CN115960187A - Recombinant antibacterial peptide PmHis3, recombinant expression vector, engineering bacterium and application thereof - Google Patents
Recombinant antibacterial peptide PmHis3, recombinant expression vector, engineering bacterium and application thereof Download PDFInfo
- Publication number
- CN115960187A CN115960187A CN202310032181.5A CN202310032181A CN115960187A CN 115960187 A CN115960187 A CN 115960187A CN 202310032181 A CN202310032181 A CN 202310032181A CN 115960187 A CN115960187 A CN 115960187A
- Authority
- CN
- China
- Prior art keywords
- pmhis3
- recombinant
- antibacterial peptide
- seq
- expression vector
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000003910 polypeptide antibiotic agent Substances 0.000 title claims abstract description 62
- 241000894006 Bacteria Species 0.000 title claims abstract description 23
- 239000013604 expression vector Substances 0.000 title claims abstract description 23
- 238000003259 recombinant expression Methods 0.000 title claims abstract description 20
- 241000191967 Staphylococcus aureus Species 0.000 claims abstract description 22
- 241000499912 Trichoderma reesei Species 0.000 claims abstract description 17
- 239000002773 nucleotide Substances 0.000 claims abstract description 11
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 11
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 10
- 238000002360 preparation method Methods 0.000 claims abstract description 7
- 239000003899 bactericide agent Substances 0.000 claims abstract description 6
- 239000000022 bacteriostatic agent Substances 0.000 claims abstract description 6
- 150000001413 amino acids Chemical class 0.000 claims abstract 2
- 239000012634 fragment Substances 0.000 claims description 10
- 241000222122 Candida albicans Species 0.000 claims description 9
- 229940095731 candida albicans Drugs 0.000 claims description 9
- 241000589517 Pseudomonas aeruginosa Species 0.000 claims description 8
- 238000000855 fermentation Methods 0.000 claims description 8
- 230000004151 fermentation Effects 0.000 claims description 8
- 210000001938 protoplast Anatomy 0.000 claims description 6
- 238000012795 verification Methods 0.000 claims description 6
- 238000000246 agarose gel electrophoresis Methods 0.000 claims description 5
- 238000012216 screening Methods 0.000 claims description 4
- 238000012163 sequencing technique Methods 0.000 claims description 4
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 claims description 2
- 238000012220 PCR site-directed mutagenesis Methods 0.000 claims description 2
- 239000002202 Polyethylene glycol Substances 0.000 claims description 2
- 239000003674 animal food additive Substances 0.000 claims description 2
- 230000001404 mediated effect Effects 0.000 claims description 2
- 229920001223 polyethylene glycol Polymers 0.000 claims description 2
- 238000011426 transformation method Methods 0.000 claims description 2
- 230000001131 transforming effect Effects 0.000 claims description 2
- 238000000034 method Methods 0.000 claims 2
- 230000003385 bacteriostatic effect Effects 0.000 claims 1
- 108010078656 plectasin Proteins 0.000 abstract description 34
- 230000000844 anti-bacterial effect Effects 0.000 abstract description 13
- 230000002401 inhibitory effect Effects 0.000 abstract description 5
- 238000002741 site-directed mutagenesis Methods 0.000 abstract description 4
- 102000038379 digestive enzymes Human genes 0.000 abstract description 3
- 108091007734 digestive enzymes Proteins 0.000 abstract description 3
- 230000009286 beneficial effect Effects 0.000 abstract description 2
- 238000010353 genetic engineering Methods 0.000 abstract description 2
- 244000005700 microbiome Species 0.000 abstract 1
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 12
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 108090000623 proteins and genes Proteins 0.000 description 7
- 241000223259 Trichoderma Species 0.000 description 6
- 238000000137 annealing Methods 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 5
- 102000004142 Trypsin Human genes 0.000 description 5
- 108090000631 Trypsin Proteins 0.000 description 5
- 238000004925 denaturation Methods 0.000 description 5
- 230000036425 denaturation Effects 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 150000007523 nucleic acids Chemical class 0.000 description 5
- 239000012588 trypsin Substances 0.000 description 5
- 206010059866 Drug resistance Diseases 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 102000057297 Pepsin A Human genes 0.000 description 4
- 108090000284 Pepsin A Proteins 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 238000010586 diagram Methods 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 229940111202 pepsin Drugs 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 206010048038 Wound infection Diseases 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 108010006654 Bleomycin Proteins 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- 241000192125 Firmicutes Species 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 239000008118 PEG 6000 Substances 0.000 description 2
- 229920002584 Polyethylene Glycol 6000 Polymers 0.000 description 2
- 108010059993 Vancomycin Proteins 0.000 description 2
- 108010084455 Zeocin Proteins 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229960001561 bleomycin Drugs 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 210000002421 cell wall Anatomy 0.000 description 2
- 239000002537 cosmetic Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- ULXTYUPMJXVUHQ-OVTFQNCVSA-N lipid II Chemical compound OC(=O)[C@@H](C)NC(=O)[C@@H](C)NC(=O)[C@H](CCCCN)NC(=O)CC[C@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]1[C@@H](NC(C)=O)[C@@H](OP(O)(=O)OP(O)(=O)OC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(\C)CC\C=C(/C)CC\C=C(/C)CCC=C(C)C)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 ULXTYUPMJXVUHQ-OVTFQNCVSA-N 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 2
- 238000012257 pre-denaturation Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 239000008223 sterile water Substances 0.000 description 2
- 229960003165 vancomycin Drugs 0.000 description 2
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 2
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 239000004278 EU approved seasoning Substances 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 238000013494 PH determination Methods 0.000 description 1
- 235000010627 Phaseolus vulgaris Nutrition 0.000 description 1
- 244000046052 Phaseolus vulgaris Species 0.000 description 1
- 241000383853 Pseudoplectania nigrella Species 0.000 description 1
- 206010041925 Staphylococcal infections Diseases 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000002802 antimicrobial activity assay Methods 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 235000013361 beverage Nutrition 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000004744 fabric Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 235000011194 food seasoning agent Nutrition 0.000 description 1
- 235000012055 fruits and vegetables Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000002949 hemolytic effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 235000013622 meat product Nutrition 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 208000015688 methicillin-resistant staphylococcus aureus infectious disease Diseases 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
Images
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a recombinant antibacterial peptide PmHis3, a recombinant expression vector, an engineering bacterium and application thereof, belonging to the field of genetic engineering and biotechnology, wherein the amino acid sequence of the recombinant antibacterial peptide PmHis3 is shown in SEQ ID NO. 1. The nucleotide sequence of the amino acid shown in the code SEQ ID NO.1 is shown in SEQ ID NO.2, the invention provides a preparation method of heterologous expression of recombinant antibacterial peptide PmHis3 in Trichoderma reesei, wherein the recombinant antibacterial peptide PmHis3 is generated by plectasin through site-directed mutagenesis, has an inhibiting effect on microorganisms such as staphylococcus aureus, has good thermal stability, digestive enzyme stability and pH stability, and is beneficial to the application of the recombinant antibacterial peptide PmHis3 in the preparation of bacteriostatic agents or bactericides.
Description
Technical Field
The invention belongs to the technical field of genetic engineering and biology, and particularly relates to a recombinant antibacterial peptide PmHis3, a recombinant expression vector, an engineering bacterium and application thereof.
Background
Staphylococcus aureus is a common pathogenic bacterium, widely distributed in air, water, human bodies and animal bodies, and can cause wound infection, skin inflammation and food-borne diseases. Staphylococcus aureus is easy to generate drug resistance, and a drug-resistant strain MRSA has drug resistance to various antibiotics, so that the staphylococcus aureus is the key point of prevention and control in the medical field. China has made a limit on staphylococcus aureus in 8 types of foods such as meat products, aquatic products, food products, instant bean products, instant fruit and vegetable products, beverages, frozen drinks, instant seasonings and the like. In addition, relevant standards in catering, hairdressing, cosmetics, medical treatment, animal feed, etc. have made a limit on staphylococcus aureus. Therefore, it is necessary to develop bacteriostatic agents or bactericides mainly targeting staphylococcus aureus.
The antibacterial peptide has the advantages of safety, environmental protection, high efficiency, difficult generation of drug resistance and the like, and can effectively replace antibiotics. Plectasin is a fungal antibacterial peptide derived from Pseudoplectania nigrella, has 3 disulfide bonds and a unique CS alpha beta structure, has a strong inhibition effect on gram-positive bacteria, and has good stability and no hemolytic activity. Plectasin can be combined with a cell wall precursor substance Lipid-II of gram-positive bacteria such as staphylococcus aureus and the like, so that the formation of a cell wall is inhibited, and the plectasin is similar to vancomycin; however, the binding site is mainly phosphate group of Lipid-II, which is less prone to cause drug resistance of bacteria. Plectasin is researched and applied in the fields of feed, cosmetics, medical treatment and the like, and is one of antibacterial peptides with research prospects and research values.
At present, myceliomycin plectasin is applied to bacteriostatic agents or bactericides and has several main problems. One is that the antibacterial activity of plectasin in the prior art is still in a large difference compared with the traditional antibiotics, the MIC of plectasin to staphylococcus aureus is 16-32 mug/mL, and the MIC of vancomycin is 1-2 mug/mL; the other is the safety problem in the production process, and the host engineering strain for producing plectasin such as pichia pastoris needs to be added with inducers such as methanol and the like before fermentation production.
Disclosure of Invention
The technical problem to be solved by the invention is to provide a recombinant antibacterial peptide PmHis3, a recombinant expression vector, an engineering bacterium and application thereof. In order to improve the antibacterial activity of plectasin, the invention designs a plectasin mutant PmHis3 by increasing the positive charge of antibacterial peptide, and finds that the inhibitory activity of PmHis3 on staphylococcus aureus is further improved compared with plectasin.
The invention is realized based on the following technical scheme:
a recombinant antibacterial peptide PmHis3, the amino acid sequence of the recombinant antibacterial peptide PmHis3 is shown in SEQ ID NO. 1. The SEQ ID NO.1 is a mutant obtained by site-specific mutagenesis of the amino acid sequence fragment shown in SEQ ID NO. 3. The nucleic acid of the prosequence plectasin codes for the mutation of the aspartic acid at position 11 of SEQ ID NO.3 to the asparagine coding for SEQ ID NO. 1.
The nucleotide sequence of the amino acid sequence coded by the SEQ ID NO.1 is shown as SEQ ID NO.2, and the SEQ ID NO.2 is translated into the coded nucleotide sequence on the basis of the antibacterial peptide PmHis3 of the original amino acid sequence SEQ ID NO. 1.
SEQ ID NO.1:GFGCNGPWDENDMQCHNHCKSIKGYKGGYCAKGGF VCKCY；
SEQ ID NO.2:gaattcggatttggatgtaacggtccgtgggatgaaaacgatatgcaatgtcataaccat tgtaagtctattaagggatacaagggaggttactgtgctaagggtggttttgtttgtaagtgttactaataagcggccgc；
SEQ ID NO.3:GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGF VCKCY.
A recombinant expression vector comprises the antibacterial peptide gene.
A recombinant engineering bacterium comprises the recombinant expression vector, and a host strain is Trichoderma reesei Tu6.
The invention comprises a preparation method of recombinant antibacterial peptide PmHis3, which comprises the following steps: translating an amino acid sequence of plectasin into a nucleic acid sequence according to the preference of trichoderma reesei codons, amplifying the nucleic acid sequence by using PCR, verifying a PCR product, inserting the verified PCR product into a trichoderma reesei expression vector through in vitro homologous recombination, and constructing a recombinant antibacterial peptide trichoderma reesei expression vector plectasin-pCBHG; constructing a recombinant expression vector PmHis3-pCBHG of the recombinant antibacterial peptide PmHis3 by PCR site-directed mutagenesis by taking plectasin-pCBHG as a template, detecting the PCR fragment by using agarose gel electrophoresis, carrying out sequencing verification on the PCR fragment, and transforming the PCR fragment into escherichia coli DH5 alpha; and transferring the recombinant expression vector into trichoderma reesei Tu6 by adopting a polyethylene glycol mediated protoplast transformation method, and obtaining the recombinant antibacterial peptide PmHis3 through fermentation expression after screening a positive transformant and verification.
The invention relates to an application of recombinant antibacterial peptide PmHis3 in preparing feed and feed additives.
The invention relates to an application of a recombinant antibacterial peptide PmHis3 in preparation of a bacteriostatic agent or a bactericide, wherein the bacterium is staphylococcus aureus, candida albicans and pseudomonas aeruginosa.
Compared with the prior art, the invention has the beneficial effects that:
the recombinant antibacterial peptide PmHis3 has good thermal stability and pH stability, the stability of trypsin and pepsin is improved, and the recombinant antibacterial peptide PmHis3 has stronger inhibiting effect on staphylococcus aureus, candida albicans and pseudomonas aeruginosa than plectasin.
The trichoderma reesei used in the invention is safe and harmless, can be directly added into feed according to national standards, has the advantages of strong promoter, efficient synthetic secretion mechanism and the like, has the advantages of independent advantages in large-scale fermentation, and can further improve the yield.
Drawings
FIG. 1 is a schematic diagram of the electrophoresis of PCR amplified nucleic acids of a recombinant expression vector;
FIG. 2 is a schematic diagram of the construction of a recombinant expression vector PmHis 3-pCBHG;
FIG. 3 is a schematic diagram of the thermal stability of the recombinant antibacterial peptide PmHis 3;
FIG. 4 is a schematic representation of pepsin stability of the recombinant antimicrobial peptide PmHis 3;
FIG. 5 is a schematic representation of trypsin stability of the recombinant antimicrobial peptide PmHis 3;
FIG. 6 is a pH stability diagram of the recombinant antibacterial peptide PmHis3.
Detailed Description
The technical solution of the present invention is further explained by the following embodiments with reference to the attached drawings, but the scope of the present invention is not limited in any way by the embodiments.
Example 1 construction of recombinant expression vector of Plectasin for Trichoderma reesei, plectasin-PCBHG
The amino acid sequence of plectasin, which is published in UQI49964.1 in NCBI, is used as an original amino acid sequence, and the plectasin is translated into a nucleotide sequence by using SnapGene 3.2.1 software for artificial synthesis. And constructing a Trichoderma reesei recombinant expression vector plectasin-PCBHG of the plectasin by using the synthesized nucleotide sequence as a template.
Linearized primer pairs using trichoderma reesei Tu6 vector backbone PCBHG-f:5'-GCTCCGTGGCGAAAGCCT-3' and PCBHG-r:5'-AGCACGAGCTGTGGCCAAG-3' was linearized by PCR using the enzyme
Super-Fidelity DNA Polymerase, PCR reaction system (50. Mu.L) was: 5 × Phanta Buffer 25 μ L; dNTP 1 u L; />
0.5 mu L; pf 2. Mu.L; pr 2. Mu.L; 1 μ L of vector PCBHG; ddH 2 O18.5. Mu.L. The Trichoderma reesei Tu6 carrier framework PCR adopts gradient annealing temperature, and the reaction conditions are as follows: pre-denaturation at 94 ℃ for 3 min; denaturation at 94 ℃ for 30sec, annealing at 62 ℃ for 30sec, extension at 72 ℃ for 7min, and 5 cycles; denaturation at 94 ℃ for 30sec,Annealing at 60 ℃ for 30sec, stretching at 72 ℃ for 7min, and 5 cycles; denaturation at 94 ℃ for 30sec, annealing at 58 ℃ for 30sec, extension at 72 ℃ for 7min, 5 cycles; denaturation at 94 ℃ for 30sec, annealing at 56 ℃ for 30sec, extension at 72 ℃ for 7min, and 25 cycles; total extension was 10min at 72 ℃.
The PCR product verified by agarose gel electrophoresis was digested, 1. Mu.L of DpnI enzyme was used, and 5. Mu.L of rCutSmart Buffer was added. The reaction conditions were 37 ℃ for 2h. And (3) recovering and purifying by using a Cycle Pure Kit PCR purification Kit to obtain a linear fragment of the PCBHG carrier. Carrying out in-vitro homologous recombination and connection on the artificially synthesized plectasin nucleic acid fragment and a linearized vector, wherein the used homologous recombination ligase is Exnase II, and the 5 mu L connector system is as follows: exnase II 0.5. Mu.L, CE II Buffer 2. Mu.L, linear vector backbone 0.5. Mu.L, ddH 2 O1. Mu.L, plectasin gene 1. Mu.L.
The reaction was performed at 37 ℃ for 30min to ligate into a loop, and then the product was transformed into E.coli DH 5. Alpha. And cultured in LB solid medium supplemented with bleomycin (zeocin) at 37 ℃ for 16h. And after a single colony grows out, selecting the single colony for colony PCR and sequencing, and completing construction of the plectasin-PCBHG trichoderma reesei recombinant expression vector plectasin-PCBHG after comparison and verification.
Example 2 site-directed mutagenesis of the recombinant antimicrobial peptide PmHis3 Gene
Using plectasin-PCBHG prepared in example 1 as a template, a PmHis3 nucleotide fragment was prepared by site-directed mutagenesis PCR. The PCR amplification enzyme used was
High fidelity amplification enzyme, PCR reaction system (50 μ L) was:
Buffer 25μL；dNTP 1μL；/>
0.5 mu L; pf 2. Mu.L; pr 2. Mu.L, synthesizing a template 1. Mu.L; ddH 2 O18.5. Mu.L. The PCR amplification reaction conditions of the PmHis3 gene are as follows: pre-denaturation at 94 ℃ for 3 min; denaturation at 94 ℃ for 30sec, annealing at 57 ℃ for 30sec, extension at 72 ℃ for 7min, and 35 cycles; 72 ℃ for 10minA total extension; 4 ℃ is prepared. Wherein the sequence of a forward primer PmHis3-f of the PmHis3 gene is 5'-GGGATGAAAACGATATGCAATG-3', and the sequence of a reverse primer PmHi s3-r is 5'-ATATCGTTTTCATCCCACGGAC-3'.
The target band of the gene amplification of the antimicrobial peptide PmHis3 is detected by agarose gel electrophoresis, as shown in FIG. 1. The PCR product verified by agarose gel electrophoresis was digested, 1. Mu.L of DpnI enzyme was used, and 5. Mu.L of LrCutSmart Buffer was added. The reaction conditions were 37 ℃ for 2h. The linearized fragment of PmHis3-PCBHG is obtained by recovery and purification by using a Cycle Pure Kit PCR purification Kit. The linearized recombinant expression vector PmHis3-PCBHG was ligated into a circular plasmid using Exnase II, with a 5. Mu.L linker system: exnase II 0.5. Mu.L, CE II Buffer 2. Mu.L, ddH 2 O1. Mu.L, plectasin gene 1.5. Mu.L. The reaction was performed at 37 ℃ for 30min to ligate into a loop, and then the product was transformed into E.coli DH 5. Alpha. And cultured in LB solid medium supplemented with bleomycin (zeocin) at 37 ℃ for 16h. After a single colony grows, selecting the single colony for colony PCR and sequencing, and completing the construction of the Trichoderma reesei recombinant expression vector PmHis3-PCBHG of PmHis3 after comparison and verification, as shown in figure 2.
EXAMPLE 3 transformation of Trichoderma recombinant expression vector for antimicrobial peptide PmHis3
Subculturing the Trichoderma reesei host strain Tu6 on a PDA + U solid medium plate at 30 deg.C for 5-6 days, washing off spores using 0.1% Trition solution, inoculating to YEG medium, and culturing in a constant temperature shaker at 30 deg.C and 180rpm for 20h.
Filtering the mature bacteria liquid with sterile filter cloth and funnel after enzymolysis, washing with sterile water, collecting appropriate amount of mycelium, and filtering and sterilizing with enzymolysis liquid with filter with 0.45 μ L pore diameter; incubate at 30 ℃ for 2h on a constant temperature shaker at 80 rpm. Filtering and centrifuging the thallus enzymolysis solution, suspending the protoplast by using a 1M sorbitol solution, centrifuging for 4min at 3500rpm, repeatedly washing for 2 times by using sterile water, and suspending the protoplast by using 1mL of 1M sorbitol solution to finish the preparation of the protoplast.
The recombinant plasmid constructed in example 2 was extracted using an e.z.n.a.plasmid Mini Kit i Kit. mu.L of protoplast, 10. Mu.L of recombinant PmHis3 plasmid, 50. Mu.L of 25% PEG6000 were taken, mixed and ice-cooled for 25min. The resulting system was transferred to a 10mL centrifuge tube containing 2mL of 25% PEG6000, and allowed to stand at room temperature for 20min. Adding the solution into the upper culture medium for trichoderma transformation, mixing, pouring on a flat plate paved with the lower culture medium for trichoderma transformation, and culturing at 30 ℃ for 5-6 days.
Example 4 fermentative expression of antimicrobial peptide PmHis3 in Trichoderma
Inoculating the transformant grown in the trichoderma transformation medium to a new plate for screening, and performing genome extraction and verification on the target gene after hypha and spores grow out. Inoculating the screened positive transformant to a trichoderma fermentation culture medium, firstly growing in a constant-temperature shaking table at 30 ℃ and 180rpm for 2 days, regulating the temperature to 25 ℃ after the strain obviously grows, continuing fermentation and induction expression for 4-5 days, and then centrifuging to obtain a fermentation product. Detecting, screening and separating the fermentation product to obtain the antibacterial peptide PmHis3, and determining that the amino acid sequence is the same as SEQ ID NO.1 and the coding nucleotide sequence is the same as SEQ ID NO.2.
Example 5 antimicrobial Activity assay of the antimicrobial peptide PmHis3
Determination of Minimum Inhibitory Concentration (MIC)
The indicator bacteria used in this example were Escherichia coli, pseudomonas aeruginosa, staphylococcus aureus, and Candida albicans.
Determining MIC by adopting a trace double dilution method: preparing bacterial suspension, and respectively diluting the four bacteria cultured to the logarithmic phase of growth to the concentration of 10 5 CFU/mL, mixing the purified antibacterial peptide PmHis3 solution and antibacterial peptide plectasin solution with the bacterial suspension in equal amount in the first column of a 96-well plate, wherein the initial concentration of the antibacterial peptide sample is 150 mu g/mL, and then sequentially diluting in a concentration gradient manner. Adding the bacterial suspension after equal dilution into all samples of a 96-well plate, incubating escherichia coli, pseudomonas aeruginosa and staphylococcus aureus for 18 hours at 37 ℃, and incubating candida albicans for 24 hours at 30 ℃. After incubation, the turbidity of each well was visually observed, wherein the minimum concentration to clarify the wells was the MIC of the antimicrobial peptide PmHis3 for each bacterium.
As shown in Table 1, the antibacterial activity of the recombinant antibacterial peptide PmHis3 is improved relative to plectasin. MIC of both to Escherichia coli is 150 μ g/mL; MICs of the recombinant antibacterial peptide PmHis3 to pseudomonas aeruginosa, staphylococcus aureus and candida albicans are respectively 37.5 mu g/mL, 18.8 mu g/mL and 18.8 mu g/mL, which shows that the antibacterial activity of the recombinant antibacterial peptide PmHis3 to the pseudomonas aeruginosa, staphylococcus aureus and candida albicans is higher than that of the original sequence plectasin.
TABLE 1 MIC (μ g/mL) of plectasin and PmHis3, a plectasin myceliophthorn, to different bacteria
Determination of zone of inhibition
And (3) coating 150 mu L of the bacterial liquid on a culture medium which is suitable for growth of each bacterium, respectively adding 100 mu L of recombinant antibacterial peptide PmHis3 and plectasin with the concentration of 300 mu g/mL into an Oxford cup, incubating each bacterium for 18h at 37 ℃, and incubating Candida albicans for 24h at 30 ℃. The determination results are shown in table 2, and the antibacterial activity of the recombinant antibacterial peptide PmHis3 to each bacterium is improved.
TABLE 2 inhibition zone size (mm) of plectasin and PmHis3 for different bacteria
The data show that the recombinant antibacterial peptide PmHis3 has improved antibacterial activity on bacteria such as gram-negative pseudomonas aeruginosa, gram-positive staphylococcus aureus and candida albicans in fungi which are easy to cause wound infection, and is favorable for being used as a bacteriostatic agent or a bactericide in the treatment of wound infection.
Example 6 thermostability assay of recombinant antimicrobial peptide PmHis3
The indicator bacteria used in this example were staphylococcus aureus, the thermal stability results are shown in fig. 3, where the abscissa is the boiling water bath treatment time, the inhibitory activity of the recombinant antibacterial peptide PmHis3 and plectasin on each bacteria after high temperature treatment was reduced to different degrees, and the PmHis3 could maintain 94% inhibition rate after 30min treatment, which was slightly lower than plectasin. The data show that the recombinant antibacterial peptide PmHis3 has relatively good thermal stability and can resist high temperature for a long time.
Example 7 digestive enzyme stability assay for recombinant antimicrobial peptide PmHis3
The indicator bacteria used in this example were staphylococcus aureus, and the results of the digestive enzyme stability assay of the recombinant antimicrobial peptide PmHis3 are shown in fig. 4 and 5, where fig. 4 is pepsin and fig. 5 is trypsin. The recombinant antibacterial peptide PmHis3 and the original sequence plectasin have better stability in pepsin. Compared with the original sequence, the recombinant antibacterial peptide PmHis3 has better trypsin stability. After 120min of trypsin treatment, the inhibition rate of the PmHis3 on the staphylococcus aureus can still reach more than 50 percent.
Example 8 determination of pH stability of recombinant antimicrobial peptide PmHis3
The indicator used in this example was staphylococcus aureus and the pH stability measurements are shown in fig. 6, where the abscissa is the pH value. The recombinant antibacterial peptide PmHis3 and the original sequence plectasin can keep more than 80% of antibacterial activity after being treated for 120min in alkaline and acidic environments, which shows that the recombinant antibacterial peptide PmHis3 and the original sequence plectasin have good pH stability and tolerance to acid and alkali.
Claims (7)
1. A recombinant antibacterial peptide PmHis3 is characterized in that the amino acid sequence of the recombinant antibacterial peptide PmHis3 is shown in SEQ ID NO. 1.
2. A nucleotide sequence for coding amino acid shown in SEQ ID NO.1, which is characterized in that the nucleotide sequence is shown in SEQ ID NO.2.
3. A recombinant expression vector comprising the nucleotide sequence of SEQ ID No.2 of claim 2.
4. A recombinant bacterium, which contains the nucleotide sequence SEQ ID No.2 of claim 2, wherein the host strain is Trichoderma reesei Tu6.
5. The method for preparing the recombinant antibacterial peptide Pmhis3 as claimed in claim 1, which is characterized in that the method is to firstly construct a recombinant antibacterial peptide Trichoderma reesei expression vector plectasin-pCBHG; constructing a recombinant expression vector PmHis3-pCBHG of the recombinant antibacterial peptide PmHis3 by PCR site-directed mutagenesis by taking plectasin-pCBHG as a template, detecting the PCR fragment by using agarose gel electrophoresis, carrying out sequencing verification on the PCR fragment, and transforming the PCR fragment into escherichia coli DH5 alpha; and transferring the recombinant expression vector into trichoderma reesei Tu6 by adopting a polyethylene glycol mediated protoplast transformation method, and obtaining the recombinant antibacterial peptide PmHis3 through screening a positive transformant and verifying and fermentation expression.
6. The use of the recombinant antibacterial peptide PmHis3 as claimed in claim 1, in the preparation of bacteriostatic or bactericidal agents, wherein said bacteria are staphylococcus aureus, candida albicans and pseudomonas aeruginosa.
7. The use of the recombinant antibacterial peptide PmHis3 of claim 1 in the preparation of feed and feed additives.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202310032181.5A CN115960187A (en) | 2023-01-10 | 2023-01-10 | Recombinant antibacterial peptide PmHis3, recombinant expression vector, engineering bacterium and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202310032181.5A CN115960187A (en) | 2023-01-10 | 2023-01-10 | Recombinant antibacterial peptide PmHis3, recombinant expression vector, engineering bacterium and application thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN115960187A true CN115960187A (en) | 2023-04-14 |
Family
ID=87363789
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202310032181.5A Pending CN115960187A (en) | 2023-01-10 | 2023-01-10 | Recombinant antibacterial peptide PmHis3, recombinant expression vector, engineering bacterium and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN115960187A (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101189256A (en) * | 2005-06-06 | 2008-05-28 | 诺维信公司 | Polypeptides having antimicrobial activity and polynucleotides encoding same |
| CN113831395A (en) * | 2021-11-26 | 2021-12-24 | 中国海洋大学 | Recombinant antibacterial peptide Trsub, preparation method and application thereof |
-
2023
- 2023-01-10 CN CN202310032181.5A patent/CN115960187A/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101189256A (en) * | 2005-06-06 | 2008-05-28 | 诺维信公司 | Polypeptides having antimicrobial activity and polynucleotides encoding same |
| CN113831395A (en) * | 2021-11-26 | 2021-12-24 | 中国海洋大学 | Recombinant antibacterial peptide Trsub, preparation method and application thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230329283A1 (en) | Recombinant antibacterial peptide trsub, preparation method and application for same | |
| CN103937830B (en) | A kind of recombinant bacterium of efficient secretory expression Nattokinase | |
| CN101173260B (en) | Representation of high disinfection vitality T4 lysozyme in yeast and producing method thereof | |
| CN115124604B (en) | Recombinant antibacterial peptide E-EJ97, recombinant expression vector, engineering bacteria and application thereof | |
| CN105985968A (en) | Improved broad-spectrum endonuclease and industrial production method thereof | |
| CN111420037B (en) | Application of phage lyase Lysep3 in preparation of broad-spectrum antibacterial drugs | |
| CN110117602A (en) | Grifola frondosus UDP-glucose pyrophosphorylase and its application | |
| CN112695054A (en) | Construction method and application of high-expression chitinase endophytic fungus Liquidambaris phomopsis | |
| CN104278017A (en) | Recombinant expression method of human lysozyme | |
| CN107475222A (en) | The heat-resisting human lysozyme of genetic engineering transformation | |
| CN115960187A (en) | Recombinant antibacterial peptide PmHis3, recombinant expression vector, engineering bacterium and application thereof | |
| CN113736762B (en) | alpha-L-rhamnosidase mutant and application thereof in preparation of pullulan | |
| CN104004729B (en) | The Aspergillus niger strain of a kind of ��-amylase Producer and application thereof | |
| CN105753958B (en) | A kind of Novel fish derived antimicrobial peptide mutant and its preparation method and application | |
| CN101691397B (en) | Nisin mutant protein, code gene thereof and application thereof | |
| CN116023450B (en) | Recombinant antibacterial peptide PmHis, recombinant expression vector, engineering bacteria and application thereof | |
| CN108948210B (en) | Hybrid antibacterial peptide PA-MO and preparation method and application thereof | |
| CN108103050A (en) | A kind of Pseudomonas aeruginosa phage lyases, its encoding gene, recombinant expression carrier and its preparation method and application | |
| CN105062906B (en) | A kind of production method optimizing organophosphor hydrolytic enzyme Yeast engineering bacteria and its enzyme | |
| CN104480056B (en) | A kind of genetic engineering bacterium of high-yield extracellular polysaccharide and its preparation method and application | |
| CN103045629A (en) | Lactase glucose depression knockout vector pMD19/HPT | |
| CN108771028B (en) | Animal feed additive and preparation method and application thereof | |
| CN106519022A (en) | Recombinant bovine lactoferricin derived peptide, and preparation method and applications thereof | |
| CN106336452A (en) | Group of NZ2114 histidine mutants, and preparation method thereof | |
| CN110845586A (en) | Secretory type grignard cyclic peptide and preparation method thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination |