CN113769080A - Polypeptide immunoconjugates and uses thereof - Google Patents
Polypeptide immunoconjugates and uses thereof Download PDFInfo
- Publication number
- CN113769080A CN113769080A CN202111092938.7A CN202111092938A CN113769080A CN 113769080 A CN113769080 A CN 113769080A CN 202111092938 A CN202111092938 A CN 202111092938A CN 113769080 A CN113769080 A CN 113769080A
- Authority
- CN
- China
- Prior art keywords
- polypeptide
- immunoconjugate
- rbd
- vaccine
- adjuvant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 135
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 109
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 108
- 229940127121 immunoconjugate Drugs 0.000 title claims abstract description 62
- 241000711573 Coronaviridae Species 0.000 claims abstract description 59
- 229960005486 vaccine Drugs 0.000 claims abstract description 49
- 101710139375 Corneodesmosin Proteins 0.000 claims abstract description 34
- 102100031673 Corneodesmosin Human genes 0.000 claims abstract description 34
- 206010035664 Pneumonia Diseases 0.000 claims abstract description 13
- 239000002671 adjuvant Substances 0.000 claims description 48
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 33
- 238000000034 method Methods 0.000 claims description 20
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims description 19
- 230000002788 anti-peptide Effects 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 16
- 210000002966 serum Anatomy 0.000 claims description 12
- 238000002360 preparation method Methods 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 8
- 239000007924 injection Substances 0.000 claims description 7
- 238000002347 injection Methods 0.000 claims description 7
- 241001465754 Metazoa Species 0.000 claims description 6
- 108091034117 Oligonucleotide Proteins 0.000 claims description 6
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 6
- 150000002632 lipids Chemical class 0.000 claims description 6
- 230000002265 prevention Effects 0.000 claims description 6
- 230000003053 immunization Effects 0.000 claims description 5
- 230000004936 stimulating effect Effects 0.000 claims description 5
- BLSAPDZWVFWUTL-UHFFFAOYSA-N 2,5-dioxopyrrolidine-3-sulfonic acid Chemical group OS(=O)(=O)C1CC(=O)NC1=O BLSAPDZWVFWUTL-UHFFFAOYSA-N 0.000 claims description 4
- NZNMSOFKMUBTKW-UHFFFAOYSA-N cyclohexanecarboxylic acid Chemical compound OC(=O)C1CCCCC1 NZNMSOFKMUBTKW-UHFFFAOYSA-N 0.000 claims description 4
- 239000002552 dosage form Substances 0.000 claims description 3
- 239000007927 intramuscular injection Substances 0.000 claims description 3
- 238000010255 intramuscular injection Methods 0.000 claims description 3
- 238000002156 mixing Methods 0.000 claims description 3
- 239000007929 subcutaneous injection Substances 0.000 claims description 3
- 238000010254 subcutaneous injection Methods 0.000 claims description 3
- 230000003472 neutralizing effect Effects 0.000 abstract description 10
- 102000004169 proteins and genes Human genes 0.000 description 17
- 108090000623 proteins and genes Proteins 0.000 description 17
- 239000000243 solution Substances 0.000 description 15
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 13
- 230000001976 improved effect Effects 0.000 description 11
- 108091005634 SARS-CoV-2 receptor-binding domains Proteins 0.000 description 10
- 229910021502 aluminium hydroxide Inorganic materials 0.000 description 10
- 239000011347 resin Substances 0.000 description 10
- 229920005989 resin Polymers 0.000 description 10
- 230000000694 effects Effects 0.000 description 9
- 230000005847 immunogenicity Effects 0.000 description 9
- 239000002773 nucleotide Substances 0.000 description 9
- 125000003729 nucleotide group Chemical group 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 6
- 241000700605 Viruses Species 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 4
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 4
- 241001112090 Pseudovirus Species 0.000 description 4
- 229940001007 aluminium phosphate Drugs 0.000 description 4
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- 208000025721 COVID-19 Diseases 0.000 description 2
- 241001678559 COVID-19 virus Species 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 2
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- GBIUHAYJGWVNLN-AEJSXWLSSA-N Val-Ser-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N GBIUHAYJGWVNLN-AEJSXWLSSA-N 0.000 description 2
- GBIUHAYJGWVNLN-UHFFFAOYSA-N Val-Ser-Pro Natural products CC(C)C(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O GBIUHAYJGWVNLN-UHFFFAOYSA-N 0.000 description 2
- 210000000683 abdominal cavity Anatomy 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- CMWYAOXYQATXSI-UHFFFAOYSA-N n,n-dimethylformamide;piperidine Chemical compound CN(C)C=O.C1CCNCC1 CMWYAOXYQATXSI-UHFFFAOYSA-N 0.000 description 2
- 239000003960 organic solvent Substances 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 239000011550 stock solution Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- CWFMWBHMIMNZLN-NAKRPEOUSA-N (2s)-1-[(2s)-2-[[(2s,3s)-2-amino-3-methylpentanoyl]amino]propanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O CWFMWBHMIMNZLN-NAKRPEOUSA-N 0.000 description 1
- BQRXMLXVGQMIBO-UHFFFAOYSA-N 1,1-bis(sulfanyl)ethanol Chemical compound CC(O)(S)S BQRXMLXVGQMIBO-UHFFFAOYSA-N 0.000 description 1
- NMXKFWOEASXOGB-QSFUFRPTSA-N Ala-Ile-His Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 NMXKFWOEASXOGB-QSFUFRPTSA-N 0.000 description 1
- AJBVYEYZVYPFCF-CIUDSAMLSA-N Ala-Lys-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O AJBVYEYZVYPFCF-CIUDSAMLSA-N 0.000 description 1
- PEEYDECOOVQKRZ-DLOVCJGASA-N Ala-Ser-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O PEEYDECOOVQKRZ-DLOVCJGASA-N 0.000 description 1
- ARHJJAAWNWOACN-FXQIFTODSA-N Ala-Ser-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O ARHJJAAWNWOACN-FXQIFTODSA-N 0.000 description 1
- AQPVUEJJARLJHB-BQBZGAKWSA-N Arg-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCCN=C(N)N AQPVUEJJARLJHB-BQBZGAKWSA-N 0.000 description 1
- FNXCAFKDGBROCU-STECZYCISA-N Arg-Ile-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FNXCAFKDGBROCU-STECZYCISA-N 0.000 description 1
- CZUHPNLXLWMYMG-UBHSHLNASA-N Arg-Phe-Ala Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CC1=CC=CC=C1 CZUHPNLXLWMYMG-UBHSHLNASA-N 0.000 description 1
- INXWADWANGLMPJ-JYJNAYRXSA-N Arg-Phe-Arg Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)CC1=CC=CC=C1 INXWADWANGLMPJ-JYJNAYRXSA-N 0.000 description 1
- LXMKTIZAGIBQRX-HRCADAONSA-N Arg-Phe-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O LXMKTIZAGIBQRX-HRCADAONSA-N 0.000 description 1
- IARGXWMWRFOQPG-GCJQMDKQSA-N Asn-Ala-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IARGXWMWRFOQPG-GCJQMDKQSA-N 0.000 description 1
- DAPLJWATMAXPPZ-CIUDSAMLSA-N Asn-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(N)=O DAPLJWATMAXPPZ-CIUDSAMLSA-N 0.000 description 1
- ZWASIOHRQWRWAS-UGYAYLCHSA-N Asn-Asp-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O ZWASIOHRQWRWAS-UGYAYLCHSA-N 0.000 description 1
- UGXVKHRDGLYFKR-CIUDSAMLSA-N Asn-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(N)=O UGXVKHRDGLYFKR-CIUDSAMLSA-N 0.000 description 1
- CZIXHXIJJZLYRJ-SRVKXCTJSA-N Asn-Cys-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 CZIXHXIJJZLYRJ-SRVKXCTJSA-N 0.000 description 1
- DMLSCRJBWUEALP-LAEOZQHASA-N Asn-Glu-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O DMLSCRJBWUEALP-LAEOZQHASA-N 0.000 description 1
- OOWSBIOUKIUWLO-RCOVLWMOSA-N Asn-Gly-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O OOWSBIOUKIUWLO-RCOVLWMOSA-N 0.000 description 1
- SUEIIIFUBHDCCS-PBCZWWQYSA-N Asn-His-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SUEIIIFUBHDCCS-PBCZWWQYSA-N 0.000 description 1
- IBLAOXSULLECQZ-IUKAMOBKSA-N Asn-Ile-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC(N)=O IBLAOXSULLECQZ-IUKAMOBKSA-N 0.000 description 1
- UHGUKCOQUNPSKK-CIUDSAMLSA-N Asn-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)N)N UHGUKCOQUNPSKK-CIUDSAMLSA-N 0.000 description 1
- NCFJQJRLQJEECD-NHCYSSNCSA-N Asn-Leu-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O NCFJQJRLQJEECD-NHCYSSNCSA-N 0.000 description 1
- ZYPWIUFLYMQZBS-SRVKXCTJSA-N Asn-Lys-Lys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N ZYPWIUFLYMQZBS-SRVKXCTJSA-N 0.000 description 1
- HBUJSDCLZCXXCW-YDHLFZDLSA-N Asn-Val-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HBUJSDCLZCXXCW-YDHLFZDLSA-N 0.000 description 1
- HRGGPWBIMIQANI-GUBZILKMSA-N Asp-Gln-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HRGGPWBIMIQANI-GUBZILKMSA-N 0.000 description 1
- VNXQRBXEQXLERQ-CIUDSAMLSA-N Asp-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)N VNXQRBXEQXLERQ-CIUDSAMLSA-N 0.000 description 1
- ZQFRDAZBTSFGGW-SRVKXCTJSA-N Asp-Ser-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O ZQFRDAZBTSFGGW-SRVKXCTJSA-N 0.000 description 1
- NJLLRXWFPQQPHV-SRVKXCTJSA-N Asp-Tyr-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O NJLLRXWFPQQPHV-SRVKXCTJSA-N 0.000 description 1
- PLOKOIJSGCISHE-BYULHYEWSA-N Asp-Val-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O PLOKOIJSGCISHE-BYULHYEWSA-N 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 229940022962 COVID-19 vaccine Drugs 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 235000019750 Crude protein Nutrition 0.000 description 1
- IDZDFWJNPOOOHE-KKUMJFAQSA-N Cys-Phe-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CS)N IDZDFWJNPOOOHE-KKUMJFAQSA-N 0.000 description 1
- QQOWCDCBFFBRQH-IXOXFDKPSA-N Cys-Phe-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CS)N)O QQOWCDCBFFBRQH-IXOXFDKPSA-N 0.000 description 1
- JLZCAZJGWNRXCI-XKBZYTNZSA-N Cys-Thr-Glu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O JLZCAZJGWNRXCI-XKBZYTNZSA-N 0.000 description 1
- JRZMCSIUYGSJKP-ZKWXMUAHSA-N Cys-Val-Asn Chemical compound SC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O JRZMCSIUYGSJKP-ZKWXMUAHSA-N 0.000 description 1
- YQEHNIKPAOPBNH-DCAQKATOSA-N Cys-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CS)N YQEHNIKPAOPBNH-DCAQKATOSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- HHWQMFIGMMOVFK-WDSKDSINSA-N Gln-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O HHWQMFIGMMOVFK-WDSKDSINSA-N 0.000 description 1
- YPMDZWPZFOZYFG-GUBZILKMSA-N Gln-Leu-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YPMDZWPZFOZYFG-GUBZILKMSA-N 0.000 description 1
- MLSKFHLRFVGNLL-WDCWCFNPSA-N Gln-Leu-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MLSKFHLRFVGNLL-WDCWCFNPSA-N 0.000 description 1
- HPCOBEHVEHWREJ-DCAQKATOSA-N Gln-Lys-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O HPCOBEHVEHWREJ-DCAQKATOSA-N 0.000 description 1
- UWMDGPFFTKDUIY-HJGDQZAQSA-N Gln-Pro-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O UWMDGPFFTKDUIY-HJGDQZAQSA-N 0.000 description 1
- DCWNCMRZIZSZBL-KKUMJFAQSA-N Gln-Pro-Tyr Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CCC(=O)N)N)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O DCWNCMRZIZSZBL-KKUMJFAQSA-N 0.000 description 1
- ININBLZFFVOQIO-JHEQGTHGSA-N Gln-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CCC(=O)N)N)O ININBLZFFVOQIO-JHEQGTHGSA-N 0.000 description 1
- DIXKFOPPGWKZLY-CIUDSAMLSA-N Glu-Arg-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O DIXKFOPPGWKZLY-CIUDSAMLSA-N 0.000 description 1
- ZWQVYZXPYSYPJD-RYUDHWBXSA-N Glu-Gly-Phe Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 ZWQVYZXPYSYPJD-RYUDHWBXSA-N 0.000 description 1
- KRRFFAHEAOCBCQ-SIUGBPQLSA-N Glu-Ile-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KRRFFAHEAOCBCQ-SIUGBPQLSA-N 0.000 description 1
- CUPSDFQZTVVTSK-GUBZILKMSA-N Glu-Lys-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(O)=O CUPSDFQZTVVTSK-GUBZILKMSA-N 0.000 description 1
- SYAYROHMAIHWFB-KBIXCLLPSA-N Glu-Ser-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O SYAYROHMAIHWFB-KBIXCLLPSA-N 0.000 description 1
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 1
- FVGOGEGGQLNZGH-DZKIICNBSA-N Glu-Val-Phe Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 FVGOGEGGQLNZGH-DZKIICNBSA-N 0.000 description 1
- YMUFWNJHVPQNQD-ZKWXMUAHSA-N Gly-Ala-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN YMUFWNJHVPQNQD-ZKWXMUAHSA-N 0.000 description 1
- WKJKBELXHCTHIJ-WPRPVWTQSA-N Gly-Arg-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N WKJKBELXHCTHIJ-WPRPVWTQSA-N 0.000 description 1
- QSTLUOIOYLYLLF-WDSKDSINSA-N Gly-Asp-Glu Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QSTLUOIOYLYLLF-WDSKDSINSA-N 0.000 description 1
- XBWMTPAIUQIWKA-BYULHYEWSA-N Gly-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN XBWMTPAIUQIWKA-BYULHYEWSA-N 0.000 description 1
- KMSGYZQRXPUKGI-BYPYZUCNSA-N Gly-Gly-Asn Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(N)=O KMSGYZQRXPUKGI-BYPYZUCNSA-N 0.000 description 1
- DGKBSGNCMCLDSL-BYULHYEWSA-N Gly-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)CN DGKBSGNCMCLDSL-BYULHYEWSA-N 0.000 description 1
- GAAHQHNCMIAYEX-UWVGGRQHSA-N Gly-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN GAAHQHNCMIAYEX-UWVGGRQHSA-N 0.000 description 1
- 101710114810 Glycoprotein Proteins 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- KZTLOHBDLMIFSH-XVYDVKMFSA-N His-Ala-Asp Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O KZTLOHBDLMIFSH-XVYDVKMFSA-N 0.000 description 1
- 101000600434 Homo sapiens Putative uncharacterized protein encoded by MIR7-3HG Proteins 0.000 description 1
- UMYZBHKAVTXWIW-GMOBBJLQSA-N Ile-Asp-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N UMYZBHKAVTXWIW-GMOBBJLQSA-N 0.000 description 1
- JLWLMGADIQFKRD-QSFUFRPTSA-N Ile-His-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CC1=CN=CN1 JLWLMGADIQFKRD-QSFUFRPTSA-N 0.000 description 1
- RQJUKVXWAKJDBW-SVSWQMSJSA-N Ile-Ser-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N RQJUKVXWAKJDBW-SVSWQMSJSA-N 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- MYGQXVYRZMKRDB-SRVKXCTJSA-N Leu-Asp-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN MYGQXVYRZMKRDB-SRVKXCTJSA-N 0.000 description 1
- PBGDOSARRIJMEV-DLOVCJGASA-N Leu-His-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(O)=O PBGDOSARRIJMEV-DLOVCJGASA-N 0.000 description 1
- GCXGCIYIHXSKAY-ULQDDVLXSA-N Leu-Phe-Arg Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O GCXGCIYIHXSKAY-ULQDDVLXSA-N 0.000 description 1
- IDGZVZJLYFTXSL-DCAQKATOSA-N Leu-Ser-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IDGZVZJLYFTXSL-DCAQKATOSA-N 0.000 description 1
- UCRJTSIIAYHOHE-ULQDDVLXSA-N Leu-Tyr-Arg Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N UCRJTSIIAYHOHE-ULQDDVLXSA-N 0.000 description 1
- VHTIZYYHIUHMCA-JYJNAYRXSA-N Leu-Tyr-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O VHTIZYYHIUHMCA-JYJNAYRXSA-N 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- VHNOAIFVYUQOOY-XUXIUFHCSA-N Lys-Arg-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VHNOAIFVYUQOOY-XUXIUFHCSA-N 0.000 description 1
- ZQCVMVCVPFYXHZ-SRVKXCTJSA-N Lys-Asn-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCCN ZQCVMVCVPFYXHZ-SRVKXCTJSA-N 0.000 description 1
- DZQYZKPINJLLEN-KKUMJFAQSA-N Lys-Cys-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCCCN)N)O DZQYZKPINJLLEN-KKUMJFAQSA-N 0.000 description 1
- SLQJJFAVWSZLBL-BJDJZHNGSA-N Lys-Ile-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN SLQJJFAVWSZLBL-BJDJZHNGSA-N 0.000 description 1
- LECIJRIRMVOFMH-ULQDDVLXSA-N Lys-Pro-Phe Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 LECIJRIRMVOFMH-ULQDDVLXSA-N 0.000 description 1
- GHKXHCMRAUYLBS-CIUDSAMLSA-N Lys-Ser-Asn Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O GHKXHCMRAUYLBS-CIUDSAMLSA-N 0.000 description 1
- MIFFFXHMAHFACR-KATARQTJSA-N Lys-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN MIFFFXHMAHFACR-KATARQTJSA-N 0.000 description 1
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 1
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 1
- IILUKIJNFMUBNF-IHRRRGAJSA-N Phe-Gln-Gln Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O IILUKIJNFMUBNF-IHRRRGAJSA-N 0.000 description 1
- IDUCUXTUHHIQIP-SOUVJXGZSA-N Phe-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC2=CC=CC=C2)N)C(=O)O IDUCUXTUHHIQIP-SOUVJXGZSA-N 0.000 description 1
- KJJROSNFBRWPHS-JYJNAYRXSA-N Phe-Glu-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O KJJROSNFBRWPHS-JYJNAYRXSA-N 0.000 description 1
- RFEXGCASCQGGHZ-STQMWFEESA-N Phe-Gly-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O RFEXGCASCQGGHZ-STQMWFEESA-N 0.000 description 1
- OSBADCBXAMSPQD-YESZJQIVSA-N Phe-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N OSBADCBXAMSPQD-YESZJQIVSA-N 0.000 description 1
- WWPAHTZOWURIMR-ULQDDVLXSA-N Phe-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC1=CC=CC=C1 WWPAHTZOWURIMR-ULQDDVLXSA-N 0.000 description 1
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 1
- HFZNNDWPHBRNPV-KZVJFYERSA-N Pro-Ala-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O HFZNNDWPHBRNPV-KZVJFYERSA-N 0.000 description 1
- ONPFOYPPPOHMNH-UVBJJODRSA-N Pro-Ala-Trp Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@@H]3CCCN3 ONPFOYPPPOHMNH-UVBJJODRSA-N 0.000 description 1
- ILMLVTGTUJPQFP-FXQIFTODSA-N Pro-Asp-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ILMLVTGTUJPQFP-FXQIFTODSA-N 0.000 description 1
- AJBQTGZIZQXBLT-STQMWFEESA-N Pro-Phe-Gly Chemical compound C([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H]1NCCC1)C1=CC=CC=C1 AJBQTGZIZQXBLT-STQMWFEESA-N 0.000 description 1
- 102100037401 Putative uncharacterized protein encoded by MIR7-3HG Human genes 0.000 description 1
- 241000315672 SARS coronavirus Species 0.000 description 1
- UCXDHBORXLVBNC-ZLUOBGJFSA-N Ser-Asn-Cys Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(O)=O UCXDHBORXLVBNC-ZLUOBGJFSA-N 0.000 description 1
- KAAPNMOKUUPKOE-SRVKXCTJSA-N Ser-Asn-Phe Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KAAPNMOKUUPKOE-SRVKXCTJSA-N 0.000 description 1
- ZOHGLPQGEHSLPD-FXQIFTODSA-N Ser-Gln-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZOHGLPQGEHSLPD-FXQIFTODSA-N 0.000 description 1
- PJIQEIFXZPCWOJ-FXQIFTODSA-N Ser-Pro-Asp Chemical compound [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O PJIQEIFXZPCWOJ-FXQIFTODSA-N 0.000 description 1
- VGQVAVQWKJLIRM-FXQIFTODSA-N Ser-Ser-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O VGQVAVQWKJLIRM-FXQIFTODSA-N 0.000 description 1
- PURRNJBBXDDWLX-ZDLURKLDSA-N Ser-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CO)N)O PURRNJBBXDDWLX-ZDLURKLDSA-N 0.000 description 1
- DYEGLQRVMBWQLD-IXOXFDKPSA-N Ser-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CO)N)O DYEGLQRVMBWQLD-IXOXFDKPSA-N 0.000 description 1
- FHXGMDRKJHKLKW-QWRGUYRKSA-N Ser-Tyr-Gly Chemical compound OC[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=C(O)C=C1 FHXGMDRKJHKLKW-QWRGUYRKSA-N 0.000 description 1
- YEDSOSIKVUMIJE-DCAQKATOSA-N Ser-Val-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O YEDSOSIKVUMIJE-DCAQKATOSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 101710167605 Spike glycoprotein Proteins 0.000 description 1
- TZKPNGDGUVREEB-FOHZUACHSA-N Thr-Asn-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O TZKPNGDGUVREEB-FOHZUACHSA-N 0.000 description 1
- ONNSECRQFSTMCC-XKBZYTNZSA-N Thr-Glu-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O ONNSECRQFSTMCC-XKBZYTNZSA-N 0.000 description 1
- WYKJENSCCRJLRC-ZDLURKLDSA-N Thr-Gly-Cys Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N)O WYKJENSCCRJLRC-ZDLURKLDSA-N 0.000 description 1
- SPVHQURZJCUDQC-VOAKCMCISA-N Thr-Lys-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O SPVHQURZJCUDQC-VOAKCMCISA-N 0.000 description 1
- DNCUODYZAMHLCV-XGEHTFHBSA-N Thr-Pro-Cys Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)O)N)O DNCUODYZAMHLCV-XGEHTFHBSA-N 0.000 description 1
- GVMXJJAJLIEASL-ZJDVBMNYSA-N Thr-Pro-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O GVMXJJAJLIEASL-ZJDVBMNYSA-N 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- ICNFHVUVCNWUAB-SZMVWBNQSA-N Trp-Arg-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N ICNFHVUVCNWUAB-SZMVWBNQSA-N 0.000 description 1
- IBBBOLAPFHRDHW-BPUTZDHNSA-N Trp-Asn-Arg Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N IBBBOLAPFHRDHW-BPUTZDHNSA-N 0.000 description 1
- UKINEYBQXPMOJO-UBHSHLNASA-N Trp-Asn-Ser Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N UKINEYBQXPMOJO-UBHSHLNASA-N 0.000 description 1
- 108010028230 Trp-Ser- His-Pro-Gln-Phe-Glu-Lys Proteins 0.000 description 1
- SCCKSNREWHMKOJ-SRVKXCTJSA-N Tyr-Asn-Ser Chemical compound N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O SCCKSNREWHMKOJ-SRVKXCTJSA-N 0.000 description 1
- NSTPFWRAIDTNGH-BZSNNMDCSA-N Tyr-Asn-Tyr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O NSTPFWRAIDTNGH-BZSNNMDCSA-N 0.000 description 1
- FMXFHNSFABRVFZ-BZSNNMDCSA-N Tyr-Lys-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O FMXFHNSFABRVFZ-BZSNNMDCSA-N 0.000 description 1
- LUMQYLVYUIRHHU-YJRXYDGGSA-N Tyr-Ser-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LUMQYLVYUIRHHU-YJRXYDGGSA-N 0.000 description 1
- FZSPNKUFROZBSG-ZKWXMUAHSA-N Val-Ala-Asp Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O FZSPNKUFROZBSG-ZKWXMUAHSA-N 0.000 description 1
- JIODCDXKCJRMEH-NHCYSSNCSA-N Val-Arg-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N JIODCDXKCJRMEH-NHCYSSNCSA-N 0.000 description 1
- LIQJSDDOULTANC-QSFUFRPTSA-N Val-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](C(C)C)N LIQJSDDOULTANC-QSFUFRPTSA-N 0.000 description 1
- TZVUSFMQWPWHON-NHCYSSNCSA-N Val-Asp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C(C)C)N TZVUSFMQWPWHON-NHCYSSNCSA-N 0.000 description 1
- XGJLNBNZNMVJRS-NRPADANISA-N Val-Glu-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O XGJLNBNZNMVJRS-NRPADANISA-N 0.000 description 1
- BVWPHWLFGRCECJ-JSGCOSHPSA-N Val-Gly-Tyr Chemical compound CC(C)[C@@H](C(=O)NCC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N BVWPHWLFGRCECJ-JSGCOSHPSA-N 0.000 description 1
- CPGJELLYDQEDRK-NAKRPEOUSA-N Val-Ile-Ala Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](C)C(O)=O CPGJELLYDQEDRK-NAKRPEOUSA-N 0.000 description 1
- KDKLLPMFFGYQJD-CYDGBPFRSA-N Val-Ile-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)NC(=O)[C@H](C(C)C)N KDKLLPMFFGYQJD-CYDGBPFRSA-N 0.000 description 1
- BTWMICVCQLKKNR-DCAQKATOSA-N Val-Leu-Ser Chemical compound CC(C)[C@H]([NH3+])C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C([O-])=O BTWMICVCQLKKNR-DCAQKATOSA-N 0.000 description 1
- QSPOLEBZTMESFY-SRVKXCTJSA-N Val-Pro-Val Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O QSPOLEBZTMESFY-SRVKXCTJSA-N 0.000 description 1
- QPJSIBAOZBVELU-BPNCWPANSA-N Val-Tyr-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](C(C)C)N QPJSIBAOZBVELU-BPNCWPANSA-N 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 102000018265 Virus Receptors Human genes 0.000 description 1
- 108010066342 Virus Receptors Proteins 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 108010041407 alanylaspartic acid Proteins 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- -1 aluminum ions Chemical class 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 description 1
- 108010038850 arginyl-isoleucyl-tyrosine Proteins 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 108010068265 aspartyltyrosine Proteins 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000011545 carbonate/bicarbonate buffer Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000002038 chemiluminescence detection Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 108010060199 cysteinylproline Proteins 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000001079 digestive effect Effects 0.000 description 1
- 210000002249 digestive system Anatomy 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 108010090037 glycyl-alanyl-isoleucine Proteins 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 108010078274 isoleucylvaline Proteins 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 108010003700 lysyl aspartic acid Proteins 0.000 description 1
- 108010054155 lysyllysine Proteins 0.000 description 1
- 108010017391 lysylvaline Proteins 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000002808 molecular sieve Substances 0.000 description 1
- 125000000896 monocarboxylic acid group Chemical group 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 108010082795 phenylalanyl-arginyl-arginine Proteins 0.000 description 1
- 108010084572 phenylalanyl-valine Proteins 0.000 description 1
- 108010012581 phenylalanylglutamate Proteins 0.000 description 1
- 108010051242 phenylalanylserine Proteins 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 108010061238 threonyl-glycine Proteins 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 108091007466 transmembrane glycoproteins Proteins 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 108010078580 tyrosylleucine Proteins 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000012224 working solution Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/06—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies from serum
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6075—Viral proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Abstract
The invention provides a polypeptide immunoconjugate and an application thereof, and the polypeptide immunoconjugate comprises: RBD of polypeptides and novel coronavirus S proteins; wherein the molar ratio of the polypeptide to the RBD of the novel coronavirus S protein is 15: 1-1: 1. the vaccine prepared by the polypeptide immunoconjugate has high neutralizing antibody to various novel coronaviruses, and can effectively prevent or treat the novel coronavirus pneumonia.
Description
Technical Field
The invention relates to the field of biomedicine, in particular to a polypeptide-RBD (radial basis function) immunoconjugate and application thereof, and more particularly relates to the polypeptide immunoconjugate, application of the immunoconjugate, a pharmaceutical composition, a vaccine, a method for preparing the vaccine, a method for preparing an antibody and a method for stimulating generation of an anti-peptide antibody or an anti-RBD antibody in a subject.
Background
The coronavirus is a forward enveloped virus with RNA, and the genome size of the coronavirus is about 26-32 kb. The genomic RNA and phosphorylated nucleocapsid (N) proteins are buried in a phospholipid bilayer and covered by a spike glycoprotein trimer (S), with membrane (M) proteins (type III transmembrane glycoproteins) and envelope (E) proteins located between the S proteins of the viral envelope. Coronaviruses are a class of viruses that are widely found in nature and cause multiple system diseases including respiratory, digestive and nervous systems.
The S protein of SARS-CoV-2 is located at the outermost layer of virus, regularly arranged in corona structure on the membrane, and is involved in the process of binding virus with virus receptor on the surface of host cell and mediating virus to enter cell through membrane fusion, and plays an important role in inducing host to produce neutralizing antibody. The development of the COVID-19 vaccine currently uses the full S protein or partial S protein (receptor binding domain (RBD) in S protein) as the target antigen. Research reports that the S protein of SARS-CoV of coronavirus in the same genus may induce antibody dependent infection enhanced reaction (ADE), the molecular weight of RBD is low, the immunogenicity using RBD monomer as antigen is poor, and partial SARS-CoV-2 mutant strain has RBD amino acid single site and multi site mutation, therefore, how to improve the immunogenicity of RBD needs to be further explored.
Disclosure of Invention
The present application is based on the discovery and recognition by the inventors of the following facts and problems:
research reports that the molecular weight of the novel coronavirus RBD is low, and the immunogenicity taking the RBD monomer as an antigen is poor, and through a large number of experimental researches, the inventor unexpectedly obtains a polypeptide immunoconjugate for preventing the novel coronavirus pneumonia COVID-19; the polypeptide immunoconjugate is added with an adjuvant to prepare a vaccine, so that the immunogenicity of the polypeptide can be improved, the immunogenicity of the RBD protein can be improved, and the broad spectrum of the immune effect of the immunoconjugate can be improved.
To this end, in a first aspect of the invention, the invention provides a polypeptide immunoconjugate. According to an embodiment of the invention, comprising: RBD of polypeptides and novel coronavirus S proteins; wherein the molar ratio of the polypeptide to the RBD of the novel coronavirus S protein is 1: 1-15: 1. The inventor creatively discovers that the polypeptide immunoconjugate obtained by combining the polypeptide and the RBD of the novel coronavirus S protein can remarkably improve the content of the anti-peptide antibody or the anti-RBD antibody when the molar ratio of the polypeptide to the RBD of the novel coronavirus S protein is 1: 1-1: 30 hours, the polypeptide immunoconjugate produces a higher level of neutralizing antibodies.
According to embodiments of the invention, the polypeptide immunoconjugate may further comprise at least one of the following additional technical features:
according to an embodiment of the invention, the polypeptide is a novel coronavirus S protein epitope.
According to an embodiment of the invention, the polypeptide has the amino acid sequence of SEQ ID NO:1 or an amino acid sequence having at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75% identity to SEQ ID No. 1.
CFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLN-NH2(SEQ ID NO:1)。
According to an embodiment of the invention, the RBD of the novel coronavirus S protein has the amino acid sequence of SEQ ID NO:2 or an amino acid sequence having at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75% identity to SEQ ID No. 2.
MLRGLCCVLL LCGAVFVSPS QEIHARFRRG ARGRVQPTES IVRFPNITNL CPFGEVFNAT RFASVYAWNR KRISNCVADY SVLYNSASFS TFKCYGVSPT KLNDLCFTNV YADSFVIRGD EVRQIAPGQT GKIADYNYKL PDDFTGCVIA WNSNNLDSKV GGNYNYLYRL FRKSNLKPFE RDISTEIYQA GSTPCNGVEG FNCYFPLQSY GFQPTNGVGY QPYRVVVLSF ELLHAPATVC GPKKSTNLVK NKCVNFWSHP QFEKDYKDDD DK(SEQ ID NO：2)。
According to an embodiment of the invention, said polypeptide is linked to said RBD by a linker.
According to an embodiment of the invention, the linker is sulfosuccinimide 4- (N-maleimidomethyl) cyclohexane-1-carboxylate.
In a second aspect, the invention provides the use of a polypeptide immunoconjugate according to the first aspect in the manufacture of a medicament. According to an embodiment of the invention, the medicament is for the prevention or treatment of a novel coronavirus pneumonia.
In a third aspect of the invention, the invention provides the use of a polypeptide immunoconjugate of the first aspect in the preparation of a vaccine. According to an embodiment of the invention, the vaccine is for the prevention or treatment of novel coronavirus pneumonia. The vaccine provided by the invention has high neutralizing antibody to various novel coronaviruses, and can effectively prevent or treat the novel coronavirus pneumonia.
In a fourth aspect of the invention, a pharmaceutical composition is provided. According to an embodiment of the invention, there is included a polypeptide immunoconjugate according to the first aspect. The pharmaceutical composition provided by the embodiment of the invention can obviously improve the content of the anti-peptide antibody or the anti-RBD antibody, and effectively prevent or treat the novel coronavirus pneumonia.
In a fifth aspect of the invention, a vaccine is presented. According to an embodiment of the invention, there is provided a polypeptide immunoconjugate according to the first aspect; and a pharmaceutically acceptable adjuvant. The vaccine provided by the embodiment of the invention has the polypeptide immunoconjugate, and can remarkably improve the content of anti-peptide antibodies or anti-RBD antibodies, so that the vaccine obtained by combining the polypeptide immunoconjugate and the adjuvant has the characteristic of generating higher anti-peptide and anti-RBD antibodies in a human body stimulated by various novel coronaviruses, and meanwhile, due to the addition of the adjuvant, the immunogenicity of the polypeptide and the RBD to the body is further improved, so that the titer of the antibodies is improved, and the effect of effectively preventing or treating the novel coronaviruses is achieved.
According to an embodiment of the invention, the vaccine may further comprise at least one of the following additional technical features:
according to an embodiment of the invention, the adjuvant comprises at least one of aluminium hydroxide, aluminium phosphate, monophosphoryl lipid, oligonucleotide CpG. The vaccine obtained by combining the adjuvant and the polypeptide immunoconjugate according to the embodiment of the invention has significantly improved titer of anti-peptide antibody and anti-RBD antibody compared with vaccines prepared by using other adjuvants, and has better effect of preventing or treating novel coronaviruses.
According to an embodiment of the invention, the adjuvant is aluminium hydroxide.
According to an embodiment of the invention, the adjuvant comprises 3D-mLA at a final concentration of 100. mu.g/L, and aluminium hydroxide at a final concentration of 1 mg/L. The vaccine obtained by combining the adjuvant and the polypeptide immunoconjugate provided by the embodiment of the invention has significantly improved titer of anti-peptide antibody and anti-RBD antibody compared with vaccines prepared by using other adjuvants, and has better effect of preventing or treating novel coronaviruses.
According to an embodiment of the invention, the content of adjuvant in the vaccine is 1 μ g to 1000 μ g, preferably 10 μ g to 500 μ g, more preferably 10 to 100 μ g, most preferably 10 to 50 μ g per dose. According to the adjuvant additive amount of the embodiment of the invention, the prepared vaccine has better effect of preventing or treating the novel coronavirus.
According to an embodiment of the invention, the vaccine is in any pharmaceutically acceptable dosage form.
According to an embodiment of the present invention, the vaccine immunization mode is at least one of intramuscular injection, subcutaneous injection, intradermal injection and microneedle injection.
In a sixth aspect of the invention, there is provided a method of making a vaccine according to the fifth aspect. According to an embodiment of the invention, the method comprises the following steps: the polypeptide immunoconjugate of the first aspect is mixed with an adjuvant. The vaccine provided by the embodiment of the invention has the polypeptide immunoconjugate, and can remarkably improve the content of anti-peptide antibodies or anti-RBD antibodies, so that the vaccine obtained by combining the polypeptide immunoconjugate and the adjuvant has the characteristic of generating higher anti-peptide and anti-RBD antibodies in a human body stimulated by various novel coronaviruses, and meanwhile, due to the addition of the adjuvant, the immunogenicity of the polypeptide and the RBD to the body is further improved, so that the titer of the antibodies is improved, and the effect of effectively preventing or treating the novel coronaviruses is achieved.
According to an embodiment of the invention, the adjuvant comprises at least one of aluminium hydroxide, aluminium phosphate, monophosphoryl lipid, oligonucleotide CpG.
According to an embodiment of the invention, the adjuvant is aluminium hydroxide.
According to an embodiment of the invention, the adjuvant comprises 3D-mLA at a final concentration of 100. mu.g/L, and aluminium hydroxide at a final concentration of 1 mg/L.
In a seventh aspect of the invention, the invention features a method of making an antibody. According to an embodiment of the invention, comprising: immunizing an animal with a polypeptide immunoconjugate of the first aspect; collecting serum of the immunized animal; and purifying the antibody of interest from the serum. The method for preparing the antibody provided by the embodiment of the invention is simple and convenient to operate, and the antibody can specifically recognize the polypeptide immunoconjugate.
In an eighth aspect of the invention, the invention features a method of stimulating the production of anti-peptide antibodies or anti-RBD antibodies in a subject. According to the embodiment of the invention, the method is realized by at least one of the following ways: 1) administering to a subject an immunoconjugate comprising a polypeptide of the first aspect; 2) administering to the subject the pharmaceutical composition of the fourth aspect; and 3) administering the vaccine of the fifth aspect to the subject.
Additional aspects and advantages of the invention will be set forth in part in the description which follows and, in part, will be obvious from the description, or may be learned by practice of the invention.
Drawings
The above and/or additional aspects and advantages of the present invention will become apparent and readily appreciated from the following description of the embodiments, taken in conjunction with the accompanying drawings of which:
FIG. 1 is a SDS-PAGE gel of polypeptides (7#, S2#, 45#, and 46#) according to an embodiment of the present invention coupled to RBD domains of novel coronavirus S proteins, respectively, wherein RBD represents: only the set of RBD domains in the S protein of the novel coronavirus; RBD-SMCC denotes: reacting RBD protein with sulfosuccinimide 4- (N-maleimidomethyl) cyclohexane-1-carboxylate to obtain a product group; RBD-7#, RBD-S2#, RBD-45#, and RBD-46# represent RBD-polypeptide group;
FIG. 2 is a SDS-PAGE gel image obtained after the polypeptides (7# and S2#) according to the embodiment of the present invention are coupled to the RBD domain of the novel coronavirus S protein, respectively, wherein the molar ratio of the 7# polypeptide to the RBD domain of the novel coronavirus S protein is 10: the molar ratio of the 1, S2# polypeptide to the RBD structural domain of the novel coronavirus S protein is 10: 1;
FIG. 3 is a SDS-PAGE gel of polypeptides (45# and 46#) coupled to the RBD domain of the novel coronavirus S protein, respectively, according to an embodiment of the present invention, wherein the molar ratio of the 45# polypeptide to the RBD domain of the novel coronavirus S protein is 10: the molar ratio of the 1, 46# polypeptide to the RBD structural domain of the novel coronavirus S protein is 10: 1; and
FIG. 4 is a graph showing the results of detecting the level of neutralizing antibodies of polypeptide immunoconjugates of the RBD-HA204 adjuvant group and the RBD-45# + HA204 adjuvant group against the novel coronavirus of the south Africa strain according to the embodiment of the invention.
Detailed Description
Reference will now be made in detail to embodiments of the present invention, examples of which are illustrated in the accompanying drawings. The embodiments described below with reference to the drawings are illustrative and intended to be illustrative of the invention and are not to be construed as limiting the invention.
Interpretation of terms
As used herein, the terms "novel coronavirus", "COVID-19", and the like, all refer to the causative agent of the novel coronavirus pneumonia.
Identity, the present invention, in order to compare two or more nucleotide sequences, the percentage of "sequence identity" between a first sequence and a second sequence can be calculated by dividing [ the number of nucleotides in the first sequence that are identical to the nucleotide at the corresponding position ]. Nucleotide in the second sequence ] minus [ the total number of nucleotides in the first sequence ], and then multiplied by [ 100% ], wherein the deletion, insertion, substitution, or addition of each nucleotide in the second nucleotide sequence-relative to the first nucleotide sequence-is considered to be a difference in a single nucleotide (position).
Alternatively, the degree of sequence identity between two or more nucleotide sequences can be calculated using standard settings using known computer algorithms for sequence alignment, such as NCBI Blast v 2.0.
Some other techniques, computer algorithms and settings for determining the degree of sequence identity are for example described in WO 04/037999, EP 0967284, EP 1085089, WO 00/55318, WO 00/78972, WO 98/49185 and GB 2357768-A.
Identity, the present invention, for comparing two or more amino acid sequences, the percentage of "sequence identity" between a first amino acid sequence and a second amino acid sequence can be determined by dividing the number of amino acid residues in the first amino acid sequence by the same as the [ amino acid residue at the corresponding position in the second amino acid sequence ], to be [ total number of nucleotides in the first amino acid sequence ], and then multiplying by [ 100% ], wherein each deletion, insertion, substitution or addition of a "residue" of an amino acid residue in the second amino acid sequence is considered a difference in a single amino acid residue (position), i.e., an "amino acid difference" as defined herein, as compared to the first amino acid sequence.
Alternatively, the degree of sequence identity between two amino acid sequences can be calculated using known computer algorithms, again using standard settings, such as the algorithms described above for determining the degree of sequence identity of nucleotide sequences.
Typically, to determine the percentage of "sequence identity" between two amino acid sequences according to the calculation methods outlined above, the amino acid sequence with the largest number of amino acid residues will be the "first" amino acid sequence and the other amino acid sequence will be the "second" amino acid sequence.
Likewise, in determining the degree of sequence identity between two amino acid sequences, the skilled person may consider so-called "conservative" amino acid substitutions, which may generally be described as amino acid substitutions in which an amino acid residue is replaced. Another amino acid residue having a similar chemical structure, which has little or no effect on the function, activity or other biological property of the polypeptide. Such conservative amino acid substitutions are well known in the art, for example, from WO 04/037999, GB-a-2357768, WO 98/49185, WO 00/46383 and WO 01/09300; and WO 01/09300. The type and/or combination of such substitutions may be selected and/or (preferably) selected based on the relevant teachings from WO 04/037999 and WO 98/49185, as well as from other references cited therein.
The invention provides a polypeptide immunoconjugate, comprising: RBD of polypeptides and novel coronavirus S proteins; wherein the molar ratio of the polypeptide to the RBD of the novel coronavirus S protein is 1: 1-15: 1. the inventor creatively discovers that the polypeptide immunoconjugate obtained by combining the polypeptide and the RBD of the novel coronavirus S protein can remarkably improve the content of the anti-peptide antibody or the anti-RBD antibody when the molar ratio of the polypeptide to the RBD of the novel coronavirus S protein is 1: 1-15: 1, the polypeptide immunoconjugate produces a higher level of neutralizing antibodies.
According to a particular embodiment of the invention, the polypeptide is a novel coronavirus S protein epitope. The polypeptide is not particularly limited, and any novel coronavirus S protein epitope can be used.
According to a particular embodiment of the invention, the polypeptide has the amino acid sequence of SEQ ID NO:1 or an amino acid sequence having at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75% identity to SEQ ID No. 1.
CFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLN-NH2(SEQ ID NO:1)。
According to a particular embodiment of the invention, the RBD of the novel coronavirus S protein has the amino acid sequence of SEQ ID NO:2 or an amino acid sequence having at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75% identity to SEQ ID No. 2.
MLRGLCCVLL LCGAVFVSPS QEIHARFRRG ARGRVQPTES IVRFPNITNL CPFGEVFNAT RFASVYAWNR KRISNCVADY SVLYNSASFS TFKCYGVSPT KLNDLCFTNV YADSFVIRGD EVRQIAPGQT GKIADYNYKL PDDFTGCVIA WNSNNLDSKV GGNYNYLYRL FRKSNLKPFE RDISTEIYQA GSTPCNGVEG FNCYFPLQSY GFQPTNGVGY QPYRVVVLSF ELLHAPATVC GPKKSTNLVK NKCVNFWSHP QFEKDYKDDD DK(SEQ ID NO：2)。
According to a particular embodiment of the invention, said polypeptide is linked to said RBD by a linker.
According to a particular embodiment of the invention, the linker is sulfosuccinimide 4- (N-maleimidomethyl) cyclohexane-1-carboxylate.
The invention provides the application of the polypeptide immunoconjugate in the preparation of medicines. According to a particular embodiment of the invention, the medicament is for the prevention or treatment of novel coronavirus pneumonia.
The invention provides the application of the polypeptide immunoconjugate in the preparation of vaccines. According to a particular embodiment of the invention, the vaccine is for the prevention or treatment of novel coronavirus pneumonia.
The invention provides a pharmaceutical composition comprising the polypeptide immunoconjugate described above. The pharmaceutical composition may include: pharmaceutically acceptable adjuvants including at least one of stabilizers, wetting agents, emulsifiers, binders, isotonicity agents; the pharmaceutical composition is at least one of tablets, granules, powder, capsules, solutions, suspensions and freeze-dried preparations. The pharmaceutical composition is effective in preventing or treating novel coronavirus pneumonia.
The invention provides a vaccine comprising the polypeptide immunoconjugate described above; and a pharmaceutically acceptable adjuvant. The vaccine according to the specific embodiment of the invention comprises the polypeptide immunoconjugate, and can significantly improve the content of anti-peptide antibodies or anti-RBD antibodies, so that the vaccine obtained by combining the polypeptide immunoconjugate and the adjuvant has the characteristic of generating higher anti-peptide and anti-RBD antibodies in a human body stimulated by various novel coronaviruses, and meanwhile, due to the addition of the adjuvant, the immunogenicity of the polypeptide and the RBD to the body is further improved, so that the titer of the antibodies is improved, and the effect of effectively preventing or treating the novel coronavirus pneumonia is achieved.
According to a particular embodiment of the invention, the adjuvant comprises at least one of aluminium hydroxide, aluminium phosphate, monophosphoryl lipids, oligonucleotide CpG.
According to a particular embodiment of the invention, the adjuvant is aluminium hydroxide.
According to a specific embodiment of the invention, the adjuvant comprises 3D-mLA in a final concentration of 100. mu.g/L and aluminum hydroxide in a final concentration of 1 mg/L.
According to a specific embodiment of the invention, the adjuvant is present in an amount of 1 μ g to 1000 μ g, preferably 10 μ g to 500 μ g, more preferably 10 to 100 μ g, most preferably 10 to 50 μ g per dose of the vaccine.
According to a particular embodiment of the invention, the vaccine is in any pharmaceutically acceptable dosage form.
According to a specific embodiment of the present invention, the vaccine immunization mode is at least one of intramuscular injection, subcutaneous injection, intradermal injection and microneedle injection.
The invention provides a method for preparing the vaccine, which comprises the following steps: the polypeptide immunoconjugate described above is mixed with an adjuvant.
According to a particular embodiment of the invention, the adjuvant comprises at least one of aluminium hydroxide, aluminium phosphate, monophosphoryl lipids, oligonucleotide CpG.
According to a particular embodiment of the invention, the adjuvant is aluminium hydroxide.
According to a specific embodiment of the invention, the adjuvant comprises 3D-mLA in a final concentration of 100. mu.g/L and aluminum hydroxide in a final concentration of 1 mg/L.
The invention provides a method for preparing an antibody, which comprises the following steps: immunizing an animal with a polypeptide immunoconjugate as described above; collecting serum of the immunized animal; and purifying the antibody of interest from the serum.
The present invention provides a method of stimulating the production of anti-peptide antibodies or anti-RBD antibodies in a subject by at least one of: 1) administering to the subject an immunoconjugate comprising a polypeptide as described above; 2) administering to the subject the aforementioned pharmaceutical composition; and 3) administering the aforementioned vaccine to the subject.
The term "administering" as used herein refers to introducing a predetermined amount of a substance into a patient by some suitable means. The polypeptide immunoconjugate, pharmaceutical composition or vaccine of the present embodiment may be administered by any common route, as long as it can reach the desired tissue. Various modes of administration are contemplated, including peritoneal, intravenous, intramuscular, subcutaneous, cortical, oral, topical, nasal, pulmonary and rectal, but the invention is not limited to these exemplified modes of administration. However, because of oral administration, the active ingredients of orally administered compositions should be coated or formulated to prevent degradation in the stomach. Preferably, the composition of the present invention can be administered in an injectable formulation. In addition, the pharmaceutical compositions of the present invention may be administered using a specific device that delivers the active ingredient to the target cells.
The administration frequency and dose of the polypeptide immunoconjugate, pharmaceutical composition or vaccine of the present embodiment may be determined by a number of relevant factors, including the type of disease to be treated, the route of administration, the age, sex, weight and severity of the disease of the patient, and the type of drug as an active ingredient. According to some embodiments of the invention, the daily dose may be divided into 1, 2 or more doses in a suitable form for administration 1, 2 or more times over the entire period of time, as long as a therapeutically effective amount is achieved.
The term "therapeutically effective amount" refers to an amount sufficient to significantly ameliorate some of the symptoms associated with a disease or condition, i.e., to provide a therapeutic effect for a given condition and dosing regimen. The term "treatment" is used to refer to obtaining a desired pharmacological and/or physiological effect. As used herein, "treatment" encompasses administration of the polypeptide immunoconjugates, pharmaceutical compositions or vaccines of the embodiments of the invention to an individual for treatment, including but not limited to administration to an individual in need thereof containing the teachings herein.
It should be noted that the polypeptide immunoconjugates, the pharmaceutical compositions, the vaccines, the methods for preparing antibodies, and the methods for stimulating the production of anti-peptide antibodies or anti-RBD antibodies in a subject according to the embodiments of the present invention are discovered and completed by the inventors of the present application through hard inventive work and optimization work.
The embodiments will be described in detail below. The experimental procedures used in the following examples are all conventional procedures unless otherwise specified. Materials, reagents and the like used in the following examples are commercially available unless otherwise specified.
EXAMPLE 1 Synthesis of polypeptide of interest
In this example, conventional methods for solid-phase synthesis of polypeptides were used to prepare polypeptides 7#, 45#, 46#, and S2, wherein the amino acid sequences of the polypeptides are shown in table 1.
Table 1:
note: the C end of the amino acid sequences of the synthesized No. 7 peptide, the synthesized No. 45 peptide and the synthesized No. 46 peptide is-CONH2Form or COOH form; n terminal is NH2Or CH3CONH-form.
The specific experimental procedures for preparing the polypeptide are as follows:
(1) DeFmoc protection
A commercially available Rink Amide AM resin was charged into a reaction tube having a filter and resistant to an organic solvent, and was closed with an organic solvent-resistant cap. After washing with DMF (dimethylformamide) for 1 min, an excess of 20% piperidine/DMF (volumetric ratio) solution was added, the reaction tube was gently shaken after the cover was closed, mixed well and kept free of Fmoc protection for 15 min, and then washed three times with DMF after draining.
(2) Peptide bond condensation
Adding 3 times of resin amino molar weight of Fmoc protected amino acid, 3 times of resin amino molar weight of activating agent HBTU and 6 times of resin amino molar weight of DIPEA (N, N-diisopropylethylamine) which are subjected to preactivation (after 2-3 minutes of preactivation) into the reaction tube obtained in the step (1), using DMF as a solvent, ensuring that the reagents are completely dissolved, and completely covering the resin. The resin is shaken and mixed uniformly every 2 to 3 minutes to react for 20 to 30 minutes.
After the reaction was completed, a 50-fold molar excess of acetic anhydride in DMF was added to the reaction tube at room temperature, then the mixture was drained after 10 minutes, and an excess of 20% piperidine/DMF (volume ratio) solution was added thereto at room temperature to react for 30 minutes. The solution was filtered off and the resin was washed 5 times with DMF.
The above steps are repeated in cycles until all the Fmoc-protected amino acids fitted to the polypeptide are attached to the resin in a linear fashion.
(3) Polypeptide cleavage
The polypeptide lysate is treated with a strong acid, such as TFA (trifluoroacetic acid). And (3) treating the resin obtained in the step (2) with TFA, water, EDT dimercaptoethanol and phenol (in a volume ratio of 92.5: 2.5: 2.5: 2.5) for 2 hours at room temperature. Then collecting the lysate carefully into a glass collector, adding ether precooled with ice, collecting the precipitated polypeptide, and continuing to wash with cold ether for 5-6 times to obtain crude peptide.
(4) And (5) polypeptide purification.
The crude peptide is purified by HPLC (high performance liquid chromatography), collected, lyophilized, and finally tested by HPLC for purity (214nm wavelength) of greater than 85% and mass spectrometry for correct molecular weight.
After the above steps, polypeptides 7#, 45#, 46# and S2 can be obtained, wherein the amino acid sequence shown in SEQ ID NO: the purity of the synthetic peptide shown in 1 (Table 1) was 95%.
EXAMPLE 2 preparation of immunogenic conjugates
In this example, the synthetic peptide prepared in example 1 was conjugated to RBD protein via a linker, and the following experimental procedures were performed:
preparation of RBD protein: the RBD plasmid was transfected into HEK293F cells, and the cells were cultured to a logarithmic growth phase before cell supernatant was collected. After concentration the protein was purified by Anti-flag G1 Affinity resin. And purifying the crude protein by using a molecular sieve to obtain the RBD protein.
The RBD protein was formulated in PBS to a concentration of 1 mg/mL. Taking a required amount of RBD solution, and mixing the RBD solution according to a molar ratio of 1: 2-1: 40 sulfol-SMCC (10mg/mL) was added thereto, the reaction mixture was reacted at room temperature for 1 hour, and the reaction mixture was concentrated by centrifugation at 3500rpm at 4 ℃ using an ultrafiltration concentration tube. After the volume is concentrated to 1/10 of the reaction solution, PBS is added to the volume of the original reaction solution, centrifugal concentration is continued, and centrifugal concentration is continuously carried out for 5 times to remove free Sulfo-SMCC. The final RBD-SMCC stock solution concentration was 10 mg/mL. The required amount of the synthetic peptide prepared in example 1 was weighed and dissolved in PBS or a PBS solution containing 10% DMSO, and the addition ratio of the polypeptide to the RBD protein was optimized by the inventors according to a molar ratio of the polypeptide to the RBD protein of 1: 1-15: 1 adding an RBD-SMCC stock solution, wherein the ratio of polypeptide to RBD addition is as shown in table 1; PBS was then added to the appropriate reaction volume, and the resulting mixture was reacted at room temperature for 1 hour, and the conjugation was detected by SDS-PAGE, wherein the loading of protein was 2. mu.g, and the electrophoretogram of SDS-PAGE is shown in FIG. 1, the molar ratio of peptide 7# to protein was 10:1, the molar ratio of peptide 45# to protein was 7.5:1, the molar ratio of peptide 46# to protein was 7:1, and the molar ratio of peptide S2# to protein was 6: 1. In FIG. 2, the molar ratio of peptide 7 to protein was 10:1, and the molar ratio of peptide S2 to protein was 10: 1. In FIG. 3 the molar ratio of 45# peptide to protein is 10:1 and the molar ratio of 46# peptide to protein is 10: 1. From the experimental results shown in fig. 1-3, it can be seen that when the molar ratio of 7# peptide to protein is 10:1, the molar ratio of 45# peptide to protein is 7.5:1, the molar ratio of 46# peptide to protein is 7:1, and the molar ratio of S2# peptide to protein is 6:1, more multimeric immunoconjugates are formed, and the synthetic effect is better.
Table 2:
| item | Molar ratio of 1 | Molar ratio of 2 |
| 7#-RBD | - | 10：1 |
| 45#-RBD | 7.5：1 | 10：1 |
| 46#-RBD | 7：1 | 10：1 |
| S2#-RBD | 6：1 | 10：1 |
Example 3 preparation of vaccine and detection of immune Effect
1. And (4) preparing the vaccine.
(1) Experimental Material
An immunoconjugate: a conjugate of RBD protein and polypeptide shown in SEQ ID NO. 1;
adjuvant: HA204[ 100. mu.g of 3D-MLA, 1mg of aluminum hydroxide (calculated as aluminum ions) per mL ];
(2) experiment grouping
The experimental groups of this example are shown in Table 3, wherein the molar ratio of peptide 7# to RBD is 10:1, the molar ratio of peptide 45# to RBD is 7.5:1, the molar ratio of peptide 46# to RBD is 7:1, the molar ratio of peptide S2# to RBD is 6:1, the column of "group" is named as "RBD domain and polypeptide conjugate-adjuvant of novel coronavirus", for example, "RBD-7 # + HA 204" in "RBD-7 #" represents the conjugate of RBD binding domain of novel coronavirus S protein and peptide No. 7, "HA 204" represents the adjuvant named HA 204.
Table 3:
(3) procedure for the preparation of the
The immunogenic conjugate prepared in example 2 was mixed with HA204 adjuvant and PBS solution, and shaken at room temperature and 30RPM for 1 hour to obtain final samples with final concentration of 100. mu.g/mL of polypeptide-containing RBD protein antigen and 20412.5% (v/v) of HA adjuvant.
2. Experiment of immune Effect
Grouping of immune effect experiments is shown in table 3, the immunogenicity of mice was studied using the samples to be tested prepared in table 3, healthy BALB/c mice weighing 16-18g were randomly grouped into groups of 6 mice each; using samples to be tested of each experimental group (RBD, RBD + HA204, RBD-7# + HA204, RBD-45# + HA204, RBD-46# + HA204, RBD-S2+ HA204) in Table 3 to perform intraperitoneal injection on mice, wherein the intraperitoneal injection is performed for 1 time on each day of 0, 14 and 21, and the administration volume is 200 mu L/mouse; injecting normal saline into the abdominal cavity of mice in Control group, injecting 1 time into the abdominal cavity on the 0 th day, the 14 th day and the 21 st day, wherein the administration volume is 100 mu L/mouse, collecting blood of all mice 1 time respectively before injection on the 0 th day, the 21 st day and the 28 th day, separating serum, diluting the serum 20 times, and measuring the serum antibody level of each group of mice on the 21 st day and the 28 th day by adopting an enzyme linked immunosorbent assay (ELISA) method, wherein the specific operation is as follows:
(1) and (3) diluting the RBD solution into working solution with the final concentration of 1 mu g/mL by using coating solution (0.05M carbonate-bicarbonate buffer solution), fully and uniformly mixing, adding an enzyme label plate according to 100 mu L/hole, attaching sealing paper, and coating at 2-8 ℃ overnight.
(2) The supernatant from the wells was aspirated, washed 5 times with PBST, and blocked for 1h at room temperature by adding 100. mu.L of 1% BSA in PBS.
(3) After blocking, wash 5 times with PBST.
(4) Sample adding: after washing in step (3), 100. mu.L of diluted serum sample was added to each well, incubated at room temperature for 2h, and washed 5 times with PBST.
(5) Adding an enzyme-labeled antibody: and (4) adding 100 mu L of diluted goat anti-mouse IgG HRP enzyme-labeled secondary antibody into each well washed in the step (4), and incubating for 1h at room temperature.
(6) After incubation was complete, washed 5 times with PBST.
(7) Adding a substrate solution for color development: after washing in step (6), 100. mu.L of TMB was added to each well to develop color.
(8) And (3) terminating the reaction: and (4) adding 50 mu L of 1N sulfuric acid into each hole after the substrate color developing solution is added in the step (7) to terminate the reaction.
Determination of OD of serum antibodies using microplate reader450Values, anti-RBD antibody levels results after combination of the polypeptide conjugate with different adjuvants are shown in table 4, and the results show that peptide No. 45 conjugated with RBD significantly increased anti-RBD antibody titers.
Table 4:
3. pseudovirus neutralization assay
Based on the above results, the inventors compared the level of neutralizing antibodies against south African pseudovirus strain produced by the sera of mice D21 and D28 in RBD-HA204 group and RBD-45# + HA204 group, and the following experiment operations were performed:
(1) mouse serum obtained in experiment 2 of this example was inactivated in 56 ℃ water bath for 30min, diluted in 96-well cell culture plates in duplicate with DMEM complete medium;
(2) adding pseudovirus (650 TCID) to serum50Perwell), cell culture incubator (37 ℃, 5% CO)2) Incubating for 1 hour;
(3) add 100. mu.L of Huh7 cells to each well of a 96-well plate to give 2X 10 cells per well4A plurality of;
(4) putting the 96-well plate into a cell culture box, and culturing for 20-28 hours at 37 ℃ and 5% CO 2;
(5) taking out a 96-well plate from the cell culture box, sucking 150 mu L of supernatant from each well, adding 100 mu L of luciferase detection reagent, and reacting for 2min at room temperature in a dark place;
(6) after the reaction is finished, repeatedly blowing and sucking the liquid in the reaction holes for 6-8 times to fully crack the cells, sucking 150 mu L of liquid from each hole, adding the liquid into a corresponding 96-hole chemiluminescence detection plate, and placing the plate in a chemiluminescence detector to read a luminescence value;
the neutralizing antibody level of the pseudoviruses generated by the RBD-HA204 group and the RBD-45# + HA204 group is shown in figure 4, wherein after the peptide No. 45 is conjugated with the RBD, the neutralizing antibody level of the RBD group at 21 days is obviously higher than that of the RBD group, and the neutralizing antibody level of the RBD-45# + HA204 group at 28 days is higher than that of the RBD-HA204 group, but the difference is not obvious, and the two groups both have good immune effect.
In the description herein, references to the description of the term "one embodiment," "some embodiments," "an example," "a specific example," or "some examples," etc., mean that a particular feature, structure, material, or characteristic described in connection with the embodiment or example is included in at least one embodiment or example of the invention. In this specification, the schematic representations of the terms used above are not necessarily intended to refer to the same embodiment or example. Furthermore, the particular features, structures, materials, or characteristics described may be combined in any suitable manner in any one or more embodiments or examples. Furthermore, various embodiments or examples and features of different embodiments or examples described in this specification can be combined and combined by one skilled in the art without contradiction.
Although embodiments of the present invention have been shown and described above, it is understood that the above embodiments are exemplary and should not be construed as limiting the present invention, and that variations, modifications, substitutions and alterations can be made to the above embodiments by those of ordinary skill in the art within the scope of the present invention.
SEQUENCE LISTING
<110> Liaoning Dabie shares GmbH of Qinghua university
<120> polypeptide immunoconjugate and use thereof
<130> BI3211207
<160> 5
<170> PatentIn version 3.5
<210> 1
<211> 40
<212> PRT
<213> Artificial Sequence
<220>
<223> 1
<400> 1
Cys Phe Lys Asn His Thr Ser Pro Asp Val Asp Leu Gly Asp Ile Ser
1 5 10 15
Gly Ile Asn Ala Ser Val Val Asn Ile Gln Lys Glu Ile Asp Arg Leu
20 25 30
Asn Glu Val Ala Lys Asn Leu Asn
35 40
<210> 2
<211> 272
<212> PRT
<213> Artificial Sequence
<220>
<223> 2
<400> 2
Met Leu Arg Gly Leu Cys Cys Val Leu Leu Leu Cys Gly Ala Val Phe
1 5 10 15
Val Ser Pro Ser Gln Glu Ile His Ala Arg Phe Arg Arg Gly Ala Arg
20 25 30
Gly Arg Val Gln Pro Thr Glu Ser Ile Val Arg Phe Pro Asn Ile Thr
35 40 45
Asn Leu Cys Pro Phe Gly Glu Val Phe Asn Ala Thr Arg Phe Ala Ser
50 55 60
Val Tyr Ala Trp Asn Arg Lys Arg Ile Ser Asn Cys Val Ala Asp Tyr
65 70 75 80
Ser Val Leu Tyr Asn Ser Ala Ser Phe Ser Thr Phe Lys Cys Tyr Gly
85 90 95
Val Ser Pro Thr Lys Leu Asn Asp Leu Cys Phe Thr Asn Val Tyr Ala
100 105 110
Asp Ser Phe Val Ile Arg Gly Asp Glu Val Arg Gln Ile Ala Pro Gly
115 120 125
Gln Thr Gly Lys Ile Ala Asp Tyr Asn Tyr Lys Leu Pro Asp Asp Phe
130 135 140
Thr Gly Cys Val Ile Ala Trp Asn Ser Asn Asn Leu Asp Ser Lys Val
145 150 155 160
Gly Gly Asn Tyr Asn Tyr Leu Tyr Arg Leu Phe Arg Lys Ser Asn Leu
165 170 175
Lys Pro Phe Glu Arg Asp Ile Ser Thr Glu Ile Tyr Gln Ala Gly Ser
180 185 190
Thr Pro Cys Asn Gly Val Glu Gly Phe Asn Cys Tyr Phe Pro Leu Gln
195 200 205
Ser Tyr Gly Phe Gln Pro Thr Asn Gly Val Gly Tyr Gln Pro Tyr Arg
210 215 220
Val Val Val Leu Ser Phe Glu Leu Leu His Ala Pro Ala Thr Val Cys
225 230 235 240
Gly Pro Lys Lys Ser Thr Asn Leu Val Lys Asn Lys Cys Val Asn Phe
245 250 255
Trp Ser His Pro Gln Phe Glu Lys Asp Tyr Lys Asp Asp Asp Asp Lys
260 265 270
<210> 3
<211> 29
<212> PRT
<213> Artificial Sequence
<220>
<223> 3
<400> 3
Leu Tyr Gln Asp Val Asn Cys Thr Glu Val Pro Val Ala Ile His Ala
1 5 10 15
Asp Gln Leu Thr Pro Thr Trp Arg Val Tyr Ser Thr Gly
20 25
<210> 4
<211> 43
<212> PRT
<213> Artificial Sequence
<220>
<223> 4
<400> 4
Cys Val Lys Gln Leu Ser Ser Asn Phe Gly Ala Ile Ser Ser Val Leu
1 5 10 15
Asn Asp Ile Leu Ser Arg Leu Asp Lys Val Glu Ala Glu Val Gln Ile
20 25 30
Asp Arg Leu Ile Thr Gly Arg Leu Gln Ser Leu
35 40
<210> 5
<211> 47
<212> PRT
<213> Artificial Sequence
<220>
<223> 5
<400> 5
Thr Glu Ser Asn Lys Lys Phe Leu Pro Phe Gln Gln Phe Gly Arg Asp
1 5 10 15
Ile Ala Leu Tyr Gln Asp Val Asn Cys Thr Asp Val Ser Thr Ala Ile
20 25 30
His Ala Asp Gln Leu Thr Pro Ala Trp Arg Ile Tyr Ser Thr Gly
35 40 45
Claims (17)
1. A polypeptide immunoconjugate, comprising: RBD of polypeptides and novel coronavirus S proteins;
wherein the molar ratio of the polypeptide to the RBD of the novel coronavirus S protein is 1: 1-15: 1.
2. the polypeptide immunoconjugate of claim 1, wherein the polypeptide is a novel coronavirus S protein epitope.
3. The polypeptide immunoconjugate of claim 1 or 2, wherein the polypeptide has the amino acid sequence of SEQ ID NO:1 or an amino acid sequence having at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75% identity to SEQ ID No. 1.
4. The polypeptide immunoconjugate of claim 1, wherein the RBD of the novel coronavirus S protein has the amino acid sequence of SEQ ID NO:2 or an amino acid sequence having at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75% identity to SEQ ID No. 2.
5. The polypeptide immunoconjugate of any one of claims 1 to 4, wherein the polypeptide is attached to the RBD via a linker.
6. The polypeptide immunoconjugate of claim 5, wherein the linker is sulfosuccinimide 4- (N-maleimidomethyl) cyclohexane-1-carboxylate.
7. Use of a polypeptide immunoconjugate according to any one of claims 1 to 6 in the manufacture of a medicament for the prevention or treatment of novel coronavirus pneumonia.
8. Use of a polypeptide immunoconjugate according to any one of claims 1 to 6 in the preparation of a vaccine for the prevention or treatment of novel coronavirus pneumonia.
9. A pharmaceutical composition comprising the polypeptide immunoconjugate of any one of claims 1 to 6.
10. A vaccine comprising the polypeptide immunoconjugate of any one of claims 1 to 6; and
a pharmaceutically acceptable adjuvant.
11. The vaccine of claim 10, wherein the adjuvant comprises at least one of aluminum hydroxide, aluminum phosphate, monophosphoryl lipids, oligonucleotide CpG;
optionally, the adjuvant is aluminum hydroxide;
preferably, the adjuvant comprises 3D-MLA with the final concentration of 100 mug/L and aluminum hydroxide with the final concentration of 1 mg/L.
12. The vaccine according to claim 10 or 11, wherein the adjuvant is present in an amount of 1 μ g to 1000 μ g, preferably 10 μ g to 500 μ g, more preferably 10 to 100 μ g, most preferably 10 to 50 μ g per dose.
13. The vaccine of any one of claims 10 to 12, wherein the vaccine is in any pharmaceutically acceptable dosage form.
14. The vaccine according to any one of claims 10 to 13, wherein the vaccine is administered by at least one of intramuscular injection, subcutaneous injection, intradermal injection, and microneedle injection.
15. A method of preparing the vaccine of claims 10-14, comprising the steps of: mixing the polypeptide immunoconjugate of any one of claims 1 to 6 with an adjuvant;
optionally, the adjuvant comprises at least one of aluminum hydroxide, aluminum phosphate, monophosphoryl lipids, oligonucleotide CpG;
optionally, the adjuvant is aluminum hydroxide;
preferably, the adjuvant comprises 3D-MLA with the final concentration of 100 mug/L and aluminum hydroxide with the final concentration of 1 mg/L.
16. A method of producing an antibody, comprising:
immunizing an animal with the polypeptide immunoconjugate of any one of claims 1 to 6;
collecting serum of the immunized animal; and
purifying the antibody of interest from the serum.
17. A method of stimulating the production of anti-peptide antibodies or anti-RBD antibodies in a subject by at least one of:
1) administering to a subject an immunoconjugate according to any one of claims 1 to 6;
2) administering to a subject the pharmaceutical composition of claim 9; and
3) administering to a subject the vaccine of any one of claims 10 to 14.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202111092938.7A CN113769080B (en) | 2021-09-17 | 2021-09-17 | Polypeptide immunoconjugates and uses thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202111092938.7A CN113769080B (en) | 2021-09-17 | 2021-09-17 | Polypeptide immunoconjugates and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN113769080A true CN113769080A (en) | 2021-12-10 |
| CN113769080B CN113769080B (en) | 2023-04-07 |
Family
ID=78851983
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202111092938.7A Active CN113769080B (en) | 2021-09-17 | 2021-09-17 | Polypeptide immunoconjugates and uses thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN113769080B (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114057853A (en) * | 2020-08-07 | 2022-02-18 | 清华大学 | Polypeptide for preventing novel coronavirus pneumonia COVID-19, immunogenic conjugate and application thereof |
| CN114057851A (en) * | 2020-08-07 | 2022-02-18 | 清华大学 | Polypeptide for preventing novel coronavirus pneumonia COVID-19, immunogenic conjugate and application thereof |
| WO2023060483A1 (en) * | 2021-10-13 | 2023-04-20 | 清华大学 | Polypeptide-rbd immunoconjugate and use thereof |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101098710A (en) * | 2004-06-02 | 2008-01-02 | 纽约血液中心 | Sars vaccines and methods to produce highly potent antibodies |
| CN106928326A (en) * | 2015-12-31 | 2017-07-07 | 中国科学院动物研究所 | A kind of coronavirus vaccine of the receptor binding domain subunit based on dimerization |
| CN112679587A (en) * | 2020-05-26 | 2021-04-20 | 河南中泽生物工程有限公司 | Recombinant antigen protein easy to activate B cells and preparation method thereof |
| CN113215178A (en) * | 2020-02-03 | 2021-08-06 | 康希诺生物股份公司 | mRNA vaccine for 2019-nCoV type coronavirus, preparation method and application thereof |
| WO2021168305A1 (en) * | 2020-02-19 | 2021-08-26 | Ubi Ip Holdings | Designer peptides and proteins for the detection, prevention and treatment of coronavirus disease, 2019 (covid-19) |
| WO2021174567A1 (en) * | 2020-03-04 | 2021-09-10 | 中山大学 | Novel coronavirus s protein double-region subunit nano-vaccine based on bacterial complex |
| CN113980140A (en) * | 2020-10-23 | 2022-01-28 | 江苏省疾病预防控制中心(江苏省公共卫生研究院) | Fusion protein and application thereof |
-
2021
- 2021-09-17 CN CN202111092938.7A patent/CN113769080B/en active Active
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101098710A (en) * | 2004-06-02 | 2008-01-02 | 纽约血液中心 | Sars vaccines and methods to produce highly potent antibodies |
| CN106928326A (en) * | 2015-12-31 | 2017-07-07 | 中国科学院动物研究所 | A kind of coronavirus vaccine of the receptor binding domain subunit based on dimerization |
| CN113215178A (en) * | 2020-02-03 | 2021-08-06 | 康希诺生物股份公司 | mRNA vaccine for 2019-nCoV type coronavirus, preparation method and application thereof |
| WO2021168305A1 (en) * | 2020-02-19 | 2021-08-26 | Ubi Ip Holdings | Designer peptides and proteins for the detection, prevention and treatment of coronavirus disease, 2019 (covid-19) |
| WO2021174567A1 (en) * | 2020-03-04 | 2021-09-10 | 中山大学 | Novel coronavirus s protein double-region subunit nano-vaccine based on bacterial complex |
| CN112679587A (en) * | 2020-05-26 | 2021-04-20 | 河南中泽生物工程有限公司 | Recombinant antigen protein easy to activate B cells and preparation method thereof |
| CN113980140A (en) * | 2020-10-23 | 2022-01-28 | 江苏省疾病预防控制中心(江苏省公共卫生研究院) | Fusion protein and application thereof |
Non-Patent Citations (3)
| Title |
|---|
| SHILONG YANG 等: "Safety and immunogenicity of a recombinant tandem-repeat dimeric RBD-based protein subunit vaccine (ZF2001) against COVID-19 in adults: two randomised, double-blind, placebo-controlled, phase 1 and 2 trials", 《LANCET INFECT DIS》 * |
| 张婷 等: "新型冠状病毒S蛋白RBD的糖基化及其长度对蛋白疫苗免疫原性的影响", 《基础医学与临床》 * |
| 曹妙 等: "广谱抗冠状病毒疫苗及抗冠状病毒多肽的研究进展", 《微生物与感染》 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114057853A (en) * | 2020-08-07 | 2022-02-18 | 清华大学 | Polypeptide for preventing novel coronavirus pneumonia COVID-19, immunogenic conjugate and application thereof |
| CN114057851A (en) * | 2020-08-07 | 2022-02-18 | 清华大学 | Polypeptide for preventing novel coronavirus pneumonia COVID-19, immunogenic conjugate and application thereof |
| CN114057851B (en) * | 2020-08-07 | 2023-11-21 | 清华大学 | Polypeptide and immunogenic conjugate for preventing novel coronavirus pneumonia COVID-19 and application thereof |
| WO2023060483A1 (en) * | 2021-10-13 | 2023-04-20 | 清华大学 | Polypeptide-rbd immunoconjugate and use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN113769080B (en) | 2023-04-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN113769080B (en) | Polypeptide immunoconjugates and uses thereof | |
| CN105669838B (en) | Neutralizing epitopes from varicella-zoster virus gE protein and antibodies thereto | |
| CN101415723B (en) | HIV fusion inhibitor peptides with improved biological properties | |
| JP2003529319A (en) | Methods of eliciting broadly neutralizing antibodies targeting HIV-1 gp41 | |
| WO2000059932A1 (en) | Influenza virus hemagglutinin-binding peptides | |
| EA017957B1 (en) | Influenza inhibiting compositions and methods | |
| JP5187883B2 (en) | Antigenic peptides and uses thereof | |
| KR20230084478A (en) | Immunogenic coronavirus fusion proteins and related methods | |
| RU2181379C2 (en) | Peptide (variants) and method of its production, pharmaceutical agent, antibody and method of its production | |
| JP2019501964A (en) | Polypeptide compounds and methods for their preparation and applications | |
| CN114057850B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus COVID-19 and application thereof | |
| AU7619694A (en) | Multiple branch peptide constructions for use against hiv | |
| WO2007054030A1 (en) | Polyethylene glycol modifications of thymosin alpha-1 | |
| WO2023060483A1 (en) | Polypeptide-rbd immunoconjugate and use thereof | |
| CN114057852B (en) | Polypeptide for preventing novel coronavirus pneumonia COVID-19 and application thereof | |
| CN114057851B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus pneumonia COVID-19 and application thereof | |
| CN114053400B (en) | Vaccine for preventing novel coronavirus pneumonia COVID-19 and preparation method thereof | |
| CN114057848B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus pneumonia COVID-19 and application thereof | |
| CN114057846B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus infection COVID-19 and application thereof | |
| CN114057843B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus infection COVID-19 and application thereof | |
| CN114057847B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus COVID-19 and application thereof | |
| WO2005016247A2 (en) | Dna sequences, peptides, antibodies and vaccines for prevention and treatment of sars | |
| CN103539840B (en) | Epidermal growth factor receptor (EGFR) mimotope peptide and application thereof | |
| CN102757500B (en) | Pegylation modifier of long-acting thymosin alpha1 | |
| CN114057844A (en) | Polypeptide for preventing novel coronavirus pneumonia COVID-19, immunogenic conjugate and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |