CN115057930A - Monoclonal antibody of targeted human Claudin18.2 protein and application thereof - Google Patents

Monoclonal antibody of targeted human Claudin18.2 protein and application thereof Download PDF

Info

Publication number
CN115057930A
CN115057930A CN202210517857.5A CN202210517857A CN115057930A CN 115057930 A CN115057930 A CN 115057930A CN 202210517857 A CN202210517857 A CN 202210517857A CN 115057930 A CN115057930 A CN 115057930A
Authority
CN
China
Prior art keywords
acid sequence
monoclonal antibody
cells
nucleic acid
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
CN202210517857.5A
Other languages
Chinese (zh)
Other versions
CN115057930B (en
Inventor
谢海涛
都晓龙
马丽雅
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Shenzhen Xiankangda Life Science Co ltd
Original Assignee
Shenzhen Xiankangda Life Science Co ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Shenzhen Xiankangda Life Science Co ltd filed Critical Shenzhen Xiankangda Life Science Co ltd
Priority to CN202210517857.5A priority Critical patent/CN115057930B/en
Publication of CN115057930A publication Critical patent/CN115057930A/en
Application granted granted Critical
Publication of CN115057930B publication Critical patent/CN115057930B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3023Lung
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3046Stomach, Intestines
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57423Specifically defined cancers of lung
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57438Specifically defined cancers of liver, pancreas or kidney
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57446Specifically defined cancers of stomach or intestine
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57484Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
    • G01N33/57492Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving compounds localized on the membrane of tumor or cancer cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/577Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/106Plasmid DNA for vertebrates
    • C12N2800/107Plasmid DNA for vertebrates for mammalian
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Biophysics (AREA)
  • Food Science & Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Zoology (AREA)
  • Hospice & Palliative Care (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Virology (AREA)
  • Plant Pathology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to the technical field of biological antibodies, in particular to a monoclonal antibody targeting human Claudin18.2 protein and application thereof. The monoclonal antibody includes a heavy chain variable region HV and a light chain variable region LV, and the amino acid sequence and the nucleic acid sequence of the monoclonal antibody may be used in a single-stranded form or in a double-stranded form. The monoclonal antibody can specifically recognize human Claudin18.2 antigen and not recognize human Claudin18.1 antigen, has good specificity in human normal tissues, only combines with Claudin18.2 positive tissues, does not recognize other tissues and organs, and has no off-target risk. The monoclonal antibody has a specific antibody-mediated Complement Dependent (CDC) killing effect on Claudin18.2 positive target cells, and CAR-T prepared by the monoclonal antibody has a specific killing function on the Claudin18.2 positive target cells.

Description

Monoclonal antibody of targeted human Claudin18.2 protein and application thereof
The application is a divisional application with application number 202111031017X, application date 2021, 09.03, and application name of monoclonal antibody targeting human Claudin18.2 protein and application thereof.
Technical Field
The invention relates to the technical field of biological cells, in particular to a monoclonal antibody of a targeted human Claudin18.2 protein, which can be used as a biological material to be applied to other DNA carrier construction, recombinant protein expression, cell line construction and chimeric antigen receptor immune cells; or coupling with other substances to be used as a biological agent, or directly using as the biological agent.
Background
Claudins is a family of proteins that function to maintain tight junctions that control the exchange of molecules between cells, are widely distributed in the stomach, pancreas and lung tissues, and can be used for disease diagnosis and treatment. The CLDN18.2 (i.e., Claudin 18.2) subtype, as a gastric-specific subtype, has become an ideal target since Sahin found that CLDN18.2 is a highly selective molecule and is only widely expressed in cancer cells. CLDN18.2 is usually buried in the gastric mucosa and is essentially inaccessible to monoclonal antibodies in normal tissues, and the development of malignant tumors results in the destruction of tight junctions, exposing the CLDN18.2 epitope on the surface of tumor cells as a specific target. Thus, CLDN18.2 confers specificity to targeted therapies. Expression recently found in pancreatic (50%), esophageal and lung cancers also shows potential for diagnosis and treatment of other tumors.
Claudin-18 has two splice variants, Claudin18.1 and Claudin18.2, respectively, with only eight amino acid differences between the sequences. The expression profiles of Claudin18.1 and Claudin18.2 are different, Claudin18.1 is selectively expressed in cells of normal lung, and Claudin18.2 is highly restricted in expression in normal cells, but frequently ectopically activated and overexpressed in various tumors (such as gastric cancer, lung cancer, pancreatic cancer and the like). The structure of Claudin protein includes four transmembrane regions, two extracellular loops, the N-terminal and C-terminal of which are in cytoplasm, and two extracellular loops which make it an ideal antibody target.
Disclosure of Invention
Based on this, there is a need to address the above problems, and one of the problems to be solved by the present invention is to provide a monoclonal antibody targeting human claudin18.2 protein, which specifically recognizes claudin18.2, but does not recognize claudin 18.1.
The second problem to be solved by the present invention is to provide a biomaterial comprising the nucleic acid sequence or amino acid sequence of a monoclonal antibody;
the third problem to be solved by the present invention is to provide a biological agent comprising a monoclonal antibody.
The first scheme of the invention is as follows:
a monoclonal antibody targeting a human Claudin18.2 protein, comprising a heavy chain variable region HV and a light chain variable region LV, the amino acid sequence and the nucleic acid sequence of the monoclonal antibody are as follows:
A) HV nucleic acid sequence:
ATGGCTGTCCTGGCGCTACTCCTCTGCCTGGTGACTTTCCCAAGCTGTGCCCTGTCCCAGGTGCAGCTGAAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGAGCCTGTCCATCACATGCACTGTCTCTGGGTTCTCATTA AACAGCTATATTATAAACTGGGTTCGCCAGTCACCAGGAAAGGGTCTGGACTGGCTTGGAGTAATATGGACTGGTG GAGGCACAAATTATAATTCAGCGCTCAAATCCAGACTGAGCATCACCAAAGACAACTCCAAGAGTCAAGTTTTCTTAAAAATGAACAGTCTGCAAACTGATGACACAGCCAGGTACTACTGTGCCAGAGGGGCCTATTATGGTAATGCTATG GACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA, respectively; wherein A-CDR1 representsGGGTTCTCATTAAACAGCTATATT(ii) a A-CDR2 representsATATGGACTGGTGGAGGCACA(ii) a A-CDR3 representsGCCAGAGGG GCCTATTATGGTAATGCTATGGACTAC
a) HV amino acid sequence:
MAVLALLLCLVTFPSCALSQVQLKESGPGLVAPSQSLSITCTVSGFSLNSYIINWVRQSPGKGLDWLGVIWTGGGTNYNSALKSRLSITKDNSKSQVFLKMNSLQTDDTARYYCARGAYYGNAMDYWGQGTSVTVSS, respectively; wherein a-CDR1 representsGFSLNSYI(ii) a a-CDR2 denotesIWTGGGT(ii) a a-CDR3 denotesARGAYYGNAMDY
B) LV nucleic acid sequence:
ATGGAATCACAGACTCAGGTCCTCATGTCCCTGCTGTTCTGGGTATCTGGTACCTGTGGGGACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAGGTCACTATGAACTGCAAGTCCAGTCAGAGT CTGTTAAACAGTGGAAATCAAAAGAACTACTTGACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAACTGTTGATCTACTGGGCATCCACTAGGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGCAGTTTATTACTGTCAGAATGCTTATAGTTATCCATTCACGTTCGGCTCGGAGACAAAGTTGGAAATAAAA, respectively; wherein B-CDR1 representsCAGAGTCTGTTAAACAGTGGAAATCAAAAGAAC TAC(ii) a B-CDR2 denotesTGGGCATCC(ii) a B-CDR3 representsCAGAATGCTTATAGTTATCCATTCACG
b) LV amino acid sequence:
MESQTQVLMSLLFWVSGTCGDIVMTQSPSSLTVTAGEKVTMNCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNAYSYPFTFGSETKLEIK, respectively; wherein b-CDR1 representsQSLLNSGNQKNY(ii) a b-CDR2 denotesWAS(ii) a b-CDR3 representsQNAYSYPFT
C) HV nucleic acid sequence:
ATGGCTGTCCTGGCGCTACTCCTCTGCCTGGTGACTTTCCCAAGCTGTGCCCTGTCCCAGGTGCAGCTGAAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGAGCCTGTCCATCACATGCACTGTCTCTGGGTTCTCATTA ACTAGTTATGTTATAAACTGGGTTCGCCAGCCACCAGGAAAGGGTCTGGAGTGGCTTGGAGTAATATGGACTGGTG GAGGCACAAATTATAATTCAGCTCTCAAATCCAGACTGAGCATCAGCAAAGACACCTCCAAGAGTCAAGTTTTCTTAAAGATGAACAGTCTGCAAACTGATGACACAGCCAGGTATTACTGTGCCAGAGGGGCCTACTATGGTAATGCTATG GACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA, respectively; wherein C-CDR1 representsGGGTTCTCATTAACTAGTTATGTT(ii) a C-CDR2 denotesATATGGACTGGTGGAGGCACA(ii) a C-CDR3 representsGCCAGAGGG GCCTACTATGGTAATGCTATGGACTAC
c) HV amino acid sequence:
MAVLALLLCLVTFPSCALSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYVINWVRQPPGKGLEWLGVIWTGGGTNYNSALKSRLSISKDTSKSQVFLKMNSLQTDDTARYYCARGAYYGNAMDYWGQGTSVTVSS, respectively; wherein c-CDR1 representsGFSLTSYV(ii) a c-CDR2 denotesIWTGGGT(ii) a c-CDR3 denotesARGAYYGNAMDY
D) LV nucleic acid sequence:
ATGGAATCACAGACTCAGGTCCTCATGTCCCTGCTGTTCTGGGTATCTGGTACCTGTGGGGACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAGGTCACTATGAGCTGCAAGTCCAGTCAGAGT CTGTTAAACAGTGGAAATCAAAAGAACTACTTAACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAATTGTTGATCTATTGGGCAGCCACTAGGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGCAGTTTATTACTGTCAGAATGATTATAGTTATCCATTCACGTTCGGCTCGGGGACAAAATTGGAAATAAAA, respectively; wherein D-CDR1 representsCAGAGTCTGTTAAACAGTGGAAATCAAAAGAAC TAC(ii) a D-CDR2 denotesTGGGCAGCC(ii) a D-CDR3 denotesCAGAATGATTATAGTTATCCATTCACG
d) LV amino acid sequence:
MESQTQVLMSLLFWVSGTCGDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWAATRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPFTFGSGTKLEIK; wherein d-CDR1 representsQSLLNSGNQKNY(ii) a d-CDR2 representsWAA(ii) a d-CDR3 representsQNDYSYPFT
E) HV nucleic acid sequence:
ATGGGATGGAGCTATATCATCCTCTTTTTGGTAGCAACATCTACAGGTGTCCACTCCCAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAGCCTGGGGCCTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACTTTC ACCAGCTACTGGATGCAGTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGAATGACTCATCCTAACA GTGGTGGTACTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGACTGGGTCGGGGAAATGCTATG GACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA, respectively; wherein E-CDR1 representsGGCTACACTTTCACCAGCTACTGG(ii) a E-CDR2 representsACTCATCCTAACAGTGGTGGTACT(ii) a E-CDR3 representsGCAAGA CTGGGTCGGGGAAATGCTATGGACTAC
e) HV amino acid sequence:
MGWSYIILFLVATSTGVHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGMTHPNSGGTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARLGRGNAMDYWGQGTSVTVSS, respectively; wherein e-CDR1 representsGYTFTSYW(ii) a e-CDR2 denotesTHPNSGGT(ii) a e-CDR3 denotesARLGRGNAMDY
F) LV nucleic acid sequence:
ATGGAATCACAGACTCAGGTCCTCATGTCCCTGCTGTTCTGGGTATCTGGTACCTGTGGGGACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAGGTCACTATGAGCTGCAAGTCCAGTCAGAGT CTGTTAAACAGTGGAAATCAAAAGAACTACTTGACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAACTGTTGATCTACTGGGCATCCACTAGGAAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGACAATTTATTACTGTCAGAATGATTATAGTTATCCATTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAA, respectively; wherein F-CDR1 representsCAGAGTCTGTTAAACAGTGGAAATCAAAAGAAC TAC(ii) a F-CDR2 representsTGGGCATCC(ii) a F-CDR3 denotesCAGAATGATTATAGTTATCCATTCACG
f) LV amino acid sequence:
MESQTQVLMSLLFWVSGTCGDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRKSGVPDRFTGSGSGTDFTLTISSVQAEDLTIYYCQNDYSYPFTFGSGTKLEIK, respectively; wherein f-CDR1 representsQSLLNSGNQKNY(ii) a f-CDR2 representsWAS(ii) a f-CDR3 representsQNDYSYPFT
G) HV nucleic acid sequence:
ATGAACTTCGGGCTCAGATTGATTTTCCTTGTCCTTACTTTAAAAGGTGTCCAGTGTGACGTGAAGTTGGTGGAGTCTGGGGAAGGCTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCGCTGGATTCACTTTC AGTAGCTATGCCATGTCTTGGGTTCGCCAGACTCCAGAGAAGAGGCTGGAGTGGGTCGCATACATTAGTAGTGGTG GTGATTACATCTACTATGCAGACACTGTGAAGGGCCGATTCACCATCTCCAGAGACAATGCCAGGAACACCCTGTACCTGCAAATGAGCAGTCTGAAGTCTGAGGACACAGCCATGTATTACTGTTCAAGACTCAGGCTACGTGGAGGAAAT GCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA; wherein G-CDR1 representsGGATTCACTTTCAGTAGCTATGCC(ii) a G-CDR2 representsATTAGTAGTGGTGGTGATTACATC(ii) a G-CDR3 representsTCAAGA CTCAGGCTACGTGGAGGAAATGCTATGGACTAC
g) HV amino acid sequence:
MNFGLRLIFLVLTLKGVQCDVKLVESGEGLVKPGGSLKLSCAAAGFTFSSYAMSWVRQTPEKRLEWVAYISSGGDYIYYADTVKGRFTISRDNARNTLYLQMSSLKSEDTAMYYCSRLRLRGGNAMDYWGQGTSVTVSS; wherein g-CDR1 representsGFTFSSYA(ii) a g-CDR2 representsISSGGDYI(ii) a g-CDR3 representsSRLRLRGGNAMDY
H) LV nucleic acid sequence:
ATGGAATCACAGACTCAGGTCCTCATGTCCCTGCTGTTCTGGGTATCTGGTACCTGTGGGGACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAAGTCACTATGAGCTGCAAGTCCAGTCAGAGT CTGTTAAACAGTGGAAATCAAAAGAACTACTTGACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAACTGTTGATCTACTGGGCATCCACTAGGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGCAGTTTATTACTGTCAGAATGATTATGCTTATCCGCTCACGTTCGGTACTGGGACCAAGCTGGAGCTGAAA, respectively; wherein H-CDR1 representsCAGAGTCTGTTAAACAGTGGAAATCAAAAGAAC TAC(ii) a H-CDR2 representsTGGGCATCC(ii) a H-CDR3 representsCAGAATGATTATGCTTATCCGCTCACG
h) LV amino acid sequence:
MESQTQVLMSLLFWVSGTCGDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYAYPLTFGTGTKLELK, respectively; wherein h-CDR1 representsQSLLNSGNQKNY(ii) a h-CDR2 denotesWAS(ii) a h-CDR3 denotesQNDYAYPLT
Preferably, the monoclonal antibody has an amino acid sequence selected from the group consisting of: any one of the amino acid sequences a), c), e), g) of the heavy chain variable region HV is used in combination with any one of the amino acid sequences b), d), f), h) of the light chain variable region LV, respectively; or any single strand of the amino acid sequences a), b), c), d), e), f), g), h).
Preferably, the monoclonal antibody has a nucleic acid sequence selected from the group consisting of: any one of the nucleic acid sequences A), C), E), G) of the heavy chain variable region HV is used in combination with any one of the nucleic acid sequences B), D), F), H) of the light chain variable region LV, respectively, in double-stranded form; or any single strand of the nucleic acid sequences A), B), C), D), E), F), G), H).
Preferably, the monoclonal antibody is of murine origin, and has three complementarity determining regions in the heavy chain variable region HV and the light chain variable region LV corresponding to the amino acid sequence and the nucleic acid sequence, respectively, and the complementarity determining regions are the amino acid sequence and the nucleic acid sequence corresponding to CDR1, CDR2, and CDR3, respectively.
Preferably, the monoclonal antibody, when humanized or otherwise engineered to be of animal origin, has no more than 20% change in the amino acid and/or nucleic acid sequence of the three complementarity determining regions CDR1, CDR2, CDR 3; or, when the monoclonal antibody is humanized or modified from other animal sources, the amino acid sequence and/or the nucleic acid sequence of the CDR1, CDR2 and CDR3 in the three complementarity determining regions are changed to 0.
The invention also provides a biological material, which comprises an expression cassette, a recombinant vector, a recombinant protein, a recombinant microorganism or a recombinant cell line constructed by the nucleic acid sequence or the amino acid sequence, wherein the nucleic acid sequence or the amino acid sequence is derived from the monoclonal antibody.
Preferably, in the biological material, the recombinant vector comprises a gene recombinant expression vector and a chimeric antigen receptor.
The invention also provides a biological agent containing the monoclonal antibody.
Preferably, the biological preparation also comprises a reagent for detecting the concentration of the human Claudin18.2 protein, a reagent for detecting the expression degree of the human Claudin18.2 protein on the surface of tumor cells, a reagent for carrying out antibody-mediated complement-dependent or cell-dependent cytotoxic reaction on human Claudin18.2 positive cells, a reagent for killing the human Claudin18.2 positive cells by antibody-coupled toxins, a functional recombinant protein for targeting the human Claudin18.2 and other antigen polyclonal antibodies prepared by antibody coupling other antibodies, and a chimeric antigen receptor immune cell for targeting the human Claudin18.2 positive cells prepared by antibody coupling other proteins.
The main advantages of the monoclonal antibody of the invention include:
1. has the ability to specifically recognize human Claudin18.2 protein and not to recognize Claudin18.1;
2. the monoclonal antibody has good tissue specificity, only identifies and expresses Claudin18.2 tissues, and does not identify other tissues and organs, thereby showing that the monoclonal antibody has good detection application prospect;
3. the monoclonal antibody has a specific antibody-mediated Complement Dependent (CDC) killing effect on Claudin18.2 positive target cells, which indicates that the monoclonal antibody has a good application prospect of monoclonal antibody therapy;
4. the CAR-T prepared by the monoclonal antibody has a specific killing function on Claudin18.2 positive target cells, and the monoclonal antibody has a good application prospect in cell immunotherapy;
5. the monoclonal antibody has good targeting property in both a natural configuration state and a recombinant configuration state, and the monoclonal antibody has good application prospects of antibody drug conjugates, single-resistance drugs, multiple-resistance drugs and recombinant antibody proteins.
Drawings
FIGS. 1a, 1b, 1c, 1d, 1e and 1f show respectively the expression negative of 293T cell Claudin18.2, expression negative of 293T cell Claudin18.1, positive of 293T-hClaudin18.1, expression positive of 293T-hClaudin18.2, expression positive of hClaudin18.2 in 293T-hClaudin18.1, expression positive of mClaudin18.1 in 293T-mClaudin18.2, and expression positive of mClaudin18.2 in 293T-mClaudin 18.2;
FIG. 2 shows the affinity assay results of the murine mAb of example 1;
FIGS. 3a, 3b, 3c, 3d, and 3e are the species-specific detection results of the murine monoclonal antibodies; wherein, FIG. 3a is a graph of the binding activity of murine mAb to 293T cells; FIG. 3b is a graph showing the binding activity of murine mAb to 293T-mClaudin18.1 cells; FIG. 3c is a graph showing the binding activity of murine mAb to 293T-mClaudin18.2 cells; FIG. 3d is a graph showing the binding activity of murine mAb to 293T-hClaudin18.1 cells; FIG. 3e is a graph showing the binding activity of murine mAb to 293T-hClaudin18.2 cells;
FIG. 4 shows the result of tissue-specific detection of murine monoclonal antibody;
FIGS. 5a, 5b, 5c, 5d, and 5e are the results of detecting the CDC effect of murine monoclonal antibody; wherein, FIG. 5a is a 293T-hClaudin18.2 cell natural activity rate graph; FIG. 5B is a graph showing the activity rate of 293T-hClaudin18.2 cells +1B8 murine monoclonal antibody; FIG. 5c is a graph showing the activity rate of 293T-hClaudin18.2 cells +1B10 murine mAb; FIG. 5d is a graph showing the activity rate of 293T-hClaudin18.2 cells +1A6 murine mAb; FIG. 5e is a graph showing the activity rate of 293T-hClaudin18.2 cells +2B5 murine mAb;
FIG. 6 is the CAR-Claudin18.2 structure;
FIG. 7 is an expansion curve of the immune cells of example 1;
FIGS. 8a, 8b, 8c, 8d, 8e, 8f are representations of CAR; wherein, fig. 8a is a NT cell (control cell) CAR expression negative profile; FIG. 8b is a map of the positive rate of CAR expression in CAR-007 cells; FIG. 8c is a map of the positive rate of CAR expression in CAR-1B8 cells; FIG. 8d is a map of the positive rate of CAR expression in CAR-1B10 cells; FIG. 8e is a map of the positive rate of CAR expression in CAR-1A6 cells; FIG. 8f is a map of CAR expression positivity rates in CAR-2B5 cells;
FIG. 9a is a graph of CAR-T versus 293T cell killing;
FIG. 9b is a graph of CAR-T vs. 293T-Claudin18.2 cell killing.
Detailed Description
In order that the invention may be more fully understood, reference will now be made to the following more detailed description. This invention may, however, be embodied in many different forms and should not be construed as limited to the embodiments set forth herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. The terminology used in the description of the invention herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention.
In the present invention, the monoclonal antibody (or abbreviated as monoclonal antibody) is derived from mouse source, and the technical scheme is illustrated and described.
In the present invention, the immune cell may be any cell including T cell, NK cell, NKT cell, macrophage, gamma-deltaT cell, TIL cell, and TCR-T cell.
The invention provides a monoclonal antibody targeting human Claudin18.2 protein, which comprises a heavy chain variable region HV and a light chain variable region LV, and the amino acid sequence and the nucleic acid sequence of the monoclonal antibody are as follows:
the antibody sequences are shown in the following table 1:
TABLE 1 amino acid sequence and nucleic acid sequence listing of monoclonal antibodies
Figure BDA0003642054020000071
Figure BDA0003642054020000081
Figure BDA0003642054020000091
Figure BDA0003642054020000101
Figure BDA0003642054020000111
Figure BDA0003642054020000121
In the invention, letters such as A, B, C, D, E, F, G, H, a, B, C, D, E, F, G, H and the like before CDR1, CDR2 and CDR3 are only serial number identification numbers, are only limited to distinguishing action and have no other meanings.
For the amino acid sequences of monoclonal antibodies, the following corresponding combinatorial selections can be made at the time of use:
any one of the amino acid sequences a), c), e), g) of the heavy chain variable region HV is used in combination with any one of the amino acid sequences b), d), f), h) of the light chain variable region LV, respectively; or any single strand of the amino acid sequences a), b), c), d), e), f), g), h).
For the amino acid double-strand combination use, for example, when the amino acid sequence of the heavy chain variable region HV is a), the amino acid sequence of the light chain variable region LV is the sequence b); or, when the amino acid sequence of the heavy chain variable region HV is c), the amino acid sequence of the light chain variable region LV is the sequence d); or, when the amino acid sequence of the heavy chain variable region HV is e), the amino acid sequence of the light chain variable region LV is the sequence f); alternatively, when the amino acid sequence of the heavy chain variable region HV is g), the amino acid sequence of the light chain variable region LV is the sequence h), and the like.
In another embodiment, the nucleic acid sequences of the monoclonal antibodies are selected for use in the corresponding combinations as follows: the nucleic acid sequence A), C), E) of the heavy chain variable region HV is used in combination with any of the nucleic acid sequences B), D), F) and H) of the light chain variable region LV; or any single strand of the nucleic acid sequences A), B), C), D), E), F), G), H).
For the nucleic acid double-stranded combination, for example, when the nucleic acid sequence of the heavy chain variable region HV is A), the nucleic acid sequence of the light chain variable region LV is sequence B); or, when the nucleic acid sequence of the heavy chain variable region HV is C), the nucleic acid sequence of the light chain variable region LV is sequence D); or, when the nucleic acid sequence of the heavy chain variable region HV is E), the nucleic acid sequence of the light chain variable region LV is sequence F); alternatively, when the nucleic acid sequence of the heavy chain variable region HV is G), the nucleic acid sequence of the light chain variable region LV is the sequence H), and the like.
Specifically, for example, the amino acid sequences in the light and heavy chain variable regions of the monoclonal antibody are used in pair and expressed as murine monoclonal antibody, preferably the expression pairs are:
1) sequence A and sequence B are paired, and the expression and purification mouse monoclonal antibody is named as 1B 8;
2) sequence C and sequence D are paired, and the expression and purification mouse monoclonal antibody is named as 1B 10;
3) sequence E and sequence F are paired, and the expression and purification mouse monoclonal antibody is named as 1A 6;
4) sequence G and sequence H were paired and the expression purified murine mab was designated 2B 5.
Preferably, since the monoclonal antibody is of murine origin, the heavy chain variable region HV and the light chain variable region LV, which correspond to the amino acid sequence and the nucleic acid sequence, respectively, have three complementarity determining regions, which correspond to the amino acid sequence and the nucleic acid sequence of CDR1, CDR2, and CDR3, respectively. Accordingly, the amino acid sequence and/or nucleic acid sequence of the three complementarity determining regions CDR1, CDR2, CDR3 of a monoclonal antibody is not changed by more than 20% when it is humanized or otherwise engineered to be of animal origin; or, when the monoclonal antibody is humanized or modified from other animal sources, the amino acid sequence and/or the nucleic acid sequence of the CDR1, CDR2 and CDR3 in the three complementarity determining regions are changed to 0.
The invention also provides a biological material, which comprises an expression cassette, a recombinant vector, a recombinant protein, a recombinant microorganism or a recombinant cell line constructed by the nucleic acid sequence or the amino acid sequence, wherein the nucleic acid sequence or the amino acid sequence is derived from the monoclonal antibody; wherein, in the biological material, the recombinant vector comprises a gene recombinant expression vector and a chimeric antigen receptor.
The invention also provides a biological preparation containing the monoclonal antibody, and the biological preparation also comprises a reagent for detecting the concentration of the human Claudin18.2 protein, a reagent for detecting the expression degree of the human Claudin18.2 protein on the surface of a tumor cell, a complement-dependent or cell-dependent cytotoxic reaction reagent for carrying out antibody-mediated reaction on a human Claudin18.2 positive cell, an antibody-coupled toxin for killing the human Claudin18.2 positive cell, and a chimeric antigen receptor immune cell which is prepared by antibody-coupled other proteins and targets the human Claudin18.2 positive cell.
The antibody development application of the present invention will be described in detail below typically using CAR-T cells as an example.
The antibody expansion application of the invention is not limited to CAR-T cells as described above and below, and the immune cells have the same or similar technical features and benefits as CAR-T cells as described above and below. Specifically, when the immune cell expresses the chimeric antigen receptor CAR, the NK cells, NKT cells, TIL, gamma-delta T cells are identical to T cells (or T cells can replace NK cells).
The design of chimeric antigen receptors CARs goes through the following process:
the first generation CARs had only one intracellular signaling component, CD3 ζ or Fc γ RI molecule, and, because of the single activation domain in the cell, it caused only transient T cell proliferation and less cytokine secretion, and did not provide long-term T cell proliferation signaling and sustained in vivo anti-tumor effects, and therefore did not achieve good clinical efficacy.
The second generation CARs introduce a costimulatory molecule such as CD28, 4-1BB, OX40 and ICOS on the basis of the original structure, and compared with the first generation CARs, the function of the second generation CARs is greatly improved, and the persistence of CAR-T cells and the killing capability of the CAR-T cells on tumor cells are further enhanced. On the basis of second generation CARs, a plurality of novel immune co-stimulatory molecules such as CD27 and CD134 are connected in series.
Third and fourth generation CARs, and also dual or multiple CARs that express targeting 2 or more targets on the same cell, and the like
The Chimeric Antigen Receptors (CARs) of the invention include an extracellular domain, a transmembrane domain, and an intracellular domain. Wherein the extracellular domain comprises an antigen binding domain, the intracellular domain comprises a costimulatory signaling region, the intracellular domain of a cytokine receptor, and a portion of the CD3 zeta chain, the costimulatory signaling region referring to the portion of the intracellular domain that comprises the costimulatory molecule, the cell surface molecule required for an effective response by lymphocytes to an antigen.
In a preferred embodiment, the extracellular domain of the CAR provided herein comprises the light and heavy chain variable region antigen binding domain of murine mab targeting claudin18.2. When expressed in T cells, the CARs of the invention are capable of antigen recognition based on antigen binding specificity or protein receptor binding. The antigen binding domain is preferably fused to an intracellular domain derived from a costimulatory molecule and the CD3 zeta chain. Preferably, the antigen binding domain is fused to the intracellular domains of CD28, 4-1BB, ICOS signaling domain, and CD3 zeta signaling domain in combination, respectively.
In the CAR of the present invention, the intracellular domain includes CD28, 4-1BB, the signaling domain of ICOS, and the signaling domain of CD3 ζ.
The vector of the expression cassette is selected from: DNA, RNA, plasmid, slow virus vector, adenovirus vector, retrovirus vector, transposon, other gene transfer system. Preferably, the vector is a viral vector.
The nucleic acid sequence of the vector encoding the desired molecule may be obtained using recombinant methods known in the art, such as, for example, by screening libraries from cells expressing the gene, by obtaining the gene from vectors known to include the gene, or by direct isolation from cells and tissues containing the gene using standard techniques. Alternatively, the gene of interest may be produced synthetically.
The present invention also provides a vector for inserting an expression cassette, a vector derived from a retrovirus such as lentivirus, characterized by long-term, stable integration of a gene of interest into a cell; transducible non-proliferating cells, such as hepatocytes; low immunogenicity; the safety is high. Typical cloning vectors contain transcriptional and translational terminators, initiation sequences, and promoters that may be used to regulate the expression of the desired nucleic acid sequence.
The expression vector may be provided to the cell in the form of a viral vector. Viruses that can be used as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. Generally, suitable vectors comprise an origin of replication functional in at least one organism, a promoter sequence, a convenient restriction enzyme site and one or more selectable markers. For example, retroviruses provide a convenient platform for gene delivery systems. The selected gene can be inserted into a vector and packaged into a retroviral particle using techniques known in the art. The recombinant virus can then be isolated and delivered to the subject cells in vivo or ex vivo. In one embodiment, a lentiviral vector is used.
Additional promoter elements, such as enhancers, may regulate the frequency of transcription initiation. Typically, these are located in the 30-110bp region upstream of the start site, although many promoters have recently been shown to also contain functional elements downstream of the start site. The spacing between promoter elements is often flexible so that promoter function is maintained when the elements are inverted or moved relative to one another. One example of a suitable promoter is the immediate early Cytomegalovirus (CMV) promoter sequence, another example is elongation growth factor-1 alpha (EF-1 alpha). However, other constitutive promoter sequences may also be used, including, but not limited to, the simian virus 40(SV40) early promoter, the mouse mammary cancer virus (MMTV), the Human Immunodeficiency Virus (HIV) Long Terminal Repeat (LTR) promoter, the MoMuLV promoter, the avian leukemia virus promoter, the Epstein-Barr (Epstein-Barr) virus immediate early promoter, the rous sarcoma virus promoter, and human gene promoters such as, but not limited to, the actin promoter, myosin promoter, heme promoter, and creatine kinase promoter. Further, the present invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch that is capable of turning on expression of a polynucleotide sequence operably linked to the inducible promoter when such expression is desired, or turning off expression when expression is not desired. Examples of inducible promoters include, but are not limited to, the metallothionein promoter, the glucocorticoid promoter, the progesterone promoter, and the tetracycline promoter.
To assess the expression of the CAR polypeptide or portion thereof, the expression vector introduced into the cells can also comprise either or both of a selectable marker gene or a reporter gene to facilitate identification and selection of expressing cells from a population of cells sought to be transfected or infected by the viral vector. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both the selectable marker and the reporter gene may be flanked by appropriate regulatory sequences to enable expression in a host cell. Useful selectable markers include, for example, antibiotic resistance genes, such as neo and the like.
Physical methods for introducing polynucleotides into host cells include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well known in the art. A preferred method of introducing the polynucleotide into the host cell is lipofection. The nucleic acid can be associated with a lipid, which can be encapsulated into the aqueous interior of a liposome, dispersed within the lipid bilayer of the liposome, attached to the liposome via a linker molecule associated with both the liposome and the oligonucleotide, entrapped in the liposome, complexed with the liposome, dispersed in a solution comprising a lipid, which is a fatty substance, which can be a naturally occurring or synthetic lipid. For example, lipids include fatty droplets that occur naturally in the cytoplasm as well as such compounds that contain long-chain aliphatic hydrocarbons and their derivatives such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
The invention provides CAR-T cells comprising the targeted claudin18.2 antibody as described above, together with a pharmaceutically acceptable carrier, diluent or excipient.
In one embodiment, the formulation is a liquid formulation. Preferably, the formulation is an injection. Preferably, the CAR-T cells are present in the formulation at a concentration of 1X 10 3 ~1×10 8 The concentration of CAR-T cells is more preferably 1X 10 4 ~1×10 7 Each/ml. In one embodiment, the formulation may include buffers such as neutral buffered saline, sulfate buffered saline, and the like; carbohydrates such as glucose, mannose, sucrose or dextran, mannitol; a protein; polypeptides or amino acids such as glycine; an antioxidant; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and a preservative. The formulations of the present invention are preferably formulated for intravenous administration.
The invention includes therapeutic applications of cells (e.g., T cells) transduced with lentiviral vectors encoding the antibody constructs of the invention. The transduced T cells can elicit a CAR-mediated T-cell response. The injected cells are capable of killing the recipient's tumor cells, and the CAR-T cells are capable of replicating in vivo, resulting in long-term persistence that can lead to sustained tumor control. And the CAR-T cell membrane can express the scFv structural antigen chimeric receptor of the murine monoclonal antibody targeting Claudin18.2, specifically kills Claudin18.2 positive target cells and has no off-target risk.
In one embodiment, the immune cells of the invention can undergo robust T cell expansion in vivo and can last for an extended amount of time. In addition, the CAR-mediated immune response can be part of an adoptive immunotherapy step, wherein the CAR-modified T cell induces an immune response specific to the antigen binding domain in the CAR. For example, claudin18.2 CAR-T cells elicit a specific immune response against cells expressing claudin 18.2.
Treatable conditions include tumor cells positively expressed by claudin18.2. Symptoms that may be caused by tumor cells include, but are not limited to, carcinomas, blastomas, sarcomas, and the like.
CAR immune cells using the antibodies of the invention, ex vivo procedures to modify T cells, at least one of the following occurs in vitro prior to administration of the cells into a human: i) expanding the cell, ii) introducing into the cell a nucleic acid encoding the CAR and a nucleic acid encoding an immune checkpoint antibody protein fused to a cytokine receptor expressed on the cell membrane, and/or iii) cryopreserving the cell. Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells isolated from human peripheral blood are used to express the CARs disclosed herein and an immune checkpoint antibody protein fused to a cytokine receptor expressed on the cell membrane. The T-modified cells can be administered to a recipient to provide a therapeutic benefit. Second, the immune cells may be autologous with respect to the recipient. Alternatively, the cells may be allogeneic, syngeneic (syngeneic), or xenogeneic with respect to the recipient.
Immune cell CAR-modified T cells using the antibodies of the invention can be administered alone or in combination with other drugs, pharmaceutical compositions, diluents and/or with other components such as IL-2, IL-17 or other cytokines or cell populations. Briefly, a pharmaceutical composition of the invention may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents, or excipients. Such compositions may include buffers such as neutral buffered saline, sulfate buffered saline, and the like; carbohydrates such as glucose, mannose, sucrose or dextran, mannitol; a protein; polypeptides or amino acids such as glycine; an antioxidant; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and a preservative. The compositions of the present invention are preferably formulated for intravenous administration.
The pharmaceutical composition made of the immune cells using the antibody of the present invention can be administered in a manner suitable for the disease to be treated (or prevented). The amount and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, and by the clinical protocol. When referring to an "immunologically effective amount", "an anti-tumor effective amount", "a tumor-inhibiting effective amount", or a "therapeutic amount", the precise amount of the composition of the invention to be administered can be determined by a physician, taking into account the age, weight, tumor size, extent of infection or metastasis, and individual differences in the condition of the patient (subject). It can be generally pointed out that: pharmaceutical compositions comprising T cells described herein may be at 1 × 10 4 ~1×10 9 Dosage per kg body weight, preferably 1X 10 5 ~1×10 6 Administered at a dose of one/kg body weight. The T cell composition may also be administered multiple times at these doses. Optimal dosages and treatment regimens for a particular patient may be determined by those skilled in the medical arts by monitoring the patient for signs of disease and adjusting the treatment accordingly.
Administration of the formulations of the invention may be carried out in any convenient manner, including by spraying, injection, swallowing, infusion, implantation or transplantation. The compositions described herein can be administered to a patient subcutaneously, intradermally, intratumorally, intranodal, intraspinally, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In one embodiment, the T cell composition of the invention is administered to a patient by intradermal or subcutaneous injection. In another embodiment, the T cell composition of the invention is preferably administered by i.v. injection. The composition of T cells can be injected directly into the tumor, lymph node or site of infection.
The following are descriptions of specific embodiments.
Example 1
The preparation method and the functional verification of the antibody of the embodiment comprise the following steps:
s100: mouse immunization and mouse monoclonal antibody sequence acquisition
Balbc mice were immunized with the self-produced Claudin18.2 protein and immunized by subcutaneous multiple injections of 20 ug/mouse per dose, once per week. After 4 weeks of immunization, mice with blood antibody titers of 1K or more were sacrificed, and spleen cells were taken and fused with SP2.0 cells. Performing titer detection on the fusion cells, screening positive fusion cells, selecting monoclone by using a limiting dilution method, performing antibody fermentation and function evaluation, extracting genes from the finally screened murine monoclonal antibody, constructing antibody light and heavy chain expression plasmid fermentation purified antibodies, and constructing CAR plasmid.
S200: fermentation and purification of mouse monoclonal antibody
And (3) pairing the constructed light and heavy chain expression plasmids of the antibody, using a PEI reagent as a transfection reagent, simultaneously carrying out antibody protein fermentation on the light and heavy chain expression plasmids of a pair of transient transfection 293T cells, naturally pairing the light and heavy chains of the antibody in the fermentation process, and collecting a culture solution. The culture broth was filtered through a 0.22 μm sterile filter to obtain a culture supernatant, which was then purified by affinity chromatography.
The purification method comprises the following steps: (1)20mM PB, pH7.0 equilibrium 1ml-Protein A affinity column, 1.0 ml/min; (2) loading the culture solution 50ml at 1ml/min, and balancing with balance solution; (3) eluting with 0.1M glycine-HCl (pH2.7) at 1ml/min, and collecting 280nm absorption peak; (4)20-50mM PB, 150mM NaCl, pH6.7 balance Superdex 200 Increate 10/300GL column, 1 ml/min; (5) and loading, and collecting 2ml of a 280nm absorption peak.
And (4) carrying out HPLC analysis on the purified sample, detecting a receiving peak, detecting the concentration of the purified receiving peak, and calculating the protein amount.
S300: cell line culture
Cell lines that do not express claudin18.1 and claudin 18.2: 293T (human embryonic kidney cell line) purchased from ATCC.
Cell line expressing human claudin18.1: 293T-hClaudin18.1, constructed by self-produced lentivirus infection.
Cell line expressing human claudin18.2: 293T-hClaudin18.2, constructed by self-produced lentivirus infection.
Cells expressing murine claudin18.1: 293T-mClaudin18.1, transient transformation from a self-produced plasmid.
Cells expressing murine claudin18.2: 293T-mClaudin18.2, transient transformation from a self-produced plasmid.
Packaging cells: 293T (human embryonic kidney cell line), purchased from ATCC.
Establishment of cell lines overexpressing human Claudin18.1 and human Claudin18.2: cloning base sequences expressing hClaudin18.1 and hClaudin18.2 into a PHBVV lentiviral vector skeleton, placing the PHBV-EF 1 alpha-hClaudin 18.1 and PHBV-EF 1 alpha-hClaudin 18.2 under a promoter of EF1 alpha (EF-1 alpha), and transferring three plasmids of PHBV-EF 1 alpha-hClaudin 18.1 and PHBV-EF 1 alpha-hClaudin 18.2, a lentiviral envelope Plasmid pMD2.G (Addgene, Plasmid #12259) and a lentiviral packaging Plasmid PAPSX 2(Addgene Plasmid #12260) into a 293T by using Lipofectamine3000 to prepare a lentiviral complete expression vector; viral supernatants were collected at 48h and 72h, concentrated by ultracentrifugation (Merck Millipore); the concentrated virus can be used for infecting 293T, and 293T cell lines which express hClaudin18.1 or hClaudin18.2 in a monoclonal mode are obtained finally, and are named as 293T-hClaudin18.1 and 293T-hClaudin 18.2.
Construction of cells expressing murine claudin18.1 and murine claudin 18.2: cloning base sequences expressing mClaudin18.1 and mClaudin18.2 into a PHBV lentiviral vector skeleton, placing the skeleton under a promoter of EF1 alpha (EF-1 alpha) to form PHBV-EF 1 alpha-mClaudin18.1 and PHBV-EF 1 alpha-mClaudin18.2, and transferring the plasmids p of the PHBV-EF 1 alpha-mClaudin18.1 and the PHBV-EF 1 alpha-mClaudin18.2 into 293T for transient expression by using Lipofectamine 3000; and detecting the positive rate of the cells after 72h to finally obtain 293T cells transiently expressing the mClaudin18.1 or the mClaudin18.2, which are named as 293T-mClaudin18.1 and 293T-mClaudin18.2 and are used for detecting the specificity of the antibody species. All cell culture media described above were cultured: DMEM medium was used for the culture. All media were supplemented with 10% (v/v) fetal bovine serum.
FIGS. 1a, 1b, 1c, 1d, 1e and 1f show the expression negative for 293T cell Claudin18.2, expression negative for 293T cell Claudin18.1, expression positive for 293T-hClaudin18.1, expression positive for 293T-hClaudin18.2, expression positive for 293T-mClaudin18.1, and expression positive for 293T-mClaudin18.2.
FIG. 1a shows the result of detection of 293T cells using Claudin18.2 antibody, wherein the position of the peak pattern is shown on the left side of the vertical line, indicating that the detection result is negative to Claudin18.2; FIG. 1b shows the result of detection of 293T cells using the Claudin18.1 antibody, wherein the position of the peak pattern is on the left side of the vertical line, indicating that the detection result is negative to Claudin18.1; the results of the two panel assays of FIGS. 1a and 1b show that 293T cells show no expression of Claudin18.1 and Claudin18.2; FIG. 1c shows the result of detection of 293T-hClaudin18.1 cells using hClaudin18.1 antibody, in which the peak positions are on the right side of the vertical line, indicating that the detection result is positive for hClaudin 18.1; FIG. 1d shows the results of detection of 293T-hClaudin18.2 cells using hClaudin18.2 antibody. The position of the peak pattern in the figure is on the right side of the vertical line, and the detection result is positive for hClaudin18.2; in FIG. 1e, the result of detection of 293T-mClaudin18.1 cell by using hClaudin18.1 antibody shows that the 293T-mClaudin18.1 cell has a positive rate of 26.55%, because the sequences of the mClaudin18.1 and the hClaudin18.1 at the detection site of the antibody are completely consistent, the mClaudin18.1 antibody can be used for carrying out mClaudin18.1 detection, the 293T-mClaudin18.1 cell is transient cell, the expression of which is not completely positive, the position of the peak in the figure is mClaudin18.1 positive at the right side of the vertical line, and the mClaudin18.1 negative at the left side of the vertical line; in FIG. 1f, the result of detection of 293T-mClaudin18.2 cells by using the hClaudin18.2 antibody shows that the sequence of the mClaudin18.2 and the sequence of the hClaudin18.2 at the detection site of the antibody are completely consistent, the mClaudin18.2 antibody can be used for detecting the mClaudin18.2, the 293T-mClaudin18.2 cells are transient cells, the expression of the cells is not completely positive, the peak position in the figure is positive to the right side of the vertical line by the mClaudin18.2 and negative to the left side of the vertical line by the mClaudin18.2, and the result of detection shows that the positive rate of the 293T-mClaudin18.2 cells is 33.88%.
S400: evaluation of affinity and species specificity of mouse monoclonal antibody
The EC50 affinities of Claudin18.2 murine mAbs 1B8, 1B10, 1A6, 2B5 were tested using 293T-hClaudin18.2 cells as positive cells, mIgG2B as isotype control, 007 antibody as positive control, and the results are shown in FIG. 2. The results show that EC50 affinity was higher for 1B8, 1B10, 1a6, 2B5 than for control antibody 007.
Species specificities of Claudin18.2 murine mAbs 1B8, 1B10, 1A6, 2B5 were examined using 293T, 293T-hClaudin18.1, 293T-hClaudin18.2, 293T-mClaudin18.1, 293T-mClaudin18.2 cells as target cells and mIgG2B as isotype control, and the results are shown in FIGS. 3a, 3B, 3c, 3d, 3 e.
In FIG. 3a, the binding peaks of murine mAbs 1B8, 1B10, 1A6, and 2B5 and isotype control mIgG2B and 293T cells, respectively, are on the left of the vertical line, indicating that they are negative; the binding peak patterns of 1B8, 1B10, 1A6 and 2B5 and isotype control mIgG2B and 293T-mClaudin18.1 cells in FIG. 3B are all on the left of the vertical line, indicating that they are negative; in fig. 3c, the binding peak pattern of isotype control mIgG2B and 293T-mclaudin18.2 cell is on the left of the vertical line, indicating that it is negative, the binding peak pattern of 1B8, 1B10, 1A6, 2B5 and 293T-mclaudin18.2 cell is negative partially on the left of the vertical line, and positive partially on the right of the vertical line, the positive rate is consistent with the positive rate of 293T-mclaudin18.2 cell, and the binding cells detected as 1B8, 1B10, 1A6, 2B5 are positive 293T-mclaudin18.2 cell, indicating that 1B8, 1B10, 1A6, 2B5 antibody can bind to mclaudin18.2; the binding peak patterns of 1B8, 1B10, 1A6 and 2B5 and isotype control mIgG2B and 293T-hClaudin18.1 cells in FIG. 3d are all on the left of the vertical line, indicating that they are negative; the isotype control mIgG2B and 293T-hClaudin18.1 cell binding peak pattern in FIG. 3e are on the left of the vertical line, indicating that its binding is negative, and the murine mAbs 1B8, 1B10, 1A6, 2B5 and 293T-hClaudin18.2 cell binding peak patterns are all positive on the right of the vertical line, indicating that the 1B8, 1B10, 1A6, 2B5 antibodies can bind to hClaudin 18.2.
The above results indicate that the murine mabs 1B8, 1B10, 1a6, 2B5 antibodies can specifically bind to human and murine claudin18.2, and not to claudin 18.1. The antibody has the specificity of two human and mouse species, and can be used for primarily evaluating the pathological toxicological characteristics in a mouse animal experiment in a subsequent experiment.
S500: tissue specificity detection and evaluation of mouse monoclonal antibody
Immunohistochemical evaluation of tissue specificity of murine mabs was performed using a human normal tissue chip comprising 37 normal tissue types: esophageal tissue, gastric tissue, small intestinal tissue, colon tissue, hepatic tissue, pancreatic tissue, appendiceal tissue, tongue tissue, salivary gland tissue, pharyngeal mucosa, lung tissue, testicular tissue, prostate tissue, breast tissue, ovarian tissue, endometrial tissue, cervical canal tissue, cervical tissue, renal cortex tissue, renal medullary tissue, bladder tissue, tonsil tissue, lymph node tissue, thymus tissue, spleen tissue, skin tissue, skeletal muscle tissue, arterial tissue, pleural mesothelial tissue, peripheral nerve tissue, cerebellar tissue, white matter of the brain, gray matter of the brain, adrenal tissue, thyroid tissue, myocardial tissue. There are 102 tissue points. The detection result is shown in figure 4, and the result shows that the staining effect is only on the cell membrane surface of the esophagus and stomach tissue (Claudin18.2 positive expression), and no cell membrane surface staining is generated on the other normal tissues, which proves that the tissue specificity is good.
S600: CDC effect detection and evaluation of mouse monoclonal antibody
After mouse monoclonal antibody 1B8, 1B10, 1A6 and 2B5 antibody working solution is prepared by DPBS of 20% human plasma, the working solution and 293T-hClaudin18.2 cells are subjected to co-incubation for 30min, and after the incubation, the cells are cleaned and the proportion of the living cells is detected in an up-flow mode. The results are shown in fig. 5a, 5b, 5c, 5d and 5e, and the in-frame selected cells in each map are viable cell ratios of 81.34%, 6.41%, 34.01%, 3.94% and 21.66%, respectively. The proportion of the live cells of 293T-hClaudin18.2 cells incubated by murine monoclonal antibodies 1B8, 1B10, 1A6 and 2B5 and human plasma is greatly reduced, which indicates that 1B8, 1B10, 1A6 and 2B5 have antibody-mediated Complement Dependent Cytotoxicity (CDC).
S700: peripheral blood PBMC isolation and T cell culture.
Separating monocytes from donor peripheral blood, performing density gradient centrifugation using ficol, and enriching T cells using a T cell sorting kit (CD3 MicroBeads, human-lymphotized, 130-; the Medium used was TexMACS GMP Medium (Miltenyi Biotec, 170- 2 Culturing in a constant temperature incubator to obtain T cells.
S800: CAR structural design and lentiviral packaging.
Claudin18.2-CAR structure, i.e. CAR structure targeting claudin 18.2:
the invention constructs four pairs of scFv sequences targeting the light chain variable region of Claudin18.2 murine monoclonal antibody, namely 1B8/1B10/1A6/2B5, respectively, into an expression cassette of a second generation CAR. The core structure of the CAR includes a secretion signal peptide sequence; the CD8 transmembrane region; intracellular segment stimulation signal 4-1BB-CD3 ζ, designated CAR-1B8, CAR-1B10, CAR-1a6, CAR-2B5, respectively, with the expression cassette of CAR constructed against the light and heavy chain variable region scFv targeting the claudin18.2 antibody as control, designated CAR-007, as shown in figure 6.
As shown in FIG. 6, Claudin18.2 scFv/TM/4-1BB/CD3 ζ represents a chimeric antigen receptor expressed on the cell membrane of an immune cell.
Cloning the expression cassette into PHBV lentiviral vector backbone, placing under the promoter of EF1 alpha (EF-1 alpha) to form PHBVV-EF 1 alpha-CAR-1B 8, PHBV-EF 1 alpha-CAR-1B 10, PHBV-EF 1 alpha-CAR-1A 6, PHBV-EF 1 alpha-CAR-2B 5 and PHBV-EF 1 alpha-CAR-007, and transferring the PHBV-EF 1 alpha-CAR-1B 8, PHBV-EF 1 alpha-CAR-1B 10, PHBV-EF 1 alpha-CAR-1A 6, PHBV-1 alpha-CAR-2B 5 and PHBV-1 alpha-CAR-007, lentiviral envelope Plasmid pMD2.G (Addgene, Plasmid 12259) and lentiviral packaging Plasmid PAX2(Addgene 122plasmid 6760) into whole strain 293 Plasmid 3000 using Lipoplaid Plasmid expressing Lipoplex # 3000; after the cells are cultured for 48h and 72h, the cells are transferred into a centrifuge tube for centrifugal treatment, virus supernatant is collected after the centrifugal treatment is stopped, and the supernatant is subjected to ultracentrifugation concentration (Merck Millipore); the concentrated virus is ready for infecting T cells.
S900: CAR-T cell preparation.
9.1 Lentiviral infection
After the primary T cells separated and purified in the step S700 are reactivated for 1 day, the 5 lentiviruses (Lv-CAR-1B8, Lv-CAR-1B10, Lv-CAR-1A6, Lv-CAR-2B5, Lv-CAR-007) packaged in the step S800 are used for lentivirus vector infection according to MOI (1-10), and the virus-infected T cells are transferred to a cell culture flask and placed at 37 ℃ and 5% CO 2 Culturing in a constant temperature incubator.
9.2 cell proliferation and CAR Positive Rate detection
And (3) sampling and detecting the cell number on 6 th, 9 th, 11 th and 13 th days after the T cells are infected, respectively detecting the CAR positive rate of the T cells on 6 th day, and subculturing and supplementing the culture medium every 1-2 days.
Using the 5 lentiviral vectors of step S800, 5 CAR-T cells were successfully constructed, named CAR-1B8, CAR-1B10, CAR-1A6, CAR-2B5, CAR-007, respectively, with T cells not infected with lentivirus as controls (NT).
As shown in FIG. 7, the growth rates of 5 cells were not significantly different from each other under the same culture conditions.
As shown in FIGS. 8a, 8B, 8c, 8d, 8e and 8f, the expression of the CAR tested on day 6 of NT cells, CAR-007, CAR-1B8, CAR-1B10, CAR-1A6 and CAR-2B5 is shown, the right side of the vertical line in the figure is the positive proportion of CAR, and it can be seen from the figure that different scFv have no significant effect on the positive rate of CAR.
S1000: CAR-T to 293T-hClaudin18.2 cell killing
Performing an in vitro killing experiment on the 5 CAR-T cells obtained in the step S900, detecting the killing effect of the CAR-T cells by adopting an LDH method (promega: G1780), incubating the target cells and the effector cells for 6h, wherein the killing efficiency is obvious, and the result is shown in FIG. 9, and FIG. 9a shows that CAR-007, CAR-1B8, CAR-1B10, CAR-1A6 and CAR-2B5 all have no killing effect on 293T cells, which indicates that the cells have no killing activity on non-target cells; it is shown in FIG. 9B that CAR-1B8, CAR-1B10, CAR-1A6, CAR-2B5 all had essentially comparable or superior killing effects on 293T-hClaudin18.2 cells compared to the control CAR-007.
The above-mentioned embodiments only express one embodiment of the present invention, and the description thereof is more specific and detailed, but not construed as limiting the scope of the invention. It should be noted that, for a person skilled in the art, several variations and modifications can be made without departing from the inventive concept, which falls within the scope of the present invention. Therefore, the protection scope of the present patent shall be subject to the appended claims.
Sequence listing
<110> Shenzhen Shenxian Shen
<120> monoclonal antibody targeting human Claudin18.2 protein and application thereof
<160> 16
<170> SIPOSequenceListing 1.0
<210> 1
<211> 411
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 1
atggctgtcc tggcgctact cctctgcctg gtgactttcc caagctgtgc cctgtcccag 60
gtgcagctga aggagtcagg acctggcctg gtggcgccct cacagagcct gtccatcaca 120
tgcactgtct ctgggttctc attaaacagc tatattataa actgggttcg ccagtcacca 180
ggaaagggtc tggactggct tggagtaata tggactggtg gaggcacaaa ttataattca 240
gcgctcaaat ccagactgag catcaccaaa gacaactcca agagtcaagt tttcttaaaa 300
atgaacagtc tgcaaactga tgacacagcc aggtactact gtgccagagg ggcctattat 360
ggtaatgcta tggactactg gggtcaagga acctcagtca ccgtctcctc a 411
<210> 9
<211> 137
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 9
Met Ala Val Leu Ala Leu Leu Leu Cys Leu Val Thr Phe Pro Ser Cys
1 5 10 15
Ala Leu Ser Gln Val Gln Leu Lys Glu Ser Gly Pro Gly Leu Val Ala
20 25 30
Pro Ser Gln Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu
35 40 45
Asn Ser Tyr Ile Ile Asn Trp Val Arg Gln Ser Pro Gly Lys Gly Leu
50 55 60
Asp Trp Leu Gly Val Ile Trp Thr Gly Gly Gly Thr Asn Tyr Asn Ser
65 70 75 80
Ala Leu Lys Ser Arg Leu Ser Ile Thr Lys Asp Asn Ser Lys Ser Gln
85 90 95
Val Phe Leu Lys Met Asn Ser Leu Gln Thr Asp Asp Thr Ala Arg Tyr
100 105 110
Tyr Cys Ala Arg Gly Ala Tyr Tyr Gly Asn Ala Met Asp Tyr Trp Gly
115 120 125
Gln Gly Thr Ser Val Thr Val Ser Ser
130 135
<210> 2
<211> 399
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 2
atggaatcac agactcaggt cctcatgtcc ctgctgttct gggtatctgg tacctgtggg 60
gacattgtga tgacacagtc tccatcctcc ctgactgtga cagcaggaga gaaggtcact 120
atgaactgca agtccagtca gagtctgtta aacagtggaa atcaaaagaa ctacttgacc 180
tggtaccagc agaaaccagg gcagcctcct aaactgttga tctactgggc atccactagg 240
gaatctgggg tccctgatcg cttcacaggc agtggatctg gaacagattt cactctcacc 300
atcagcagtg tgcaggctga agacctggca gtttattact gtcagaatgc ttatagttat 360
ccattcacgt tcggctcgga gacaaagttg gaaataaaa 399
<210> 10
<211> 133
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 10
Met Glu Ser Gln Thr Gln Val Leu Met Ser Leu Leu Phe Trp Val Ser
1 5 10 15
Gly Thr Cys Gly Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Thr
20 25 30
Val Thr Ala Gly Glu Lys Val Thr Met Asn Cys Lys Ser Ser Gln Ser
35 40 45
Leu Leu Asn Ser Gly Asn Gln Lys Asn Tyr Leu Thr Trp Tyr Gln Gln
50 55 60
Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg
65 70 75 80
Glu Ser Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp
85 90 95
Phe Thr Leu Thr Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Val Tyr
100 105 110
Tyr Cys Gln Asn Ala Tyr Ser Tyr Pro Phe Thr Phe Gly Ser Glu Thr
115 120 125
Lys Leu Glu Ile Lys
130
<210> 3
<211> 411
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 3
atggctgtcc tggcgctact cctctgcctg gtgactttcc caagctgtgc cctgtcccag 60
gtgcagctga aggagtcagg acctggcctg gtggcgccct cacagagcct gtccatcaca 120
tgcactgtct ctgggttctc attaactagt tatgttataa actgggttcg ccagccacca 180
ggaaagggtc tggagtggct tggagtaata tggactggtg gaggcacaaa ttataattca 240
gctctcaaat ccagactgag catcagcaaa gacacctcca agagtcaagt tttcttaaag 300
atgaacagtc tgcaaactga tgacacagcc aggtattact gtgccagagg ggcctactat 360
ggtaatgcta tggactactg gggtcaagga acctcagtca ccgtctcctc a 411
<210> 11
<211> 137
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 11
Met Ala Val Leu Ala Leu Leu Leu Cys Leu Val Thr Phe Pro Ser Cys
1 5 10 15
Ala Leu Ser Gln Val Gln Leu Lys Glu Ser Gly Pro Gly Leu Val Ala
20 25 30
Pro Ser Gln Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu
35 40 45
Thr Ser Tyr Val Ile Asn Trp Val Arg Gln Pro Pro Gly Lys Gly Leu
50 55 60
Glu Trp Leu Gly Val Ile Trp Thr Gly Gly Gly Thr Asn Tyr Asn Ser
65 70 75 80
Ala Leu Lys Ser Arg Leu Ser Ile Ser Lys Asp Thr Ser Lys Ser Gln
85 90 95
Val Phe Leu Lys Met Asn Ser Leu Gln Thr Asp Asp Thr Ala Arg Tyr
100 105 110
Tyr Cys Ala Arg Gly Ala Tyr Tyr Gly Asn Ala Met Asp Tyr Trp Gly
115 120 125
Gln Gly Thr Ser Val Thr Val Ser Ser
130 135
<210> 4
<211> 399
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 4
atggaatcac agactcaggt cctcatgtcc ctgctgttct gggtatctgg tacctgtggg 60
gacattgtga tgacacagtc tccatcctcc ctgactgtga cagcaggaga gaaggtcact 120
atgagctgca agtccagtca gagtctgtta aacagtggaa atcaaaagaa ctacttaacc 180
tggtaccagc agaaaccagg gcagcctcct aaattgttga tctattgggc agccactagg 240
gaatctgggg tccctgatcg cttcacaggc agtggatctg gaacagattt cactctcacc 300
atcagcagtg tgcaggctga agacctggca gtttattact gtcagaatga ttatagttat 360
ccattcacgt tcggctcggg gacaaaattg gaaataaaa 399
<210> 12
<211> 133
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 12
Met Glu Ser Gln Thr Gln Val Leu Met Ser Leu Leu Phe Trp Val Ser
1 5 10 15
Gly Thr Cys Gly Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Thr
20 25 30
Val Thr Ala Gly Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser
35 40 45
Leu Leu Asn Ser Gly Asn Gln Lys Asn Tyr Leu Thr Trp Tyr Gln Gln
50 55 60
Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ala Thr Arg
65 70 75 80
Glu Ser Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp
85 90 95
Phe Thr Leu Thr Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Val Tyr
100 105 110
Tyr Cys Gln Asn Asp Tyr Ser Tyr Pro Phe Thr Phe Gly Ser Gly Thr
115 120 125
Lys Leu Glu Ile Lys
130
<210> 5
<211> 411
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 5
atgggatgga gctatatcat cctctttttg gtagcaacat ctacaggtgt ccactcccag 60
gtccaactgc agcagcctgg ggctgagctg gtaaagcctg gggcctcagt gaagttgtcc 120
tgcaaggctt ctggctacac tttcaccagc tactggatgc agtgggtgaa gcagaggcct 180
ggacaaggcc ttgagtggat tggaatgact catcctaaca gtggtggtac taactacaat 240
gagaagttca agagcaaggc cacactgact gtagacaaat cctccagcac agcctacatg 300
caactcagca gcctgacatc tgaggactct gcggtctatt actgtgcaag actgggtcgg 360
ggaaatgcta tggactactg gggtcaagga acctcagtca ccgtctcctc a 411
<210> 13
<211> 137
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 13
Met Gly Trp Ser Tyr Ile Ile Leu Phe Leu Val Ala Thr Ser Thr Gly
1 5 10 15
Val His Ser Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Lys
20 25 30
Pro Gly Ala Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe
35 40 45
Thr Ser Tyr Trp Met Gln Trp Val Lys Gln Arg Pro Gly Gln Gly Leu
50 55 60
Glu Trp Ile Gly Met Thr His Pro Asn Ser Gly Gly Thr Asn Tyr Asn
65 70 75 80
Glu Lys Phe Lys Ser Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser
85 90 95
Thr Ala Tyr Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val
100 105 110
Tyr Tyr Cys Ala Arg Leu Gly Arg Gly Asn Ala Met Asp Tyr Trp Gly
115 120 125
Gln Gly Thr Ser Val Thr Val Ser Ser
130 135
<210> 6
<211> 399
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 6
atggaatcac agactcaggt cctcatgtcc ctgctgttct gggtatctgg tacctgtggg 60
gacattgtga tgacacagtc tccatcctcc ctgactgtga cagcaggaga gaaggtcact 120
atgagctgca agtccagtca gagtctgtta aacagtggaa atcaaaagaa ctacttgacc 180
tggtaccagc agaaaccagg gcagcctcct aaactgttga tctactgggc atccactagg 240
aaatctgggg tccctgatcg cttcacaggc agtggatctg gaacagattt cactctcacc 300
atcagcagtg tgcaggctga agacctgaca atttattact gtcagaatga ttatagttat 360
ccattcacgt tcggctcggg gacaaagttg gaaataaaa 399
<210> 14
<211> 133
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 14
Met Glu Ser Gln Thr Gln Val Leu Met Ser Leu Leu Phe Trp Val Ser
1 5 10 15
Gly Thr Cys Gly Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Thr
20 25 30
Val Thr Ala Gly Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser
35 40 45
Leu Leu Asn Ser Gly Asn Gln Lys Asn Tyr Leu Thr Trp Tyr Gln Gln
50 55 60
Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg
65 70 75 80
Lys Ser Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp
85 90 95
Phe Thr Leu Thr Ile Ser Ser Val Gln Ala Glu Asp Leu Thr Ile Tyr
100 105 110
Tyr Cys Gln Asn Asp Tyr Ser Tyr Pro Phe Thr Phe Gly Ser Gly Thr
115 120 125
Lys Leu Glu Ile Lys
130
<210> 7
<211> 417
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 7
atgaacttcg ggctcagatt gattttcctt gtccttactt taaaaggtgt ccagtgtgac 60
gtgaagttgg tggagtctgg ggaaggctta gtgaagcctg gagggtccct gaaactctcc 120
tgtgcagccg ctggattcac tttcagtagc tatgccatgt cttgggttcg ccagactcca 180
gagaagaggc tggagtgggt cgcatacatt agtagtggtg gtgattacat ctactatgca 240
gacactgtga agggccgatt caccatctcc agagacaatg ccaggaacac cctgtacctg 300
caaatgagca gtctgaagtc tgaggacaca gccatgtatt actgttcaag actcaggcta 360
cgtggaggaa atgctatgga ctactggggt caaggaacct cagtcaccgt ctcctca 417
<210> 15
<211> 139
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 15
Met Asn Phe Gly Leu Arg Leu Ile Phe Leu Val Leu Thr Leu Lys Gly
1 5 10 15
Val Gln Cys Asp Val Lys Leu Val Glu Ser Gly Glu Gly Leu Val Lys
20 25 30
Pro Gly Gly Ser Leu Lys Leu Ser Cys Ala Ala Ala Gly Phe Thr Phe
35 40 45
Ser Ser Tyr Ala Met Ser Trp Val Arg Gln Thr Pro Glu Lys Arg Leu
50 55 60
Glu Trp Val Ala Tyr Ile Ser Ser Gly Gly Asp Tyr Ile Tyr Tyr Ala
65 70 75 80
Asp Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Arg Asn
85 90 95
Thr Leu Tyr Leu Gln Met Ser Ser Leu Lys Ser Glu Asp Thr Ala Met
100 105 110
Tyr Tyr Cys Ser Arg Leu Arg Leu Arg Gly Gly Asn Ala Met Asp Tyr
115 120 125
Trp Gly Gln Gly Thr Ser Val Thr Val Ser Ser
130 135
<210> 8
<211> 399
<212> DNA
<213> Artificial sequence (2 Ambystoma latex x Ambystoma jeffersonia)
<400> 8
atggaatcac agactcaggt cctcatgtcc ctgctgttct gggtatctgg tacctgtggg 60
gacattgtga tgacacagtc tccatcctcc ctgactgtga cagcaggaga gaaagtcact 120
atgagctgca agtccagtca gagtctgtta aacagtggaa atcaaaagaa ctacttgacc 180
tggtaccagc agaaaccagg gcagcctcct aaactgttga tctactgggc atccactagg 240
gaatctgggg tccctgatcg cttcacaggc agtggatctg gaacagattt cactctcacc 300
atcagcagtg tgcaggctga agacctggca gtttattact gtcagaatga ttatgcttat 360
ccgctcacgt tcggtactgg gaccaagctg gagctgaaa 399
<210> 16
<211> 133
<212> PRT
<213> Artificial sequence (2 Ambystoma latex x Ambystoma texanum)
<400> 16
Met Glu Ser Gln Thr Gln Val Leu Met Ser Leu Leu Phe Trp Val Ser
1 5 10 15
Gly Thr Cys Gly Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Thr
20 25 30
Val Thr Ala Gly Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser
35 40 45
Leu Leu Asn Ser Gly Asn Gln Lys Asn Tyr Leu Thr Trp Tyr Gln Gln
50 55 60
Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg
65 70 75 80
Glu Ser Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp
85 90 95
Phe Thr Leu Thr Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Val Tyr
100 105 110
Tyr Cys Gln Asn Asp Tyr Ala Tyr Pro Leu Thr Phe Gly Thr Gly Thr
115 120 125
Lys Leu Glu Leu Lys
130

Claims (9)

1. A monoclonal antibody targeting a human Claudin18.2 protein, wherein the monoclonal antibody comprises a heavy chain variable region HV and a light chain variable region LV, and the amino acid sequence and the nucleic acid sequence of the monoclonal antibody are as follows:
E) HV nucleic acid sequence:
ATGGGATGGAGCTATATCATCCTCTTTTTGGTAGCAACATCTACAGGTGTCCACTCCCAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAGCCTGGGGCCTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACTTTCACCA GCTACTGGATGCAGTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGAATGACTCATCCTAACAGTGG TGGTACTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGACTGGGTCGGGGAAATGCTATGGACT ACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA, respectively; wherein:
E-CDR1 representsGGCTACACTTTCACCAGCTACTGG
E-CDR2 denotesACTCATCCTAACAGTGGTGGTACT
E-CDR3 representsGCAAGACTGGGTCGGGGAAATGCTATGGACTAC
e) HV amino acid sequence:
MGWSYIILFLVATSTGVHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGMTHP NSGGTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARLGRGNAMDYWGQGTSVTVSS, respectively; wherein:
e-CDR1 denotesGYTFTSYW
e-CDR2 denotesTHPNSGGT
e-CDR3 denotesARLGRGNAMDY
F) LV nucleic acid sequence:
ATGGAATCACAGACTCAGGTCCTCATGTCCCTGCTGTTCTGGGTATCTGGTACCTGTGGGGACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAGGTCACTATGAGCTGCAAGTCCAGTCAGAGTCTGT TAAACAGTGGAAATCAAAAGAACTACTTGACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAACTGTTGATCTACTGGGCATCCACTAGGAAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGACAATTTATTACTGTCAGAATGATTATAGTTATCCATTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAA, respectively; wherein:
F-CDR1 representsCAGAGTCTGTTAAACAGTGGAAATCAAAAGAACTAC
F-CDR2 representsTGGGCATCC
F-CDR3 representsCAGAATGATTATAGTTATCCATTCACG
f) LV amino acid sequence:
MESQTQVLMSLLFWVSGTCGDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRKSGVPDRFTGSGSGTDFTLTISSVQAEDLTIYYCQNDYSYPFTFGSGTKLEIK, respectively; wherein:
f-CDR1 representsQSLLNSGNQKNY
f-CDR2 representsWAS
f-CDR3 representsQNDYSYPFT
2. The monoclonal antibody of claim 1, wherein the amino acid sequence of the monoclonal antibody is selected from the group consisting of:
the amino acid sequence e) of the heavy chain variable region HV is used in combination with the amino acid sequence f) of the light chain variable region LV.
3. The monoclonal antibody of claim 1, wherein the nucleic acid sequence of the monoclonal antibody is selected from the group consisting of:
the nucleic acid sequence E) of the heavy chain variable region HV is used double-stranded in combination with the nucleic acid sequence F) of the light chain variable region LV.
4. The monoclonal antibody according to claim 1, which is of murine origin and has three complementarity determining regions in the heavy chain variable region HV and the light chain variable region LV corresponding to the amino acid sequence and the nucleic acid sequence, respectively, and the complementarity determining regions are the amino acid sequence and the nucleic acid sequence corresponding to CDR1, CDR2 and CDR3, respectively.
5. The monoclonal antibody of claim 4, wherein the amino acid sequence and/or nucleic acid sequence of the three CDRs 1, 2, and 3 is changed to 0 when the monoclonal antibody is humanized or otherwise engineered to be of animal origin.
6. A biological material comprising an expression cassette, recombinant vector, recombinant protein, recombinant microorganism or recombinant cell line constructed from a nucleic acid sequence or amino acid sequence derived from a monoclonal antibody according to any one of claims 1 to 5.
7. The biomaterial of claim 6, wherein the recombinant vector comprises a recombinant gene expression vector and a chimeric antigen receptor.
8. A biological agent comprising the monoclonal antibody of any one of claims 1 to 5.
9. The biological agent of claim 8, wherein the biological agent comprises a reagent for detecting the concentration of human Claudin18.2 protein, a reagent for detecting the degree of expression of human Claudin18.2 protein on the surface of tumor cells, a reagent for performing antibody-mediated complement-dependent or cell-dependent cytotoxic reaction on human Claudin18.2 positive cells, a reagent for killing human Claudin18.2 positive cells by antibody-coupled toxins, a functional recombinant protein for targeting human Claudin18.2 by antibody-coupled other antibodies, a chimeric antigen receptor immune cell for targeting human Claudin18.2 positive cells by antibody-coupled other proteins, and a polyclonal antibody for targeting human Claudin 18.2.
CN202210517857.5A 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof Active CN115057930B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202210517857.5A CN115057930B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CN202111031017.XA CN113788894B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN202210517857.5A CN115057930B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
CN202111031017.XA Division CN113788894B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof

Publications (2)

Publication Number Publication Date
CN115057930A true CN115057930A (en) 2022-09-16
CN115057930B CN115057930B (en) 2022-11-29

Family

ID=79182716

Family Applications (4)

Application Number Title Priority Date Filing Date
CN202111031017.XA Active CN113788894B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN202210517873.4A Active CN114907482B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN202210517857.5A Active CN115057930B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN202210517876.8A Active CN114751984B (en) 2021-09-03 2021-09-03 Monoclonal antibody of targeted human Claudin18.2 protein and application thereof

Family Applications Before (2)

Application Number Title Priority Date Filing Date
CN202111031017.XA Active CN113788894B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN202210517873.4A Active CN114907482B (en) 2021-09-03 2021-09-03 Monoclonal antibody targeting human Claudin18.2 protein and application thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
CN202210517876.8A Active CN114751984B (en) 2021-09-03 2021-09-03 Monoclonal antibody of targeted human Claudin18.2 protein and application thereof

Country Status (1)

Country Link
CN (4) CN113788894B (en)

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023174405A1 (en) * 2022-03-18 2023-09-21 广东东阳光药业股份有限公司 Claudin18.2 humanized antibody and application thereof
CN117903310A (en) * 2022-11-30 2024-04-19 华道(上海)生物医药有限公司 Heavy chain antibody against CLDN18.2, related products and uses
CN116143924A (en) * 2023-02-07 2023-05-23 深圳市先康达生命科学有限公司 Humanized monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN116813782B (en) * 2023-08-10 2024-01-23 北京百普赛斯生物科技股份有限公司 Claudin-18.2 specific antibody and application thereof
CN116903745B (en) * 2023-09-13 2023-11-14 苏州仁端生物医药科技有限公司 Monoclonal antibody against human Claudin18.2 and application thereof
CN117327182B (en) * 2023-09-19 2024-06-04 上海交通大学医学院附属仁济医院 Preparation method and application of CLDN18.2 single domain antibody probe

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101584860A (en) * 2009-04-27 2009-11-25 西安杰诺瓦生物科技有限公司 Recombinant human Claudin18.2 tumor vaccine and preparation method thereof
CN110746508A (en) * 2018-07-23 2020-02-04 上海细胞治疗集团有限公司 Monoclonal antibody specifically binding to mesothelin and chimeric antigen receptor
US20210261658A1 (en) * 2018-08-22 2021-08-26 Reyoung (Suzhou) Biology Science & Technology Co., Ltd Anti-human claudin 18.2 monoclonal antibody and application thereof

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013167153A1 (en) * 2012-05-09 2013-11-14 Ganymed Pharmaceuticals Ag Antibodies useful in cancer diagnosis
WO2013174403A1 (en) * 2012-05-23 2013-11-28 Ganymed Pharmaceuticals Ag Combination therapy involving antibodies against claudin 18.2 for treatment of cancer
SG11201900171QA (en) * 2016-07-08 2019-02-27 Carsgen Therapeutics Co Ltd Antibody for anti-claudin 18a2 and use thereof
CN111518214B (en) * 2019-02-03 2023-09-22 上海健信生物医药科技有限公司 Bispecific antibody targeting CLDN18.2 as well as preparation method and application thereof
CN110746505B (en) * 2018-07-23 2023-04-14 上海细胞治疗集团有限公司 Monoclonal antibody specifically binding to mesothelin and chimeric antigen receptor
TW202023613A (en) * 2018-08-27 2020-07-01 大陸商南京聖和藥業股份有限公司 Anti-claudin182 antibody and use thereof
CN112159475B (en) * 2020-10-10 2021-04-30 南京凯地生物科技有限公司 Siglec-15 monoclonal antibody and application thereof
CN112830969B (en) * 2021-01-29 2022-07-26 江苏诺迈博生物医药科技有限公司 Monoclonal antibody specifically binding to human Claudin18.2, and medicine and kit containing monoclonal antibody
CN112940124B (en) * 2021-04-14 2022-04-05 南京凯地医疗技术有限公司 Humanized monoclonal antibody targeting Claudin18.2 and preparation method and application thereof

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101584860A (en) * 2009-04-27 2009-11-25 西安杰诺瓦生物科技有限公司 Recombinant human Claudin18.2 tumor vaccine and preparation method thereof
CN110746508A (en) * 2018-07-23 2020-02-04 上海细胞治疗集团有限公司 Monoclonal antibody specifically binding to mesothelin and chimeric antigen receptor
US20210261658A1 (en) * 2018-08-22 2021-08-26 Reyoung (Suzhou) Biology Science & Technology Co., Ltd Anti-human claudin 18.2 monoclonal antibody and application thereof

Also Published As

Publication number Publication date
CN114907482A (en) 2022-08-16
CN113788894A (en) 2021-12-14
CN115057930B (en) 2022-11-29
CN114751984A (en) 2022-07-15
CN114751984B (en) 2023-02-14
CN113788894B (en) 2022-08-05
CN114907482B (en) 2023-02-14

Similar Documents

Publication Publication Date Title
CN113788894B (en) Monoclonal antibody targeting human Claudin18.2 protein and application thereof
CN110950953B (en) Monoclonal antibody against B7-H3 and application thereof in cell therapy
JP7299294B2 (en) CHIMERIC ANTIGEN RECEPTOR TARGETING BCMA AND METHOD FOR PRODUCING AND USE THEREOF
CN110818802B (en) Chimeric T cell receptor STAR and application thereof
US20230357385A1 (en) Anti-gpc3 antibody, anti-gpc3 chimeric antigen receptor and gpc3/cd3 bispecific antibody
CN115515983A (en) Humanized CD19 antibodies and uses thereof
WO2023109976A2 (en) Antibody against ox40 and medical use thereof
CN116589584A (en) Antibodies or fragments thereof targeting human Nectin4 protein and uses thereof
CN109970859B (en) Glyphican-3 specific antibody and CAR-T cell specific to the same
CN113603779B (en) Antibody combined with human lymphocyte activation gene 3 (LAG-3) and application thereof
KR102393776B1 (en) Humanized antibody specific for CD22 and chimeric antigen receptor using the same
WO2021139755A1 (en) Engineered t cell, and preparation and use thereof
CN115873115A (en) Application of anti-4-1 BB monoclonal antibody in tumor immunotherapy
CN116813784B (en) Antibodies targeting DLL3 and uses thereof
CN113005088B (en) Engineered T cells, their preparation and use
WO2023273762A1 (en) Spatial conformational epitope mediating efficient retention of cd3 within cells and application thereof
CN116284419A (en) Monoclonal antibody targeting human GUCY2C protein and application thereof
US20240067737A1 (en) Humanized Anti-GDNF family alpha-receptor 4 (GRF-alpha-4) Antibodies and Chimeric Antigen Receptors (CARs)
TW202235436A (en) Siglec-15 binding protein and preparation and use thereof
CN117186235A (en) Bispecific antibody of anti-4-1 BB/anti-EGFRvIII, preparation method and application thereof
CN117343177A (en) Camel heavy chain antibody or antigen binding fragment and application thereof
CN116554327A (en) Antibodies, chimeric antigen receptors, and uses thereof, that specifically bind c-Met
CN117794951A (en) Claudin 18.2T cell antigen conjugate and application thereof

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant