CN115925925A - Method for inducing differentiation of umbilical cord mesenchymal stem cells and producing cell factors - Google Patents
Method for inducing differentiation of umbilical cord mesenchymal stem cells and producing cell factors Download PDFInfo
- Publication number
- CN115925925A CN115925925A CN202211009917.9A CN202211009917A CN115925925A CN 115925925 A CN115925925 A CN 115925925A CN 202211009917 A CN202211009917 A CN 202211009917A CN 115925925 A CN115925925 A CN 115925925A
- Authority
- CN
- China
- Prior art keywords
- wnt
- cells
- monoclonal antibody
- mug
- volume fraction
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 210000004027 cell Anatomy 0.000 title claims abstract description 70
- 210000002901 mesenchymal stem cell Anatomy 0.000 title claims abstract description 24
- 210000003954 umbilical cord Anatomy 0.000 title claims abstract description 18
- 230000004069 differentiation Effects 0.000 title claims abstract description 16
- 238000000034 method Methods 0.000 title abstract description 16
- 230000001939 inductive effect Effects 0.000 title abstract description 6
- 102000052547 Wnt-1 Human genes 0.000 claims abstract description 28
- 108700020987 Wnt-1 Proteins 0.000 claims abstract description 28
- 102000004127 Cytokines Human genes 0.000 claims abstract description 26
- 108090000695 Cytokines Proteins 0.000 claims abstract description 26
- 230000000694 effects Effects 0.000 claims abstract description 21
- 101100156752 Caenorhabditis elegans cwn-1 gene Proteins 0.000 claims abstract description 20
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 9
- 102000015735 Beta-catenin Human genes 0.000 claims abstract description 6
- 108060000903 Beta-catenin Proteins 0.000 claims abstract description 6
- 230000037361 pathway Effects 0.000 claims abstract description 6
- 239000003814 drug Substances 0.000 claims abstract description 4
- 238000012258 culturing Methods 0.000 claims description 17
- 239000002609 medium Substances 0.000 claims description 13
- 239000000203 mixture Substances 0.000 claims description 12
- 108091003079 Bovine Serum Albumin Proteins 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 238000002360 preparation method Methods 0.000 claims description 9
- 102000003745 Hepatocyte Growth Factor Human genes 0.000 claims description 6
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 claims description 6
- 239000012091 fetal bovine serum Substances 0.000 claims description 6
- 239000012894 fetal calf serum Substances 0.000 claims description 5
- 229920006395 saturated elastomer Polymers 0.000 claims description 5
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 claims description 4
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 claims description 4
- 238000004108 freeze drying Methods 0.000 claims description 4
- 239000001963 growth medium Substances 0.000 claims description 4
- 102000009024 Epidermal Growth Factor Human genes 0.000 claims description 3
- 101800003838 Epidermal growth factor Proteins 0.000 claims description 3
- 101001060274 Homo sapiens Fibroblast growth factor 4 Proteins 0.000 claims description 3
- DFPAKSUCGFBDDF-UHFFFAOYSA-N Nicotinamide Chemical compound NC(=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-UHFFFAOYSA-N 0.000 claims description 3
- 239000003795 chemical substances by application Substances 0.000 claims description 3
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 claims description 3
- 229960003957 dexamethasone Drugs 0.000 claims description 3
- 229940116977 epidermal growth factor Drugs 0.000 claims description 3
- 102000057231 human FGF4 Human genes 0.000 claims description 3
- 229960003966 nicotinamide Drugs 0.000 claims description 3
- 235000005152 nicotinamide Nutrition 0.000 claims description 3
- 239000011570 nicotinamide Substances 0.000 claims description 3
- 230000001737 promoting effect Effects 0.000 claims description 3
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 claims description 3
- 102000018233 Fibroblast Growth Factor Human genes 0.000 claims description 2
- 108050007372 Fibroblast Growth Factor Proteins 0.000 claims description 2
- 102000004140 Oncostatin M Human genes 0.000 claims description 2
- 108090000630 Oncostatin M Proteins 0.000 claims description 2
- 229940126864 fibroblast growth factor Drugs 0.000 claims description 2
- 239000007788 liquid Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 3
- 230000004071 biological effect Effects 0.000 abstract description 3
- 102000004889 Interleukin-6 Human genes 0.000 description 23
- 108090001005 Interleukin-6 Proteins 0.000 description 23
- 229940100601 interleukin-6 Drugs 0.000 description 13
- 230000006698 induction Effects 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 8
- 230000014509 gene expression Effects 0.000 description 8
- 230000035755 proliferation Effects 0.000 description 8
- 230000012010 growth Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 5
- 239000003102 growth factor Substances 0.000 description 5
- 235000018102 proteins Nutrition 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 108010050904 Interferons Proteins 0.000 description 4
- 102000014150 Interferons Human genes 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 229940024606 amino acid Drugs 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 229940047124 interferons Drugs 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 102000015696 Interleukins Human genes 0.000 description 3
- 108010063738 Interleukins Proteins 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- 102100034593 Tripartite motif-containing protein 26 Human genes 0.000 description 3
- 230000033077 cellular process Effects 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 229940047122 interleukins Drugs 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 239000002504 physiological saline solution Substances 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 210000001626 skin fibroblast Anatomy 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 3
- 238000000108 ultra-filtration Methods 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 102100037241 Endoglin Human genes 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 2
- 101000881679 Homo sapiens Endoglin Proteins 0.000 description 2
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 2
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000800116 Homo sapiens Thy-1 membrane glycoprotein Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 108010019160 Pancreatin Proteins 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 102100033523 Thy-1 membrane glycoprotein Human genes 0.000 description 2
- 102000001742 Tumor Suppressor Proteins Human genes 0.000 description 2
- 108010040002 Tumor Suppressor Proteins Proteins 0.000 description 2
- 102000052556 Wnt-2 Human genes 0.000 description 2
- 108700020986 Wnt-2 Proteins 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 229940069078 citric acid / sodium citrate Drugs 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- -1 coatings Substances 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- 230000007123 defense Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 102000052611 human IL6 Human genes 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 238000013394 immunophenotyping Methods 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 108040006858 interleukin-6 receptor activity proteins Proteins 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 229940055695 pancreatin Drugs 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 229910000160 potassium phosphate Inorganic materials 0.000 description 2
- 235000011009 potassium phosphates Nutrition 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 239000004017 serum-free culture medium Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- QZNNVYOVQUKYSC-JEDNCBNOSA-N (2s)-2-amino-3-(1h-imidazol-5-yl)propanoic acid;hydron;chloride Chemical compound Cl.OC(=O)[C@@H](N)CC1=CN=CN1 QZNNVYOVQUKYSC-JEDNCBNOSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- IVLXQGJVBGMLRR-UHFFFAOYSA-N 2-aminoacetic acid;hydron;chloride Chemical compound Cl.NCC(O)=O IVLXQGJVBGMLRR-UHFFFAOYSA-N 0.000 description 1
- HTCSFFGLRQDZDE-UHFFFAOYSA-N 2-azaniumyl-2-phenylpropanoate Chemical compound OC(=O)C(N)(C)C1=CC=CC=C1 HTCSFFGLRQDZDE-UHFFFAOYSA-N 0.000 description 1
- 108010062271 Acute-Phase Proteins Proteins 0.000 description 1
- 102000011767 Acute-Phase Proteins Human genes 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 101000693922 Bos taurus Albumin Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 101100264044 Caenorhabditis elegans cwn-2 gene Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102000027587 GPCRs class F Human genes 0.000 description 1
- 108091008884 GPCRs class F Proteins 0.000 description 1
- 101150112014 Gapdh gene Proteins 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 101001002466 Homo sapiens Interferon lambda-3 Proteins 0.000 description 1
- 101001002634 Homo sapiens Interleukin-1 alpha Proteins 0.000 description 1
- 101001033249 Homo sapiens Interleukin-1 beta Proteins 0.000 description 1
- 101001076407 Homo sapiens Interleukin-1 receptor antagonist protein Proteins 0.000 description 1
- 101000852965 Homo sapiens Interleukin-1 receptor-like 2 Proteins 0.000 description 1
- 101001010600 Homo sapiens Interleukin-12 subunit alpha Proteins 0.000 description 1
- 101001003140 Homo sapiens Interleukin-15 receptor subunit alpha Proteins 0.000 description 1
- 101001019598 Homo sapiens Interleukin-17 receptor A Proteins 0.000 description 1
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 description 1
- 101000998181 Homo sapiens Interleukin-17B Proteins 0.000 description 1
- 101000998151 Homo sapiens Interleukin-17F Proteins 0.000 description 1
- 101000960946 Homo sapiens Interleukin-19 Proteins 0.000 description 1
- 101001010591 Homo sapiens Interleukin-20 Proteins 0.000 description 1
- 101001044893 Homo sapiens Interleukin-20 receptor subunit alpha Proteins 0.000 description 1
- 101001010626 Homo sapiens Interleukin-22 Proteins 0.000 description 1
- 101000853012 Homo sapiens Interleukin-23 receptor Proteins 0.000 description 1
- 101001033279 Homo sapiens Interleukin-3 Proteins 0.000 description 1
- 101001043821 Homo sapiens Interleukin-31 Proteins 0.000 description 1
- 101000998140 Homo sapiens Interleukin-36 alpha Proteins 0.000 description 1
- 101000998126 Homo sapiens Interleukin-36 beta Proteins 0.000 description 1
- 101000998124 Homo sapiens Interleukin-36 gamma Proteins 0.000 description 1
- 101001040964 Homo sapiens Interleukin-36 receptor antagonist protein Proteins 0.000 description 1
- 101000998122 Homo sapiens Interleukin-37 Proteins 0.000 description 1
- 101001033312 Homo sapiens Interleukin-4 receptor subunit alpha Proteins 0.000 description 1
- 101001055222 Homo sapiens Interleukin-8 Proteins 0.000 description 1
- 102100020992 Interferon lambda-3 Human genes 0.000 description 1
- 102100020881 Interleukin-1 alpha Human genes 0.000 description 1
- 102100039065 Interleukin-1 beta Human genes 0.000 description 1
- 102100026018 Interleukin-1 receptor antagonist protein Human genes 0.000 description 1
- 102100036697 Interleukin-1 receptor-like 2 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000177 Interleukin-11 Proteins 0.000 description 1
- 102000003815 Interleukin-11 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 102100030698 Interleukin-12 subunit alpha Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 102100020789 Interleukin-15 receptor subunit alpha Human genes 0.000 description 1
- 101800003050 Interleukin-16 Proteins 0.000 description 1
- 102000049772 Interleukin-16 Human genes 0.000 description 1
- 102100035018 Interleukin-17 receptor A Human genes 0.000 description 1
- 102100033461 Interleukin-17A Human genes 0.000 description 1
- 102100033101 Interleukin-17B Human genes 0.000 description 1
- 102100033454 Interleukin-17F Human genes 0.000 description 1
- 102000003810 Interleukin-18 Human genes 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 102100039879 Interleukin-19 Human genes 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102100030692 Interleukin-20 Human genes 0.000 description 1
- 102100022706 Interleukin-20 receptor subunit alpha Human genes 0.000 description 1
- 102100030704 Interleukin-21 Human genes 0.000 description 1
- 102100030703 Interleukin-22 Human genes 0.000 description 1
- 108010065637 Interleukin-23 Proteins 0.000 description 1
- 102000013264 Interleukin-23 Human genes 0.000 description 1
- 102100036672 Interleukin-23 receptor Human genes 0.000 description 1
- 102100039064 Interleukin-3 Human genes 0.000 description 1
- 102100021596 Interleukin-31 Human genes 0.000 description 1
- 108010067003 Interleukin-33 Proteins 0.000 description 1
- 102000017761 Interleukin-33 Human genes 0.000 description 1
- 102100033474 Interleukin-36 alpha Human genes 0.000 description 1
- 102100033498 Interleukin-36 beta Human genes 0.000 description 1
- 102100033503 Interleukin-36 gamma Human genes 0.000 description 1
- 102100021150 Interleukin-36 receptor antagonist protein Human genes 0.000 description 1
- 102100033502 Interleukin-37 Human genes 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102100039078 Interleukin-4 receptor subunit alpha Human genes 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102100026236 Interleukin-8 Human genes 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010087230 Sincalide Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 101150019524 WNT2 gene Proteins 0.000 description 1
- 102000013814 Wnt Human genes 0.000 description 1
- 108050003627 Wnt Proteins 0.000 description 1
- RRNJROHIFSLGRA-JEDNCBNOSA-N acetic acid;(2s)-2,6-diaminohexanoic acid Chemical compound CC(O)=O.NCCCC[C@H](N)C(O)=O RRNJROHIFSLGRA-JEDNCBNOSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 210000001691 amnion Anatomy 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 230000000181 anti-adherent effect Effects 0.000 description 1
- 239000003911 antiadherent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229960003121 arginine Drugs 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000008568 cell cell communication Effects 0.000 description 1
- 238000010609 cell counting kit-8 assay Methods 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000009087 cell motility Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 229940049906 glutamate Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000035990 intercellular signaling Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 229960003646 lysine Drugs 0.000 description 1
- 229960005357 lysine acetate Drugs 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 235000013930 proline Nutrition 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000012465 retentate Substances 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000010008 shearing Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 102000034285 signal transducing proteins Human genes 0.000 description 1
- 108091006024 signal transducing proteins Proteins 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- HELHAJAZNSDZJO-OLXYHTOASA-L sodium L-tartrate Chemical compound [Na+].[Na+].[O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O HELHAJAZNSDZJO-OLXYHTOASA-L 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229940074404 sodium succinate Drugs 0.000 description 1
- ZDQYSKICYIVCPN-UHFFFAOYSA-L sodium succinate (anhydrous) Chemical compound [Na+].[Na+].[O-]C(=O)CCC([O-])=O ZDQYSKICYIVCPN-UHFFFAOYSA-L 0.000 description 1
- 239000001433 sodium tartrate Substances 0.000 description 1
- 229960002167 sodium tartrate Drugs 0.000 description 1
- 235000011004 sodium tartrates Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000003270 steroid hormone Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 235000008521 threonine Nutrition 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Landscapes
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention relates to a method for inducing differentiation of umbilical cord mesenchymal stem cells and producing cell factors. The monoclonal antibody for specifically inhibiting the activity of Wnt-1 in a Wnt 1/beta-catenin pathway is prepared, the antibody can promote umbilical cord mesenchymal stem cells to be differentiated into liver-like cells, the differentiated liver-like cells can highly express cytokines rich in IL6, and the cytokines have good biological activity, can be used for preparing corresponding medicaments, and have wide application prospects.
Description
Technical Field
The application relates to the field of biology, in particular to a method for inducing differentiation of umbilical cord mesenchymal stem cells and producing cytokines.
Background
Cytokines are a large class of proteins that are important for intercellular signaling. They are produced by a variety of cells, including stem cells, immune cells such as macrophages, B lymphocytes, T lymphocytes, and mast cells, as well as endothelial cells, fibroblasts, and various stromal cells. The release of cytokines will have an effect on the surrounding cellular activities. Cytokines may include interleukins, interferons, growth factors, tumor necrosis factors, chemokines and colony stimulating factors.
Interleukins (Interleukins), also referred to simply as ILs, are cytokines that play important roles in regulating cellular processes (cell growth, differentiation and movement) and stimulating immune responses. Originally found in leukocytes, they have now been found to be produced by a wide variety of cells, including macrophages, lymphocytes, and the like, which have a solid structure and function. Mainly includes CXCL8, IFNL3, IL10, IL11, IL12, IL12A, IL13, IL15, IL15RA, IL16, IL17A, IL17B, IL17F, IL17RA, IL18, IL19, IL1A, IL1B, IL1RL2, IL1RN, IL2, IL20, IL20RA, IL21, IL22, IL23, IL23R, IL3, IL31, IL33, IL36A, IL36B, IL36G, IL36RN, IL37, IL4, IL4R, IL5, IL6, IL7, IL9, etc. Interferons (interferons), abbreviated IFNs, are known for their ability to protect cells from viral infection by "interfering" with viral replication because host cells produce and release a set of signal proteins against a variety of existing viruses. Interferons belong to a large class of cytokine proteins used in the communication between cells to trigger protective defenses of the immune system to eliminate pathogens. Growth factors also belong to a protein or steroid hormone, are naturally occurring substances that stimulate cell growth, differentiation, survival, inflammation and tissue repair. Growth factors play an important role in regulating diverse cellular processes and may be secreted by neighboring cells, distant tissues and glands, and even by tumor cells themselves. Normal cells maintain proliferation and viability by exhibiting a need for several growth factors. Growth factors may exert their stimulatory effects through endocrine, paracrine, or autocrine mechanisms.
There are many methods for cytokine production. For example, CN106520689A provides a method for preparing mesenchymal stem cell cytokine, which comprises the following steps: extracting mesenchymal stem cells; culturing; continuing culturing under a low-oxygen condition; digesting with 0.25% pancreatin EDTA solution; centrifuging, and washing with 0.9% physiological saline; adjusting the cell concentration by using 0.9% physiological saline, and then adding 1 3mg/mL of EDTA and 5 10mg/mL of Vc; freezing and thawing; centrifuging and filtering. However, the method is not directed to high production of the cytokine IL-6.
CN106367389A discloses a preparation method of human umbilical cord mesenchymal stem cell factor, which comprises two steps of primary separation and culture of human umbilical cord mesenchymal stem cells, preparation of freeze-dried powder and activity detection, wherein the cell factor is prepared by centrifuging, incubating, secondary centrifuging and ultrafiltration concentrating cells in P20 generation in a culture bottle to obtain factor concentrated solution, and IL-6 is not highly expressed in the same obtained cell factor. CN105543313A discloses a method for separating and purifying human mesenchymal stem cell factor, which comprises the steps of obtaining cell culture supernatant: taking human mesenchymal stem cells, placing the human mesenchymal stem cells in a mesenchymal stem cell serum-free culture medium for culture, collecting supernatant when the cells grow to reach 75-85% of confluence degree, filtering and concentrating: filtering the supernatant with 0.22 μm filter membrane; and then passing through a 50KD ultrafiltration membrane to collect dialysate, and then passing the dialysate through a 1KD ultrafiltration membrane to collect retentate to obtain cytokine concentrate. The method also produces less IL-6 during the manufacturing process.
Interleukin 6 (IL-6) is the most typical cytokine associated with inflammation. It plays an important role in host defense by modulating immune and inflammatory responses. IL-6 is a small glycoprotein with a molecular weight of 19-28kDa, which forms four alpha helical structures from 184 amino acids, usually in monomeric form, and has an isoelectric point of 5.0. The gene encoding human IL-6 is located on chromosome 7p15-21 and includes 4 introns and 5 exons. IL-6 has 3 receptor binding sites, including 1 specific receptor IL-6R (IL-6R) binding site, and 2 gp130 (signal-transducing protein) binding sites. IL-6 is also a cytokine with pleiotropic activity, and can promote proliferation and differentiation of various cells, accelerate synthesis of acute phase protein of liver cells, inhibit growth of M1 myeloid leukemia cell line, promote maturation and differentiation thereof, and inhibit growth of melanoma and breast cancer cells. Therefore, the efficient production of IL-6 cytokines is an urgent direction of research.
Disclosure of Invention
The present invention provides a method for efficiently producing IL-6 and other cytokines.
In particular, the invention provides a method for producing a cytokine cocktail comprising IL-6 cytokines.
Wnt-1 protein is a secreted glycoprotein composed of 343 amino acids, and most of them act through cell surface Frizzled family receptors, which are essential in the normal development of embryos. Wnt-1 activation leads to a complex cascade of signaling reactions that ultimately leads to the upregulation of multiple gene expression. Wnt-1 is involved in a variety of cellular processes in the human body and affects the normal function of certain systems. Wnt-1 is the most important regulatory protein in the Wnt 1/beta-catenin pathway. By inhibiting the activity of the Wnt-1, the Wnt 1/beta-catenin pathway can be inhibited on the whole.
In one aspect, the invention provides a monoclonal antibody that inhibits the activity of Wnt-1.
The monoclonal antibody for inhibiting the activity of Wnt-1 is Wnt-1-13F, and a light chain variable region VL amino acid sequence:
QIVLSQSPAILSASPGEKVTMTCNTEYRGARGSWYQQKPGSSPKPWIYPWEHQTHGVPFRFSGSGSGTSYSLTISRVEAEDAATYYCIASYMILFLFGGGTKLEIK
heavy chain variable region VH amino acid sequence:
QVKLQESGGGLVQPKGSLKLSCAASGFSFYFIPYPWVRQAPGKGLEWVAVTTVIMWDGPDEWDENLCRRFTISRDDSQSMLYLQMHNLKTDDTAMYYCVRITESAWAIVEFAFWGAGTTVTVSS
the light chain variable region and the heavy chain variable region of the antibody are respectively as follows:
LCDR1 | NTEYRGARGS |
LCDR2 | PWEHQTH |
LCDR3 | IASYMILFL |
HCDR1 | FIPYP |
HCDR2 | VTTVIMWDGPDEWDENLCR |
HCDR3 | ITESAWAIVEFAF |
further, the invention also provides application of the monoclonal antibody for inhibiting the activity of Wnt-1 in preparing a reagent for promoting the differentiation of umbilical cord mesenchymal stem cells into liver-like cells.
Further, the differentiation reagent comprises a three-stage reagent composition, and the three-stage reagent is used in the conditions of inducing the differentiation of the umbilical cord mesenchymal stem cells, wherein the conditions are as follows: culturing umbilical cord mesenchymal stem cells at the current stage 1, namely culturing DMEM-LG +20 mu g/L epidermal growth factor +10 mu g/L basic fibroblast growth factor for 3d; then stage 2 culture, namely DMEM-LG + 1% fetal calf serum with the volume fraction of 20 mu g/L hepatocyte growth factor +10 mu g/L alkaline fibroblast growth factor +0.61g/L niacinamide +10 mu g/L Wnt-1-13F monoclonal antibody, culturing for 6 days, and changing the liquid for 1 time every 3 days; final stage 3 culture: contains fetal calf serum with volume fraction of 5%, human fibroblast growth factor 4 with volume fraction of 10 mug/L, hepatocyte growth factor with volume fraction of 10 mug/L, recombinant oncostatin M with volume fraction of 10 mug/L, wnt-1-13F monoclonal antibody with volume fraction of 10 mug/L, and 10 Wnt-1-13F monoclonal antibody with volume fraction of 10 mug/L -7 And (5) culturing the liver-like cells after differentiation for 10 days by using a HBM culture medium containing mol/L dexamethasone.
Further, the present invention provides a method for producing an IL 6-rich cytokine using the differentiated hepatocyte-like cells.
The production method comprises a cell culture method which is conventional in the field, and the cell factor can be obtained by collecting supernatant.
Further, the production method may be such that the density of the liver-like cells induced to differentiate by the monoclonal antibody is inoculated with an α -MEM medium containing 10% fetal bovine serum, the medium is incubated at 37 ℃ with 5% CO 2 Culturing in a saturated humidity incubator for 5d, centrifuging at 4 ℃ and 1500rpm for 5min to remove cells, and freeze-drying the supernatant to obtain the cytokine composition, and storing at-20 ℃.
Furthermore, the invention also provides application of the prepared cytokine rich in IL6 in preparing medicaments for promoting fibroblast proliferation and treating related diseases such as cancer.
Furthermore, the cell factor prepared by the invention can be used for preparing cell factor preparations, cosmetics and the like.
The pharmaceutical composition of the invention further comprises a buffer, which may be selected from the group consisting of: potassium phosphate, acetic acid/sodium acetate, citric acid/sodium citrate, succinic acid/sodium succinate, tartaric acid/sodium tartrate, histidine/histidine HCl, glycine, tris, glutamate, acetate and mixtures thereof, and is in particular selected from the group consisting of potassium phosphate, citric acid/sodium citrate, succinic acid, histidine, glutamate, acetate and combinations thereof.
The pharmaceutical compositions may optionally comprise one or more additional excipients, as long as they do not reduce or eliminate their advantageous properties as described herein, in particular their stability.
Excipients can be used in the present invention for a wide variety of purposes, such as to adjust the physical, chemical, or biological properties of the formulation (such as to adjust viscosity) and/or the methods of the present invention to further improve effectiveness and/or to further stabilize the formulation and method against degradation and spoilage due to, for example, stresses generated during manufacture, shipping, storage, preparation prior to use, during application, and thereafter. The term "excipient" generally includes fillers, binders, disintegrants, coatings, adsorbents, anti-adherents, glidants, preservatives, antioxidants, flavoring agents, colorants, sweeteners, solvents, co-solvents, buffers, chelating agents, viscosity imparting agents, surfactants, diluents, wetting agents, carriers, diluents, preservatives, emulsifiers, stabilizers, and tonicity adjusting agents.
Acceptable excipients are preferably pharmaceutically acceptable, including but not limited to: amino acids such as glycine, alanine, glutamine, asparagine, threonine, proline, 2-phenylalanine include charged amino acids, preferably lysine, lysine acetate, arginine, glutamate and/or histidine.
Further, the primary vehicle or carrier in the pharmaceutical composition may be aqueous or non-aqueous in nature. Suitable vehicles or carriers may be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other substances common in compositions for parenteral administration. Neutral buffered saline or saline mixed with serum albumin are other exemplary vehicles.
Advantageous effects
The monoclonal antibody for specifically inhibiting the activity of Wnt-1 in a Wnt 1/beta-catenin pathway is prepared, the antibody can promote umbilical cord mesenchymal stem cells to be differentiated into liver-like cells, the differentiated liver-like cells can highly express cytokines rich in IL6, and the cytokines have good biological activity, can be used for preparing corresponding medicaments, and have wide application prospects.
Drawings
FIG. 1 shows the result of phage clone ELISA assay
FIG. 2 is a graph showing the result of identifying the specificity of an antibody
FIG. 3 is a graph showing the effect of cytokines on the proliferation of human skin fibroblasts
Detailed Description
In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings used in the description of the embodiments or the prior art will be briefly described below, and it is obvious that the drawings in the following description are some embodiments of the present invention, and other drawings can be obtained by those skilled in the art without creative efforts.
EXAMPLE 1 preparation of Wnt-1 monoclonal antibody
Human recombinant Wnt-1 (Biovision, cat # 4754-50) was coated on an ELISA plate with 50mmol/L sodium bicarbonate (pH 10.0), PBS/2% milk was blocked and added to a phage library (synthesized by Wuhan Kingkurui bioengineering, inc., fab phage library), gently shaken at room temperature for 1h, washed 6 times with PBS/0.1% Tween, and the bound phage were eluted with an acidic eluent (0.1 mmol/LHCl-Gly, pH2.2,0.1% BSA), and the eluate was neutralized with 1mol/L Tris-HCl (pH 9.1) to measure titer, and amplified phage for the next round of screening. The screening is carried out for 3 rounds, the subsequent 2 rounds of screening process is the same as the first round, but the coating antigen amount is reduced, and the Tween concentration is gradually increased to 0.3 percent and 0.5 percent respectively. After 3 rounds of screening, the enrichment index of the finally enriched phage is 109, which indicates that the phage with high affinity to Wnt-1 has been successfully enriched.
42 positive clones obtained by 3 rounds of screening were selected, inoculated into 100. Mu.l of 2YT medium containing 100mg/LAmp, cultured at 37 ℃ until OD600= 0.3-0.4, infected with 25. Mu.l of helper phage, then added with 25. Mu.l of 2YT medium containing 300mg/L Kan, and cultured overnight at 37 ℃. And (3) carrying out specificity identification on each enriched phage clone by adopting an ELISA method, coating human recombinant Wnt-1 100ng in each hole, adding 100 mu l of phage, and developing through an HRP-labeled mouse anti-M13 phage antibody. The blank was zeroed and the absorbance at A450nm was measured with a microplate reader (Multiskan Spectrum microplate thermo 1500). The positive standard was a P/N value (positive/negative) >2.0 and the negative standard was a P/N value <0.5. The results are shown in FIG. 1.
As can be seen from the results in FIG. 1, the 2 mAbs with the best positive effects were Wnt-1-15C and Wnt-1-13F, respectively.
For Wnt-1-13F, the primers were used with 5' ends: aagacaggctatcgatt and 3' end primer: GCCCCCTATTAGCGTTT amplifies Fab gene fragments, and PCR conditions are as follows: 5min at 94 ℃; 15s at 94 ℃, 30s at 50 ℃, 2min at 72 ℃ and 30 cycles; 10min at 72 ℃. The product is sent to Shanghai Biotechnology Limited company for antibody variable region gene sequence determination, and the sequencing result is searched and analyzed by DNAMAN and database. The amino acid sequence of the variable region of the light chain of the coding Wnt-1-13F monoclonal antibody and the amino acid sequence of the variable region of the heavy chain of the coding Wnt-1-13F monoclonal antibody are obtained by sequence comparison, wherein the sequence of the variable region of the heavy chain is shown as SEQ ID NO.1, and the sequence of the variable region of the light chain is shown as SEQ ID NO. 2.
Obtaining an expression Fab antibody by soluble separation in HB2151 bacteria, inducing expression overnight by 0.5mol/L IPTG at low temperature, obtaining soluble Wnt-1-13F monoclonal antibody from bacteria periplasm cavity by osmotic shock method, purifying by nickel column to obtain purified monoclonal antibody, and adjusting the concentration of the monoclonal antibody to 1mg/mL for standby.
Example 2 identification of affinity and specificity of Wnt-1-13F monoclonal antibodies
The binding capacity of the Wnt-1-13F antibody to the Wnt-1 protein is analyzed by applying an SPR technology: wnt-1 protein was coupled to a CM5 sensor chip and injected with Wnt-1-13F mab at 6 different concentrations in the range of 1-100 nM, at a flow rate of 45 μ L/min in all experiments. The regeneration conditions of the chip are glycine-HCl pH1.5. The kinetic parameters KD were calculated using binding curves obtained at different antibody concentrations. By calculation, the results of table 1 were obtained.
TABLE 1 affinity of Wnt-1-13F monoclonal antibodies
Name of antibody | KD(M) |
Wnt-1-13F monoclonal antibody | 2.19E-09 |
As can be seen from the results in Table 1, the affinity KD of the Wnt-1-13F antibody prepared by the present invention for antigen was 2.19X 10 -9 M, has better affinity.
And (3) specific identification: the purified Wnt-1-13F monoclonal antibody is subjected to specificity analysis by an ELISA method, each hole is coated with 100ng of human recombinant Wnt-1 protein, wnt-2 protein and BSA, the Wnt-1-13F monoclonal antibody which is diluted in a gradient manner is added, and the mouse anti-Flag antibody marked by HRP is developed. The results are shown in FIG. 2.
The ELISA plate is coated with Wnt-1 protein and control protein (Wnt-2 and BSA), and the analysis result shows that the Wnt-1-13F monoclonal antibody can be specifically combined with the Wnt-1 protein and not combined with other unrelated proteins (figure 2), and the better specificity is shown.
Example 3 preparation and differentiation Induction of umbilical cord mesenchymal Stem cells
The fresh umbilical cord is placed in a culture dish, and the amnion and the blood vessel are removed. Shearing the separated umbilical cord to about 1mm by using an ophthalmic scissors 3 The tissue blocks of the size were taken in appropriate amounts and placed in sterile petri dishes, covering the bottom of 75% of the petri dishes. Adding serum-free culture medium of mesenchymal stem cells, shaking for 1min to disperse tissue mass, and adding 5% CO 2 Culturing in an incubator at 37 ℃. On day 5, the medium was changed by half, and the culture was continued for about 14 days, and when the cell mass was grown to about 50%, the tissue mass was removed, and at the same time, the cells were collected for subculture. Changing the culture solution once every 3 days, observing the growth change of the cells by using an inverted microscope, carrying out digestion passage when the adherent cells grow to 90% of the bottom of the bottle, adding 0.05% of pancreatin for digestion, carrying out passage according to the proportion of 1. Viable cell density of 5X 10 in serum-free DMEM medium up to passage 3 6 Cell suspension per mL for detection.
The UC-MSCs immunophenotyping is to measure the expression of CD90, CD45, CD105, CD34 and HIA-DR on the surface of the UC-MSCs by a flow cytometer. The results are shown in Table 2.
TABLE 2 mesenchymal stem cell immunophenotyping
As can be seen from the results in Table 2, CD90 and CD105 are positive, the positive rate is more than 98%, while CD34, CD45 and HLA-DR are negative, the positive rate is less than 2%, which indicates that the umbilical cord mesenchymal stem cells are obtained by separation and preparation.
The hUC-MSCs with good growth state of the 4 th generation are selected to be 5 multiplied by 10 per hole 4 Cells were uniformly seeded in 6-well plates and when cells grew to 80% confluency, they were cultured in the following order. Stage 1, culturing DMEM-LG +20 mug/L epidermal growth factor +10 mug/L basic fibroblast growth factor for 3 days; stage 2 culture with DMEM-LG + volume fraction of 1% fetal bovine serum +20 μ g/L hepatocyte growth factor
+ 10. Mu.g/L of basic fibroblast growth factor +0.61g/L of niacinamide + 10. Mu.g/L of Wnt-1-13F monoclonal antibody, culturing for 6 days, and changing the solution 1 time every 3 days;
The cells after induction were digested with 0.25% trypsin and collected, respectively, total RNA was extracted with the kit, and cDNA was synthesized using the reverse transcription kit. SYBR slide Master Mix was chosen for the fluorescent quantitative PCR detection, 1. Mu.L of cDNA template was added with 0.5. Mu.L of each primer, 10. Mu.L of reaction system was used, GAPDH gene was chosen as internal reference, and the experimental conditions were 95 ℃ 10min,58 ℃ 2 s,72 ℃ 30s, 40 cycles in total. The specific primer is an AFP upstream primer: GCTGGTGGTGGATGAAAACA, downstream primer TCCTCTGTTATTTGTGGCTTTTG; IL-6 upstream primer:
aaattcggttacatcctcgac, downstream primer: CAGGAACTGGATCAGGACTT; GAPDH is used as an internal reference gene, and an upstream primer: AGCCACATCGCTCAGACAC; a downstream primer: GCCCAATACGACCAAAATCC. The results are shown in table 3 below.
TABLE 3 expression of IL-6 and AFP genes in each group
As can be seen from the results in table 3, the mRNA expression levels of AFP and IL-6 were significantly higher in the induced group than in the control group (. P < 0.05), and after induction, the umbilical cord mesenchymal stem cell phenotype differentiated into liver-like cells, and the differentiated cells had the high expression characteristic of hepatocyte marker AFP, indicating that the induction of differentiation was successful. After the monoclonal antibody is added, the differentiation and maturation of the hUC-MSCs to the liver-like cells are further promoted after the Wnt/p-catenin signal channel is competitively inhibited. And, unexpectedly, the differentiated mature liver-like cells have the characteristic of high expression of the cytokine IL-6.
EXAMPLE 4 production of cytokine composition containing human IL6 by differentiated cells
The liver-like cells obtained in example 3 after the induction of differentiation with Wnt-1-13F monoclonal antibody were sampled at 5X 10 3 /cm 2 Inoculating 15mL of an alpha-MEM medium containing 10% fetal bovine serum at 37 ℃ and 5% of CO 2 Culturing in a saturated humidity incubator for 5 days, measuring cell density, centrifuging at 4 deg.C and 1500rpm for 5min to remove cells, and freeze drying the supernatant to obtain cytokine composition, and storing at-20 deg.C.
Taking the hUC-MSCs with good growth state of the 4 th generation as 5 multiplied by 10 3 /cm 2 The density of (A) was determined by inoculating 15mL of an alpha-MEM medium containing 10% fetal bovine serum, incubating the medium at 37 ℃ and 5% of CO 2 Culturing in a saturated humidity incubator for 5 days, measuring cell density, centrifuging at 4 deg.C and 1500rpm for 5min to remove cells, and freeze drying the supernatant to obtain cytokine composition, and storing at-20 deg.C.
And (3) measuring the secretion amount of the IL6 under the same cell density condition by using an ELISA detection kit. The results are shown in Table 4.
TABLE 4 secretion of IL6
Each group consisting of | IL6 secretion amount (pg/mL 1X 10) 5 Cell) |
Control group | 83.67±7.52 |
Wnt-1-13F monoclonal antibody enhanced induction group | 279.18±12.72* |
As can be seen from the results in Table 4, the cells obtained after the enhancement of induction with Wnt-1-13F monoclonal antibody were able to secrete IL-6 at high concentration, and the difference was significant (P) compared to the control group<0.01 At 1X 10) of 5 IL-6 can be isolated at a concentration of one cell that produces (279.18. + -. 12.72) pg/mL.
Example 5 cytokine Activity assay
Human skin fibroblast HFF-1 cells were cultured in 10% fetal bovine serum in DMEM/F12 medium, cultured routinely in a saturated humidity incubator at 37 ℃ and 5% CO2, and trypsinized and subcultured when the cells were 85% long. Taking HFF-1 cells in logarithmic growth phase, 1 × 10 per well 4 The individual cells were seeded in 96-well culture plates. After 12 hours, the cells were replaced with complete medium containing the final concentrations of 0. Mu.g/mL, 10. Mu.g/mL, 50. Mu.g/mL, and 100. Mu.g/mL of stem cell factor (prepared in example 4), and the complete medium containing 100. Mu.g/mL of stem cell factor (prepared in example 4 as a control) was used as an experimental control, and after further culturing for 48 hours, 20. Mu.L of 5mg/mL CCK-8 solution was added to each well, and incubation was continued at 37 ℃ for 4 hours in the absence of light, and then the culture medium was removed from each well, and 150. Mu.L of DMSO was added thereto, and the mixture was shaken and mixed well to dissolve it sufficiently. Detecting the absorbance OD value at the wavelength of 570nm by using a microplate reader, taking 0 mu g/mL as a blank control hole, and calculating according to the following formula: proliferation rate (%) = (OD assay well-OD blank control well)/OD blank control well × 100%. The results are shown in FIG. 3.
As can be seen from the results in fig. 3, the cytokine production induced by the monoclonal antibody of the present application has concentration dependency, and with the increase of the concentration, the proliferation of human skin fibroblasts can be significantly promoted (P <0.05 compared with the control group), and the dose dependency is presented. The cell factor of 100 mu g/mL prepared by using the cells induced by the monoclonal antibody can improve the proliferation activity of the HFF-1 cells to (264.1 +/-12.9)%, and the cell factor prepared by obtaining the cells without using the monoclonal antibody can improve the proliferation activity of the HFF-1 cells to (196.8 +/-10.5)%, which also indicates that the content and the activity of the cell factor can be obviously improved after the monoclonal antibody is used for induction.
It is to be understood that the invention is not necessarily limited in its application to the details of construction and the arrangement of components set forth in the following description and/or illustrated in the drawings. The invention is capable of embodiments in addition to those described and of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.
Claims (4)
1. A monoclonal antibody that inhibits the activity of Wnt-1 is Wnt-1-13F, whose light chain variable region VL amino acid sequence:
the monoclonal antibody for inhibiting the activity of Wnt-1 is Wnt-1-13F, and a light chain variable region VL amino acid sequence:
QIVLSQSPAILSASPGEKVTMTCNTEYRGARGSWYQQKPGSSPKPWIYPWEHQTHGVPFRFSGSGSGTSYSLTISRVEAEDAATYYCIASYMILFLFGGGTKLEIK
heavy chain variable region VH amino acid sequence:
QVKLQESGGGLVQPKGSLKLSCAASGFSFYFIPYPWVRQAPGKGLEWVAVTTVIMWDGPDEWDENLCRRFTISRDDSQSMLYLQMHNLKTDDTAMYYCVRITESAWAIVEFAFWGAGTTVTVSS。
2. the use of the monoclonal antibody Wnt-1-13F of claim 1 in the preparation of a medicament for inhibiting the activity of the Wnt1/β -catenin pathway by inhibiting the activity of the Wnt1/β -catenin pathway.
3. Use of the monoclonal antibody Wnt-1-13F inhibiting the activity of Wnt-1 according to claim 1 in the preparation of an agent for promoting differentiation of umbilical cord mesenchymal stem cells into liver-like cells.
4. A method for producing IL 6-rich cytokines with high yield comprises culturing umbilical cord mesenchymal stem cells in stage 1 with DMEM-LG +20 μ g/L epidermal growth factor +10 μ g/L basic fibroblast growth factor for 3d; then stage 2 culture, DMEM-LG + 1% fetal calf serum +20 mug/L hepatocyte growth factor +10 mug/L alkaline fibroblast growth factor +0.61g/L niacinamide +10 mug/L Wnt-1-13F monoclonal antibody by volume fraction, culture for 6 days, and changing the liquid 1 time every 3 days; final stage 3 culture: contains fetal calf serum with volume fraction of 5%, human fibroblast growth factor 4 with volume fraction of 10 mug/L, hepatocyte growth factor with volume fraction of 10 mug/L, recombinant oncostatin M with volume fraction of 10 mug/L, wnt-1-13F monoclonal antibody with volume fraction of 10 mug/L, and 10 Wnt-1-13F monoclonal antibody with volume fraction of 10 mug/L -7 Culturing the HBM culture medium containing mol/L dexamethasone for 10 days to obtain differentiated liver-like cells;
inoculating the hepatocyte-like cells into an alpha-MEM medium containing 10% fetal bovine serum, and incubating at 37 deg.C for 5% CO 2 Culturing in a saturated humidity incubator for 5d, centrifuging at the low temperature of 4 ℃ and 1500rpm for 5min to remove cells, and freeze-drying supernate to obtain a cytokine composition rich in IL 6; wherein Wnt-1-13F monoclonal antibody is the monoclonal antibody of claim 1.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211009917.9A CN115925925B (en) | 2022-08-23 | 2022-08-23 | Method for inducing umbilical cord mesenchymal stem cells to differentiate and producing cytokines |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202211009917.9A CN115925925B (en) | 2022-08-23 | 2022-08-23 | Method for inducing umbilical cord mesenchymal stem cells to differentiate and producing cytokines |
Publications (2)
Publication Number | Publication Date |
---|---|
CN115925925A true CN115925925A (en) | 2023-04-07 |
CN115925925B CN115925925B (en) | 2024-02-06 |
Family
ID=86556391
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202211009917.9A Active CN115925925B (en) | 2022-08-23 | 2022-08-23 | Method for inducing umbilical cord mesenchymal stem cells to differentiate and producing cytokines |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN115925925B (en) |
Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5780300A (en) * | 1995-09-29 | 1998-07-14 | Yale University | Manipulation of non-terminally differentiated cells using the notch pathway |
WO2000029575A1 (en) * | 1998-11-17 | 2000-05-25 | Zymogenetics, Inc. | Novel human wnt gene |
CN101300270A (en) * | 2005-11-30 | 2008-11-05 | 金政文 | Non-activated Wnt inhibition polypeptides and method for preparing the same |
CN102168065A (en) * | 2011-02-17 | 2011-08-31 | 暨南大学 | Method for inducing human umbilical cord mesenchymal stem cells in vitro into liver cells and application thereof |
CN102985441A (en) * | 2010-02-19 | 2013-03-20 | 俄克拉何马大学董事会 | Monoclonal antibodies that inhibit the Wnt signaling pathway and methods of production and use thereof |
WO2018107157A1 (en) * | 2016-12-11 | 2018-06-14 | Case Western Reserve Univeristy | Compositions and methods of modulating endochondral ossification and bone formation |
CN112430269A (en) * | 2021-01-28 | 2021-03-02 | 天津汉青生物科技有限公司 | Composition for promoting osteogenic differentiation of umbilical cord blood stem cells and application thereof |
CN113789296A (en) * | 2021-09-15 | 2021-12-14 | 淮安市第一人民医院 | Method for efficiently inducing human umbilical cord mesenchymal stem cells to differentiate into liver cells and application |
-
2022
- 2022-08-23 CN CN202211009917.9A patent/CN115925925B/en active Active
Patent Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5780300A (en) * | 1995-09-29 | 1998-07-14 | Yale University | Manipulation of non-terminally differentiated cells using the notch pathway |
WO2000029575A1 (en) * | 1998-11-17 | 2000-05-25 | Zymogenetics, Inc. | Novel human wnt gene |
CN101300270A (en) * | 2005-11-30 | 2008-11-05 | 金政文 | Non-activated Wnt inhibition polypeptides and method for preparing the same |
CN102985441A (en) * | 2010-02-19 | 2013-03-20 | 俄克拉何马大学董事会 | Monoclonal antibodies that inhibit the Wnt signaling pathway and methods of production and use thereof |
CN102168065A (en) * | 2011-02-17 | 2011-08-31 | 暨南大学 | Method for inducing human umbilical cord mesenchymal stem cells in vitro into liver cells and application thereof |
WO2018107157A1 (en) * | 2016-12-11 | 2018-06-14 | Case Western Reserve Univeristy | Compositions and methods of modulating endochondral ossification and bone formation |
CN112430269A (en) * | 2021-01-28 | 2021-03-02 | 天津汉青生物科技有限公司 | Composition for promoting osteogenic differentiation of umbilical cord blood stem cells and application thereof |
CN113789296A (en) * | 2021-09-15 | 2021-12-14 | 淮安市第一人民医院 | Method for efficiently inducing human umbilical cord mesenchymal stem cells to differentiate into liver cells and application |
Non-Patent Citations (1)
Title |
---|
MALYSHEVA K等: "Interleukin 6/Wnt interactions in rheumatoid arthritis: interleukin 6 inhibits Wnt signaling in synovial fibroblasts and osteoblasts", CROAT MED J, vol. 57, no. 02, pages 89 - 98 * |
Also Published As
Publication number | Publication date |
---|---|
CN115925925B (en) | 2024-02-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Zhao et al. | Th17 cells in inflammatory bowel disease: cytokines, plasticity, and therapies | |
KR101909879B1 (en) | Method and Composition for Proliferating of Natural Killer Cell | |
CN105008521A (en) | Methods modulating immunoregulatory effect of stem cells | |
US20210101953A1 (en) | Human Interleukin-2 and Anti-human Epithelial Cell Adhesion Molecule Single-Chain Antibody Fusion Protein and Application Thereof | |
JP2023109837A (en) | Induction medium and methods for stem cell culture and therapy | |
WO2006093172A1 (en) | Method for in vitro amplification of adult stem cells | |
CN113774028A (en) | Genetically modified stem cell for cartilage repair treatment and application thereof | |
WO2020103651A1 (en) | Use of mesenchymal stem cells in preparation of product for treating rheumatoid arthritis | |
WO2010125110A1 (en) | Method for obtaining human microglial precursor cells from pluripotent stem cells | |
WO2020073029A1 (en) | Methods for the expansion of mesenchymal stromal cells | |
CN111139222B (en) | Recombinant mesenchymal stem cell and preparation method and application thereof | |
Van den Bergh et al. | Characterization of interleukin-15-transpresenting dendritic cells for clinical use | |
Horvat et al. | Production of interleukin 2 and interleukin 4 by immune CD4− CD8+ and their role in the generation of antigen‐specific cytotoxic T cells | |
EP0363083A2 (en) | Pharmaceutical preparation for treatment of thrombocytopenic or platelet function-deficient disease | |
US20240052312A1 (en) | Composition for reprogramming cells into plasmacytoid dendritic cells or interferon type i-producing cells, methods and uses thereof | |
CN115947841B (en) | Method for producing cytokines by using umbilical cord mesenchymal stem cells as basic cells | |
CN115925925B (en) | Method for inducing umbilical cord mesenchymal stem cells to differentiate and producing cytokines | |
WO2002100898A2 (en) | Polypeptide having an activity to support proliferation or survival of hematopoietic stem cell and hematopoietic progenitor cell, and dna coding for the same | |
WO2023030489A1 (en) | Application of genetically modified oligodendrocyte progenitor cell in multiple sclerosis | |
Apte | Mechanisms of cytokine production by fibroblasts-implications for normal connective tissue homeostasis and pathological conditions | |
WO2022004823A1 (en) | Cranial neuropathy therapeutic agent containing culture supernatant for umbilical cord blood monocytic cells | |
Tanaka et al. | Identification of leukemia inhibitory factor as a potent mast cell growth-enhancing factor produced by mouse keratinocyte cell line, KCMH-1 | |
CN115819579B (en) | Total human interleukin 17A single chain antibody No.34 and application | |
WO2022179520A1 (en) | Co-expressed cxcr2 and t cells of star specific to gpc3, and use thereof | |
WO2001044490A2 (en) | A NOVEL METHOD TO PRODUCE HUMAN NATURAL INTERFERON-$g(a) |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
TA01 | Transfer of patent application right |
Effective date of registration: 20231219 Address after: 214064 building 7 and building 8, Hujing Science Park, No. 288, shibawan Road, Wuxi, Jiangsu Applicant after: Jiangsu Xinchao Biotechnology (Group) Co.,Ltd. Address before: Room 2157, Building 2, East Ring Road, Yanqingyuan, Zhongguancun, Yanqing District, Beijing 100000 Applicant before: Beijing Yiyuan Biotechnology Co.,Ltd. |
|
TA01 | Transfer of patent application right | ||
GR01 | Patent grant | ||
GR01 | Patent grant |