Chothia numbering system)
In addition, the sequences of the heavy and light chain variable regions of each anti-RSV antibody were sequenced as follows:
the heavy chain variable region sequence of the antibody RSV101 is shown as SEQ ID NO. 19, and the light chain variable region sequence is shown as SEQ ID NO. 20; the heavy chain variable region sequence of the antibody RSV200 is shown as SEQ ID NO:21, and the light chain variable region sequence is shown as SEQ ID NO: 22; the heavy chain variable region sequence of antibody RSV300 is shown in SEQ ID NO:23 and the light chain variable region sequence is shown in SEQ ID NO: 24.
Example 4: preparation and purification of recombinant antibodies
Constructing recombinant antibody, preparing cell strain for stably expressing anti-blocking agent antibody through eukaryotic expression, and carrying out large-scale culture and purification on the cell strain.
Amplifying the mouse monoclonal antibody heavy and light chain variable region gene (V) by adopting a PCR method and taking cDNA obtained by reverse transcription as a template H And V L ) And sequencing to determine the sequence. V for antibody L And V H Gene, and the plasmid pCDNA3.1 is used in constructing recombinant antibody eukaryotic expression vector by means of molecular cloning. The heavy chain and light chain gene expression plasmids of the antibody are electrically transduced into CHO host cells, after the electric transduction, the CHO host cells are added into a pressure screening culture medium (50 mu M MSX) to be cultured for 20 days, and then the supernatant is taken to be subjected to ELISA detection (horse radish peroxidase (HRP) marked goat anti-mouse IgG is used as a secondary antibody for screening, the method is the same as the above), and the stably expressed recombinant antibody cell strains are screened.
In addition, the light chain CDR3 of RSV101 was mutated to QQYSNFPCT and the remaining sequences were left unchanged, and a recombinant antibody eukaryotic expression vector (again using plasmid pCDNA3.1) was constructed in the same manner. The heavy chain and light chain gene expression plasmids of the antibody are electrically transduced into CHO host cells, and recombinant antibody cell strains with stable expression are screened out, the obtained recombinant antibody is marked as RSV102, and CDRs of the recombinant antibody are shown in the following table 2:
table 2: CDRs of the heavy and light chains of antibody RSV102 (according to the Chothia numbering system)
And (3) carrying out large-scale cell culture on the screened stable transgenic cell strain by adopting a cell roller bottle culture technology, and preparing a recombinant antibody. Cells were plated at (0.2-0.3). Times.10 in culture medium (Vega CHO) 6 cells/ml are inoculated in a roller bottle, a 1L roller bottle contains 300ml of culture medium (Vega CHO), the number of the roller bottles is determined according to production requirements, and the roller bottles inoculated with cells are put into a cell bottle rotating machine to be cultured in a cell incubator. The culture conditions were 900 rpm/h, the temperature was 37 ℃ and carbon dioxide was 5%. And (4) after culturing for 7-9 days, sampling under a microscope, observing, and centrifuging to collect samples when the cell viability is less than 50%. And (3) performing affinity purification on the sample by using a protein A affinity chromatography column to obtain an antibody, namely the recombinant monoclonal antibody.
The binding ability of the recombinant antibody RSV102 to the RSV F protein was tested according to the method described in example 2 and the results are shown in FIG. 3. It can be seen that the EC50 value for RSV102 antibody binding to RSV-F (strain A) is 7.9ng/ml.
Example 5: immunochromatography test based on colored latex microspheres
The monoclonal anti-RSV antibody of the invention is evaluated by an immunochromatography method based on colored latex microspheres.
The recombinant antibody labeled latex microsphere comprises the following steps:
1. cleaning microspheres: adding a certain amount of 0.1M 4-morpholine ethanesulfonic acid (MES) buffer solution with pH of 6.0 into 1mg microsphere, mixing, centrifuging at 20000rpm for 20min, and removing supernatant;
2. and (3) activation: adding certain volume of MES buffer solution with pH of 6.0, ultrasonically mixing, adding 12 μ g of 1-ethyl- (3-dimethylaminopropyl) carbodiimide (EDC) and 12 μ g of N-hydroxysuccinimide (NHS), reacting at 37 ℃ for 15min, mixing uniformly every 5min, centrifuging at 20000rpm,20min, and discarding the supernatant;
3. coupling: adding a certain volume of 50mM boric acid buffer solution with pH =8.0, ultrasonically mixing, adding 0.2mg of the anti-RSV F monoclonal antibody a listed in the following table 3, and mixing and reacting at 37 ℃ overnight;
4. and (3) sealing: blocking was performed for 1h by adding 1ml BSA (5%), followed by centrifugation at 20000rpm for 20min and discarding the supernatant.
5. Cleaning: washing with 0.1M Tris-HCl (pH8.5) for 2 times, centrifuging at 20000rpm for 20min, and removing supernatant;
6. and (3) storage: adding 25mM MES (pH = 7.4) 0.5ml for storage, 1% BSA,0.1% Tween20 diluted 50-fold, and freeze-dried and sealed for use.
Recombinant antibody-coated nitrocellulose membrane (NC membrane): anti-RSV monoclonal antibody b (listed in Table 3 below) was coated on NC membranes of Sidoris 140 as a test line (T line) diluted to a final concentration of 1.0mg/ml with 10mM pH 7.4PBS and 2% sucrose, and sealed overnight at 37 ℃ for use.
Preparing a sample pad: the sample pad was treated with 10mM PBS, pH7.4, and lyophilized for use.
Assembling an immunochromatography system: and assembling the red latex microspheres marked with the antibodies, the NC membrane coated with the antibodies, the sample pad, the absorbent paper and the polyester plate into the immunochromatography rapid test card in a conventional manner.
Table 3: anti-RSV monoclonal antibodies a and b used in this example
And (3) immune test: samples of virus cultures and samples containing different concentrations (1 ng/ml, 10ng/ml and 100 ng/ml) of recombinant antigen were tested at different dilutions (1. Specifically, 80 μ l of a sample to be tested is dropped into the rapid test card, and after the rapid test card is placed at room temperature for 15 minutes, the result is visually observed and judged. The antigen-antibody binding activity in the sample is indicated by the light and dark color of the developed bands, and the results are shown in Table 4, using the manufacturer A RSV latex chromatographic reagent as a control. And comparing the color of the developed T line with a standard color card, selecting the closest color, and marking the activity of the product by the grade number of the color number corresponding to the color. As shown in FIG. 4, the color chart is divided into nine grades C1-C9, wherein C1 is strong positive and represents the highest unit activity, the middle gradient is decreased, and C9 is weakest positive and represents the lowest unit activity. In the figure, B represents a blank.
Table 4: immunochromatography reaction result based on colored latex microspheres
The result shows that when the antibody is used in immunochromatography detection based on the colored latex microspheres, the sensitivity of the antibody is one to two grades higher than that of similar products of a manufacturer A no matter against virus culture or against recombinant antigen when different labeled antibodies and coating antibodies are adopted, and the test sensitivity can reach nanogram grade. Among them, antibody combinations 4, 10, 13 and 14 showed the highest sensitivity.
Example 6: colloidal gold immunochromatographic assay
Preparing colloidal gold: 200ml of ultrapure water was added to a Erlenmeyer flask, the flask was heated to boiling, and then 1ml of a 2% chloroauric acid (Sigma-Aldrich Co., ltd., product No. 16961-25-4) solution was added thereto, and immediately after boiling, 1ml of a 2% trisodium citrate (Sigma-Aldrich Co., product No. 6132-04-3) aqueous solution was added thereto, followed by boiling under stirring for 10 minutes, followed by natural cooling.
Labeling the colloidal gold conjugate: 10ml of the above colloidal gold was put into a beaker, and 120. Mu.l of 0.2M K was added while stirring 2 CO 3 Adjusting the pH value to 7.0, and continuing stirring for 10 seconds; 100 μ g of anti-RSV monoclonal antibody a (labeled antibody) as listed in Table 3 above was added and stirring was continued for 5 minutes; adding 0.1ml 10% BSA, and stirring for 5 minutes; the precipitate was centrifuged at 12000g for 10 minutes, the supernatant was discarded, and the precipitate was diluted to 1ml with a colloidal gold diluent (10mM PB,150mM NaCl,0.2% BSA,0.1% TritonX-100,3% Sucross, 0.01% Proclin 300) as an anti-RSV monoclonal antibody colloidal gold complex.
Preparing a colloidal gold pad: and (3) diluting the colloidal gold compound by 10 times of a colloidal gold diluent, soaking glass fiber (Shanghai gold mark company) in the diluted colloidal gold compound, and freeze-drying to obtain the gold mark pad.
Nitrocellulose membrane (NC membrane) coating: the anti-RSV monoclonal antibody b (coating antibody) as listed in the above Table 3 was diluted to 1.5mg/ml, and a test line working solution was prepared, streaked by a dot film machine onto a corresponding position of a nitrocellulose membrane (Millipore Co., ltd., cat. No.: HF 135002), and dried at 50 ℃ for 1 hour for use.
Assembling the colloidal gold immunochromatographic test reagent strip: and assembling the gold-labeled pad, the nitrocellulose membrane coated with the antibody, absorbent paper, a polyester plate and the sample padding into the colloidal gold immunoassay reagent strip.
And (3) sensitivity detection: samples of virus cultures at different dilutions and recombinant antigens at different concentrations were tested separately. Specifically, 80 mul of sample to be measured is dripped to the sample pad, and the sample pad is placed at room temperature for 15-30 minutes, and the result is judged. The activity of the antigen in the sample to bind to the antibody can be indicated by the shade of the color of the band. The color of the T-line strip of the colloidal gold test paper reaction coloration is compared with a standard color card, the closest color is selected, the grade number of the color number corresponding to the color is used for marking the activity of the product, and the result is shown in the following table 5, and the RSV colloidal gold chromatography reagent of manufacturer A is used as a contrast. The results show that the antibody combinations of the invention exhibit comparable sensitivity, or one to two orders of magnitude higher sensitivity, than the manufacturer a RSV colloidal gold chromatography reagent, when different labeled and coated antibodies are used in the invention. Of these, antibody combinations 4, 10 and 13 showed the highest sensitivity.
Table 5: colloidal gold-based immunochromatographic reaction results (recombinant antigen unit ng/ml)
And (3) specific detection: with the RSV colloidal gold chromatography reagent of manufacturer A as a control, 30 nasopharyngeal swab samples of healthy people were tested using the reagent strips prepared with the four antibodies of the invention. The results show that, like the reagent of manufacturer A, the reagent strips prepared by the four antibodies of the invention have no false positive results, and the specificity is 100%.
Example 7: fluorescent microsphere immunochromatographic assay
Respectively coating an NC membrane (coated antibody) and a time-resolved fluorescent microsphere (labeled antibody) with the antibody to prepare a chromatography product, comprising the following steps of:
1. labeling time-resolved fluorescent microspheres: adding a certain amount of 0.1M MES buffer solution with pH 6.5 into 1mg microsphere, mixing uniformly, centrifuging at 20000rpm for 20min, and removing supernatant; adding MES buffer solution with a certain volume, pH 6.5, ultrasonically mixing, adding 20 μ g EDC and 40 μ g NHS, reacting at room temperature for 30min, mixing once every 5min, centrifuging at 20000rpm,20min, and discarding supernatant; adding a certain volume of 50mM boric acid buffer solution with pH =8.0, ultrasonically mixing, adding 0.05-0.1mg of the anti-RSV monoclonal antibody a listed in the above table 3, and mixing and reacting at room temperature for 2 hours; adding 1% BSA to 1mL of 100mM Tris-HCl pH8.5 and blocking for 2 hours, centrifuging at 20000rpm for 20min, and discarding the supernatant; washing with 0.1M Tris-HCl (pH8.5) for 2 times, centrifuging at 20000rpm for 20min, and removing supernatant; and (3) storage: adding 25mM MES (pH = 7.4) 0.5ml for storage, 1% BSA,0.1% Tween20 diluted 50-fold, and freeze-dried and sealed for use.
2. Coating an NC film: the anti-RSV monoclonal antibody b listed in the above Table 3 was diluted with 10mM pH7.4 PBS,2% sucrose to a final concentration of 1.0mg/ml, coated on NC membrane of Celtolite 140, and sealed overnight at 37 ℃ for use.
3. Sample pad preparation: the sample pad was treated with 1 mM PBS, pH7.4, and lyophilized for use.
4. Assembling and testing: and assembling the time-resolved fluorescent microspheres marked with the antibodies, the NC membrane coated with the antibodies and the sample pad into an immunochromatography rapid test card, adding 80 mul of random clinical samples, standing at room temperature for 15 minutes, and detecting by using an immunofluorometer.
Sensitivity of antibody to F protein recombinant antigen:
first, the detection of the F protein recombinant antigen at different concentrations (0.1-500 ng/ml) by the antibody combinations 4 and 10 was examined, and the results are shown in the following Table 6 and FIG. 5. As shown in the following Table 6, the detection results of the antibody combination 4 on the F protein recombinant antigen show that when the antigen concentration is 0.1ng/ml, the T/C value is more than twice of the T/C value (0.52) of a detection group without the F protein, and by taking the T/C value as the standard, the sensitivity of the recombinant antibody on the F protein recombinant antigen can reach 0.1ng/ml in a fluorescent microsphere immunochromatographic system. The same detection is carried out by taking the RSV N protein recombinant antigen as a negative control, and the T/C value is not obviously changed along with the increase of the N protein concentration.
Table 6: sensitivity results of antibody combination 4 to F protein recombinant antigen
Next, the results of detection of the F protein recombinant antigen at different concentrations by the antibody combinations 2, 4,8, 10, and 15 of the present example and the RSV latex chromatographic reagent of manufacturer a were compared, and are shown in table 7. Compared with the RSV latex chromatographic reagent of manufacturer A, the antibody of the invention can detect the F protein recombinant antigen with the concentration of 0.1ng/ml in the fluorescence chromatographic reagent, and the latex reagent of manufacturer A has a negative detection result of the concentration, which shows that the monoclonal antibody of the invention has high sensitivity.
Table 7: sensitivity results of antibodies to viral cultures and F protein recombinant antigens
Sensitivity of antibodies to virus culture: antibody pair dilutions were tested at 1:100 to 1: sensitivity of virus cultures in the range 20000, the results are shown in Table 8. In contrast to the RSV latex chromatographic reagent from manufacturer A, the antibody of the invention was compared to the antibody of the present invention in a fluorescent chromatographic reagent to detect a viral culture 1:20000, and in the 1: at 20000 dilution, the latex reagent of manufacturer A showed negative results, indicating that the monoclonal antibody of the invention has higher sensitivity.
Table 8: results of sensitivity of the antibodies of the invention to viral cultures
Sequence listing
SEQ ID NO:1(V H CDR1)：GYSITSDY
SEQ ID NO:2(V H CDR2)：SYIGS
SEQ ID NO:3(V H CDR3)：TIRNYFDY
SEQ ID NO:4(V L CDR1)：SASQGISNYLN
SEQ ID NO:5(V L CDR2)：DTSSLHS
SEQ ID NO:6(V L CDR 3): QQYSNFPXT (wherein X is C or F)
SEQ ID NO:7(V H CDR1)：GFNIKDY
SEQ ID NO:8(V H CDR2)：DPENGN
SEQ ID NO:9(V H CDR3)：YGTSYWFPY
SEQ ID NO:10(V L CDR1)：KASQDINSYLS
SEQ ID NO:11(V L CDR2)：RANRLVD
SEQ ID NO:12(V L CDR3)：LQFDEFPYT
SEQ ID NO:13(V H CDR1)：GYTFSSN
SEQ ID NO:14(V H CDR2)：LPGSGS
SEQ ID NO:15(V H CDR3)：EELGYFDY
SEQ ID NO:16(V L CDR1)：RASQDINNYLN
SEQ ID NO:17(V L CDR2)：YTSRLHS
SEQ ID NO:18(V L CDR3)：QQGSTLPPT
SEQ ID NO:19(V H )：EVQLQQPGAELVKPGGSVKLSCKASGYSITSDYWVKQRPGRQLEWIGSYIGSKISLTVDKPSSTAYMQLSSLTSEDSAVYYCARTIRNYFDYWGQGTTVTVSS
SEQ ID NO:20(V L )：DIVMTQTHKFMSTSVGDRVSLTCSASQGISNYLNWYQEKPGQSPKLLIYSDTSSLHSGVPARFTGTQSGTDFTFTISSVQAEDEALYFCQQYSNFPCTFGAGTKLELK
SEQ ID NO:21(V H )：EVQLQQPGAELVKPGGSVKLSCKASGFNIKDYWVKQRPGRQLEWIGDPENGNKISLTVDKPSSTAYMQLSSLTSEDSAVYYCARYGTSYWFPYWGQGTTVTVSS
SEQ ID NO:22(V L )：DIVMTQTHKFMSTSVGDRVSLTCKASQDINSYLSWYQEKPGQSPKLLIYSRANRLVDGVPARFTGTQSGTDFTFTISSVQAEDEALYFCLQFDEFPYTFGAGTKLELK
SEQ ID NO:23(V H )：EVQLQQPGAELVKPGGSVKLSCKASGYTFSSNWVKQRPGRQLEWIGLPGSGSKISLTVDKPSSTAYMQLSSLTSEDSAVYYCAREELGYFDYWGQGTTVTVSS
SEQ ID NO:24(V L )：DIVMTQTHKFMSTSVGDRVSLTCRASQDINNYLNWYQEKPGQSPKLLIYSYTSRLHSGVPARFTGTQSGTDFTFTISSVQAEDEALYFCQQGSTLPPTFGAGTKLELK
SEQ ID NO:25(C)：AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
SEQ ID NO:26(C)：ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
27 (RSV fusion protein): MELPILNAITTIILAAVTFCFASSQNITEEFYQSTCSAVSKGYLSANRARRELFLLVDTWYTSVITIELSKENKCNGTDAKVKLKWKLKYKNAVTELQLLQSTPAANNRLRELFLRNFLRNTRRFNYTLNTTTNVTLSKKRRFLRGFLGGGSAIASGASKVLSKVLEGLVEGVKLVSLVLSKLVSLSKLVSLVLSTGLSKLVSLTSKVLSKVLSKVKLVSKLTGNVKLTGNVKLVTNLVTNLVSLVTNVTNLVSLVDTVSKLVSKLVSKLVSKLVTNLVSKLVTNLVSKLVSKLVTNLVSKLVTNLVSVTNLVSVTNLVSVTNLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVTNLVSKLVSKLVTNLVSKLVSKLVSKLVSKLVTNLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLNVKLNVKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSFLVSKLVSKLVSKLVSKLVSFLVSFLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSFLVSKLVSKLVSKLVSFLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVSKLVS
Claims (10)
1. A monoclonal anti-Respiratory Syncytial Virus (RSV) antibody, which is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOs: 1-3, respectively H CDR1、V H CDR2 and V H CDR3，The light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 4-6, respectively L CDR1、V L CDR2 and V L CDR3, wherein the sequence shown in SEQ ID NO. 6 is QQYSNFPXT, and X is C or F;
preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO 19 or a sequence identical to SEQ ID NO:19 has a sequence with more than 80%, more than 85%, more than 90% or more than 95% identity, and the light chain variable region comprises the amino acid sequence shown in SEQ ID NO:20 or a sequence which is identical to the amino acid sequence shown in SEQ ID NO:20 has a sequence with 80% or more, 85% or more, 90% or more, or 95% or more identity;
preferably, V of said antibody L CDR3 is QQYSNFPCT, and is produced by hybridoma with preservation number of CGMCC No.45238, which is deposited in China general microbiological culture Collection center (CGMCC) of institute of microbiology, china academy of sciences, no. 3, west Lu 1, navy, beijing, and the rising area of Beijing for 7 months and 14 days in 2022.
2. A hybridoma cell which is preserved in China general microbiological culture Collection center (CGMCC) of the microbiological research institute of China academy of sciences No. 3 of Beijing, chaoyang, beijing, 7 months and 14 days in 2022, and the preservation number of the hybridoma cell is CGMCC No.45238.
3. An expression vector comprising a gene encoding a monoclonal anti-RSV antibody, wherein the monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 1-3, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 4-6, respectively L CDR1、V L CDR2 and V L CDR3, wherein the sequence shown in SEQ ID NO. 6 is QQYSNFPXT, wherein X is C or F, in particular X is F;
preferably, the heavy chain variable region comprises the amino acid sequence shown in SEQ ID NO 19 or a sequence identical to SEQ ID NO:19, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:20 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:20 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more;
preferably, the expression vector is a plasmid vector such as pcdna3.1, pEE12, pCAGGS.
4. An expression cell comprising the expression vector of claim 3; preferably, the expression cell is a mammalian cell, such as a chinese hamster ovary cell, a small hamster kidney cell, a monkey kidney cell, a mouse thymoma cell, a human embryonic kidney cell.
5. A method of detecting Respiratory Syncytial Virus (RSV), for non-diagnostic purposes, comprising the step of using the monoclonal anti-RSV antibody of claim 1.
6. Use of the monoclonal anti-RSV antibody of claim 1 in the manufacture of a reagent for detecting Respiratory Syncytial Virus (RSV).
7. The method of claim 5 or the use of claim 6, wherein the detection is by immunochromatography, enzyme-labeled antibody method (ELISA), chemiluminescence, electrochemiluminescence; preferably, the immunochromatography comprises a fluorescent microsphere immunochromatography, a colloidal gold immunochromatography, an immunochromatography based on colored latex microspheres, a time-resolved fluorescent microsphere immunochromatography, a magnetic microsphere immunochromatography and a quantum dot immunochromatography; ELISA such as direct method, indirect method, sandwich method and competition method.
8. The method according to claim 5 or 7 or the use according to claim 6 or 7, wherein a further monoclonal anti-RSV antibody is also used in the detection and is used as one of a coating antibody and a labeled antibody, the further monoclonal anti-RSV antibody is used as the other of a coating antibody and a labeled antibody;
preferably, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3, or the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3；
Preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:21 or a sequence identical to SEQ ID NO:21, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:22 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:22, or the heavy chain variable region comprises the amino acid sequence shown in SEQ ID NO:23 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence with 80% or more, 85% or more, 90% or more, or 95% or more identity;
more preferably, the other monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain variable region having a variable region defined by SEHeavy chain complementarity determining region V of the amino acid sequence shown in Q ID NO 13-15 H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3；
Further preferably, the heavy chain variable region comprises the amino acid sequence shown in SEQ ID NO 23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
9. A monoclonal anti-RSV antibody combination for immunodetection comprising a first monoclonal anti-RSV antibody as a labeled antibody and a second monoclonal anti-RSV antibody as a coating antibody, wherein,
the first monoclonal anti-RSV antibody of claim 1,
the second monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3，
Preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence of 80% or more, 85% or more, 90% or more, or 95% or more identity to the amino acid sequence;
or
The first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS: 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3，
Preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO 23 or a sequence identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more,
the second monoclonal anti-RSV antibody is the monoclonal anti-RSV antibody of claim 1;
or alternatively
The first monoclonal anti-RSV antibody is a monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences set forth in SEQ ID NOS 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3，
Preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:21 or a sequence identical to SEQ ID NO:21, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO:22 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:22 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more,
the second monoclonal anti-RSV antibody is the monoclonal antibody of claim 1RSV antibodies, preferably wherein V L Monoclonal anti-RSV antibody with CDR3 qysnfpft.
10. A kit for detecting Respiratory Syncytial Virus (RSV), the kit comprising the monoclonal anti-RSV antibody of claim 1 and instructions for directing how to detect Respiratory Syncytial Virus (RSV);
preferably, the kit further comprises: another monoclonal anti-RSV antibody comprising a heavy chain variable region and a light chain variable region, wherein:
the heavy chain variable region comprises a heavy chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 7-9, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprises a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 10-12, respectively L CDR1、V L CDR2 and V L CDR3，
Preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:21 or a sequence identical to SEQ ID NO:21 has a sequence of more than 80%, more than 85%, more than 90% or more than 95% identity, and the light chain variable region comprises the amino acid sequence shown in SEQ ID NO. 22 or a sequence identical to SEQ ID NO:22 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more;
or
The heavy chain variable region comprises a heavy chain variable region V having amino acid sequences represented by SEQ ID NOS 13-15, respectively H CDR1、V H CDR2 and V H CDR3, the light chain variable region comprising a light chain complementarity determining region V having amino acid sequences represented by SEQ ID NOS 16-18, respectively L CDR1、V L CDR2 and V L CDR3，
Preferably, the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:23 or a sequence substantially identical to SEQ ID NO:23, and the light chain variable region comprises an amino acid sequence shown in SEQ ID NO. 24 or a sequence having more than 80%, more than 85%, more than 90% or more than 95% identity with the amino acid sequence shown in SEQ ID NO:24 has a sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202211182850.9A CN115960216B (en) | 2022-09-27 | 2022-09-27 | Anti-respiratory syncytial virus antibodies and related uses thereof |
| PCT/CN2023/118965 WO2024067151A1 (en) | 2022-09-27 | 2023-09-15 | Anti-respiratory syncytial virus antibody and related use thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202211182850.9A CN115960216B (en) | 2022-09-27 | 2022-09-27 | Anti-respiratory syncytial virus antibodies and related uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN115960216A true CN115960216A (en) | 2023-04-14 |
| CN115960216B CN115960216B (en) | 2023-07-07 |
Family
ID=85903769
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202211182850.9A Active CN115960216B (en) | 2022-09-27 | 2022-09-27 | Anti-respiratory syncytial virus antibodies and related uses thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN115960216B (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024067151A1 (en) * | 2022-09-27 | 2024-04-04 | 深圳重链生物科技有限公司 | Anti-respiratory syncytial virus antibody and related use thereof |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103048459A (en) * | 2012-12-05 | 2013-04-17 | 中国科学院武汉病毒研究所 | Immune detection reagent for detecting respiratory syncytial virus |
| CN111606993A (en) * | 2019-02-26 | 2020-09-01 | 中国科学院上海生命科学研究院 | Fully human broad-spectrum neutralizing antibody 4F1 for resisting respiratory syncytial virus and application thereof |
| CN113249333A (en) * | 2021-03-16 | 2021-08-13 | 贵州省人民医院 | Hybridoma cell strain RSVN4C3 secreting monoclonal antibody against respiratory syncytial virus |
| CN113402604A (en) * | 2021-07-14 | 2021-09-17 | 北京保图生物技术有限公司 | Kit for rapidly detecting virus and preparation method thereof |
-
2022
- 2022-09-27 CN CN202211182850.9A patent/CN115960216B/en active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103048459A (en) * | 2012-12-05 | 2013-04-17 | 中国科学院武汉病毒研究所 | Immune detection reagent for detecting respiratory syncytial virus |
| CN111606993A (en) * | 2019-02-26 | 2020-09-01 | 中国科学院上海生命科学研究院 | Fully human broad-spectrum neutralizing antibody 4F1 for resisting respiratory syncytial virus and application thereof |
| CN113249333A (en) * | 2021-03-16 | 2021-08-13 | 贵州省人民医院 | Hybridoma cell strain RSVN4C3 secreting monoclonal antibody against respiratory syncytial virus |
| CN113402604A (en) * | 2021-07-14 | 2021-09-17 | 北京保图生物技术有限公司 | Kit for rapidly detecting virus and preparation method thereof |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024067151A1 (en) * | 2022-09-27 | 2024-04-04 | 深圳重链生物科技有限公司 | Anti-respiratory syncytial virus antibody and related use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN115960216B (en) | 2023-07-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN115838419B (en) | Anti-respiratory syncytial virus antibodies and related uses thereof | |
| CN115724951B (en) | Antibodies or antigen binding fragments thereof that bind to HPV type 11 and uses thereof | |
| CN115960216A (en) | Anti-respiratory syncytial virus antibodies and uses thereof | |
| CN115925909B (en) | Anti-respiratory syncytial virus antibodies and related uses thereof | |
| CN116143914B (en) | Antibody for dengue virus NS1 protein and related application thereof | |
| CN116355094B (en) | Monoclonal antibody against interleukin 12 of mouse and preparation method | |
| CN117024585A (en) | Antithyroid globulin monoclonal antibody and application thereof | |
| KR20210049894A (en) | Anti-human myocardial troponin I recombinant antibody | |
| CN113683692B (en) | SARS-CoV-2N protein antibody and its application | |
| WO2024067151A1 (en) | Anti-respiratory syncytial virus antibody and related use thereof | |
| CN116789807B (en) | Anti-adenovirus monoclonal antibody and application thereof | |
| CN115825415B (en) | Blocker and in vitro immunodiagnostic product and use | |
| CN117003880B (en) | Anti-thiocyanate fluorescein monoclonal antibody and application thereof | |
| CN116396392B (en) | Antibody specific to digoxigenin and related application thereof | |
| CN116023483B (en) | anti-SARS-CoV-2 antibody and application thereof | |
| CN116082500B (en) | anti-SARS-CoV-2 antibodies nCoV1 and nCoV2 and uses thereof | |
| CN117106073A (en) | Anti-novel coronavirus monoclonal antibody and application thereof | |
| CN117304330B (en) | His tag antibody and application thereof | |
| CN116813780B (en) | Anti-human CD31 rabbit monoclonal antibody and application thereof | |
| CN116693664A (en) | Anti-adenovirus monoclonal antibody and application thereof | |
| CN117467005A (en) | Anti-plasmodium monoclonal antibody and application thereof | |
| CN117466995B (en) | Antibodies or antigen binding fragments thereof specifically binding to HPV45 type capsid protein L1 and application thereof | |
| CN117402249A (en) | Anti-pancreatic lipase monoclonal antibody and application thereof | |
| CN117143226B (en) | Antibodies or antigen binding fragments thereof specifically binding to HPV33 type capsid protein L1 and uses thereof | |
| CN117551189A (en) | anti-Zika virus monoclonal antibody and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CP03 | Change of name, title or address |
Address after: 518101, 3rd Floor, Building 47, Baotian Industrial Zone, Chentian Community, Xixiang Street, Bao'an District, Shenzhen City, Guangdong Province Patentee after: Shenzhen heavy chain Biotechnology Co.,Ltd. Country or region after: China Address before: Room 304, Building 30, Baotian Industrial Zone, Chentian Community, Xixiang Street, Baoan District, Shenzhen City, Guangdong Province, 518101 Patentee before: Shenzhen heavy chain Biotechnology Co.,Ltd. Country or region before: China |
|
| CP03 | Change of name, title or address |