Background
Heparin, first discovered from the liver, is known as mucopolysaccharidosides consisting of glucosamine, L-iduroniside, N-acetylglucosamine and D-glucuronic acid, which are alternately expressed, have an average molecular weight of 15kDa and are strongly acidic. It is also present in tissues such as lung, vessel wall, intestinal mucosa, etc., and is a natural anticoagulant substance in animal body. Naturally occurring in mast cells, are now predominantly extracted from the mucosa of the bovine lung or porcine small intestine. As an anticoagulant, it is a polymer formed by alternatively connecting two kinds of polysaccharides, and has anticoagulant effect both inside and outside the body. The preparation is mainly used for thromboembolic diseases, myocardial infarction, cardiovascular operations, cardiac catheter examination, extracorporeal circulation, hemodialysis and the like in clinic. With the progress of pharmacology and clinical medicine, the application of heparin is continuously expanding.
In current research, detection of heparin has become particularly important. For example, the surface of transitional epithelial cells in the urinary tract is covered with glucosylceramides (GAGs) to prevent the epithelial cells from being adhered by pathogens, microcrystals, proteins and carcinogenic factors, heparin is one of the main components of GAGs, and heparin excreted in urine is mainly generated by the decomposition and shedding of GAGs, so the excretion amount of liver cords in urine may have a certain relationship with diseases such as bladder tumor and infection.
The first method for determining the amount of heparin preparation was established by Howell in 1924, based on the inhibition of coagulation of fresh whole blood. The whole blood method is modified by storing blood with sodium sulfate, adding bovine cerebroprotein, determining the effect of heparins on coagulation time after recalcification by methods of British pharmacopoeia and Reiner and Winterstein in 1938, and finally determining the effect of heparin on coagulation time after recalcification by using the blood plasma of sheep salted by citric acid. The existing methods for measuring the heparin titer recorded in pharmacopoeias of various countries are biological assay methods, and the methods are different and all use the pharmacological action of the heparin titer resistance to measure. Such as the british pharmacopoeia (1980), the japanese pharmacopoeia (sodium sulfate-bovine whole blood method, british pharmacopoeia (1980) also specifies that sodium sulfate-bovine whole plasma can be used, the sodium citrate-sheep plasma method (british pharmacopoeia 1983, 1986 supplementations have changed the measurement of heparin potency into this method) and parallel lines.
The sono-chromatic substrate method is a commonly used detection method at present. The chromogenic substrate assay for heparin has developed relatively rapidly in recent years. The photometric determination of heparin using chromogenic substrates was first proposed by Teien et al in 1976, and Tastad in 1980 and TenCate et al in 1984 describe a modified method for detecting heparin with S-2222. There are two chromogenic substrate methods currently in common use for heparin assays. One is developed by the Teien method, and the principle is to measure the inhibition effect of the antithrombin-heparin complex on the X factor only. The method adds exogenous antithrombin into a test system, and heparin has enhanced anticoagulation activity in the presence of antithrombin, and the activity is directly directed to some coagulation factors, wherein X instrument factor and thrombin are the most prominent, so the two enzymes can be used for measuring the heparin activity. The second method, developed by Bartl and Lill in 1979, is based on the determination of the inhibitory effect of AT-III heparin on thrombin, i.e.the determination of heparin activity using thrombin and the substrate ChromozymTH. The above two reagent supplies for heparin determination using chromogenic substrates have been commercialized abroad. The greatest advantage of the chromogenic substrate method is its specificity in heparin effect assays and is therefore widely used for monitoring of heparin therapy and investigation of heparin properties. Photometric applications allow automation of routine assays, which is also important for clinical monitoring.
However, currently, detection methods for heparin are not enough, and development of different detection ideas is urgent. Monoclonal antibodies are highly homogeneous antibodies produced by a single B cell clone that are directed against only a particular epitope. Usually, hybridoma (hybridoma) antibody technology is used to prepare hybridoma, which is a method of fusing a sensitized B cell having the ability to secrete a specific antibody and a myeloma cell having an unlimited proliferation ability into a B cell hybridoma based on cell fusion technology. By culturing a population of adult cells with a single hybridoma having such a property, a monoclonal antibody, which is a specific antibody against an epitope, can be produced. The monoclonal antibody has high purity and strong specificity, and can improve the sensitivity and specificity of various serological methods for detecting the antigen. Therefore, the development of heparin-specific monoclonal antibodies and methods for their detection becomes of particular importance.
Disclosure of Invention
The invention overcomes the defects of the prior art and provides a method for detecting the heparin content in blood by adopting a biological method.
In one aspect, the invention provides a monoclonal antibody specific for heparin.
The monoclonal antibody is 5C5 antibody, preferably, the heavy chain of the antibody comprises heavy chain variable region (VH), the light chain comprises light chain variable region (VL), and the light chain variable region of the antibody comprises SEQ ID NO.1, and the heavy chain variable region of the amino acid sequence comprises the amino acid sequence shown in SEQ ID NO. 2.
In some embodiments, the first monoclonal antibody for use in the invention comprises a heavy chain variable region having a sequence at least 85%, 90%, 95%, 98%, 99% or 100% identical to SEQ ID No. 2. In some embodiments, the first monoclonal antibody for use in the invention comprises a light chain variable region sequence having a sequence at least 85%, 90%, 95%, 98%, 99% or 100% identical to SEQ ID No. 1.
According to a particular embodiment of the invention, the antibody is detectably labeled. Such as enzyme labels, radiolabels, luminescent labels, chromogenic labels, haptens (e.g., digoxigenin, biotin), metal complexes, and metals (e.g., colloidal gold).
In a second aspect, a method for detecting heparin content is provided, which comprises detecting with the monoclonal antibody of the invention; preferably, detection is by ELISA. Further preferably, the monoclonal antibody of the present invention is used as a coating antibody, and a rabbit polyclonal antibody prepared by a conventional method is used as a detection antibody.
Preferably, the method comprises:
1) coating an enzyme-linked plate with the monoclonal antibody of the invention;
2) reacting a sample to be tested with the monoclonal antibody of the invention;
3) detecting and developing rabbit polyclonal antibody prepared by conventional method, and measuring absorbance at 450 nm;
4) and preparing a standard curve by using the heparin standard substance, and calculating the heparin content in the detected sample according to the standard curve.
In another aspect of the invention, a kit containing a monoclonal antibody of the invention is provided. The kit may be used in a detection method selected from the group consisting of: chemiluminescence immunoassay, immunoturbidimetry, enzyme-linked immunosorbent assay (ELISA), Western blotting, antibody microarray, immunoprecipitation, Radioimmunoassay (RIA), and the like. Preferably, the kit is an ELISA detection kit, such as a double antibody sandwich ELISA detection kit, comprising a combination of antibodies according to the invention.
Further preferably, the kit further comprises IgG, a washing reagent, a substrate developing solution A (EDTA-Na, citric acid, glycerol, TMB), a substrate developing solution B (sodium acetate, citric acid, 30% H2O2), a stop solution (2M H2SO4) and BSA, and an enzyme-linked plate and a sealing plate membrane and/or a heparin standard.
In some embodiments, the ELISA assay or sandwich ELISA assay comprises the use of one or more monoclonal antibodies described herein. In one embodiment, the ELISA assay or sandwich ELISA assay comprises exposing a urine sample to a first monoclonal antibody described herein. In one embodiment, the ELISA assay or sandwich ELISA assay comprises exposing the urine sample to a second monoclonal antibody. In one embodiment, the ELISA assay or sandwich ELISA assay comprises exposing a urine sample to a first monoclonal antibody and/or a second monoclonal antibody described herein. In one embodiment, the ELISA assay or sandwich ELISA assay comprises exposing a urine sample to a first monoclonal antibody described herein. In some embodiments, the first monoclonal antibody and/or the second monoclonal antibody used in the ELISA assay or sandwich ELISA assay specifically binds heparin. In some embodiments, the first monoclonal antibody used in the ELISA assay or sandwich ELISA assay binds heparin.
In the present invention, the test object is preferably a human sample; the biological sample is one or more selected from the group consisting of whole blood, plasma, serum, blood cells, ascites, lymph fluid, saliva, sputum, sweat, urine, mucus, interstitial fluid, tissue biopsy, and cells from a subject, preferably whole blood, serum, or plasma.
Optionally, the kits of the invention can have a sensitivity of at least about 35%, at least about 45%, at least about 55%, at least about 65%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% when the invention relates to T1 bladder cancer in situ.
In some embodiments, the methods and uses of the invention may have a sensitivity of at least about 75% when the bladder cancer is T1 bladder cancer.
Advantageous effects
The monoclonal antibody for heparin is prepared and obtained by adopting a hybridoma method, has better specificity and sensitivity, can be used for measuring the content of heparin in a blood sample, and has better application value.
Detailed Description
In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings used in the description of the embodiments or the prior art will be briefly described below, and it is obvious that the drawings in the following description are some embodiments of the present invention, and other drawings can be obtained by those skilled in the art without creative efforts.
Example 1 heparin preparation
Adding distilled water into 100g of isolated lung tissue according to a ratio of 1: 10 (g: mL), fully crushing the lung tissue in a tissue triturator to form meat paste, and transferring the meat paste into a 1000mL beaker for later use. Adjusting the pH value of the meat paste in the cup to 8.5 by adopting 2mol/LNaOH solution, adding 2% protease for enzymolysis for 3h, adding 5% NaCl of the sample amount, stirring for 30s at 60 ℃ every 10min, continuously performing the operation for 2h, immediately heating to 100 ℃ after 2h, standing for 10min to precipitate protein, filtering by using a 100-mesh sieve, and collecting filtrate. Cooling the filtrate to 50 deg.C, adjusting pH to 8.5 with 2mol/L NaOH, adding 8% Dow AMBERLITM FPA98CL food grade special polymer (resin) resin (the resin is washed with distilled water to neutral), continuously adsorbing in a constant temperature magnetic stirrer at 50 deg.C for 8h, filtering with 100 mesh sieve, and collecting the resin for use. Loading the resin into an elution column, repeatedly washing with distilled water until colorless, soaking and washing the resin with 1.2mol/L NaCl for 30min, and discarding the filtrate. Adding 5mol/L NaCl into the resin elution column, soaking for 3h, and collecting the leaching liquor by using a beaker; soaking for 2h (twice continuously) by using 3.5mol/L NaCl, collecting liquid by using the same beaker, and reserving filtrate in the beaker for later use. Adjusting pH of the filtrate to 3.5 with 1: 1 (V: V) HCl, standing for 30min, precipitating acid protein, and filtering with filter paper; adjusting pH of the filtrate with 2mol/L NaOH to 10, standing for 3 hr, precipitating alkali protein, and filtering with filter paper to obtain filtrate. Adding the filtrate into a beaker by using 1.5 times of 95% ethanol by volume, shaking uniformly, standing for 12h, carrying out vacuum filtration, retaining the solid, and collecting the filtrate for ethanol recovery. And (3) drying the solid obtained by suction filtration in a vacuum drying oven at 60 ℃ in vacuum, and weighing by using balance until the difference between the two weighed weights is 0.02g to obtain the heparin crude product. The heparin crude product is prepared into heparin solution with the concentration of 1mg/mL, and the heparin solution is purified by an S5428 resin chromatographic column, wherein the dynamic adsorption conditions of the S5428 resin chromatographic column are that the adsorption temperature is 45 ℃, the heparin solution injection concentration is 1.0mg/mL, the injection speed is 1.5mL/min, the adsorption capacity can reach 3mg/mL, 2.0mol/L NaCl is used as a desorbent, the elution flow rate is 1.5mL/min, the pH value is 8.0, and the elution temperature is 45 ℃. Under the condition, the purified heparin is collected, namely the purified heparin. The concentration of the heparin in the solution is detected to be 287mg/kg by adopting a concentrated sulfuric acid oxidation method, and the heparin titer is detected to be 140U/mg.
EXAMPLE 2 preparation of heparin-specific monoclonal antibodies
The heparin prepared in example 1 was dissolved in 1ml of physiological saline by sucking 1mg of antigen, and mixed well to prepare an antigen solution having a concentration of 1 mg/ml.
And (3) immunizing a female Balb/c mouse with the age of 6 weeks for 6 times by using the repeatedly emulsified immunogen, wherein the specific scheme is as follows: immunogen plus Freund's complete adjuvant for the first immunization, and the volume ratio of the two is l: 1 mixing, injecting the mouse foot pad and the abdomen at multiple points under the skin, 60 ug/mouse, and carrying out the next immunization after 2 weeks; 2 to 5 times of immunization, fully emulsifying the immunogen with Freund incomplete adjuvant, and injecting the mice foot pad and subcutaneous multiple points at 30 ug/mouse at an interval of 2 weeks each time; serum is taken, the titer is measured, and the mouse with the best titer is selected to be injected with 100ul and 50ug of immunogen in the abdominal cavity 3 days before cell fusion is carried out, so as to enhance the immune effect.
Mice on the third day after the boost were sacrificed by cervical pulling. The mice were rinsed with tap water, soaked in 1% benzalkonium bromide solution for 5 minutes, fixed in their right lateral position, aseptically dissected through the abdominal skin, exposed to the peritoneum, dissected through the spleen, removed the fat and connective tissue, and placed in a dish with a small amount of DMEM. The following experimental instruments were sterilized in advance at high temperature: a 200-mesh cell screen, a push rod of a glass syringe and 3 surgical scissors. The cell screen was placed in a dish with a small amount of DMEM while the spleen was carefully placed on the cell screen, the spleen was carefully ground with a glass push rod to allow it to penetrate the cell screen into the DMEM, and after grinding was complete, the spleen cell suspension was collected with a 50ml centrifuge tube. The collected spleen cell suspension was centrifuged, and the supernatant was discarded. And (4) resuspending and precipitating by using DMEM, and blowing uniformly to obtain the spleen cells to be fused, and counting live cells for later use after trypan blue staining. The SP2/O tumor cells and immune spleen cells were mixed according to the ratio of 1: 5, mixing, centrifuging at 2000rpm for 10min, pouring off the supernatant, carefully sucking up the residual liquid by using a suction pipe, slightly vibrating the bottom of the pipe, mixing uniformly, and placing in a water bath environment at 37 ℃. 0.6ml of PEG (MW.4000) was aspirated, and the addition was completed within 1 minute with gentle stirring. The tubes were shaken with addition of lmlDMEM and added over 1.5 minutes. The lmlDMEM was added again within 1 minute, the tube was shaken with addition, and this was repeated three times. Add lOmlDMEM and shake the tube while adding, and add over 1 minute. Centrifuge at 2000rpm for 10min and discard the supernatant. The cell pellet was carefully resuspended in HAT selection medium and plated into a well of a 96-well feeder cell culture plate, 0.1ml per well (2X 105 cells per well based on splenocytes). One well was left to add SP2/O containing HAT selection medium as a control well for SP2/0 sensitivity to HAT. Culturing in a 5% C02 incubator at 37 deg.C, and about the seventh day after cell fusion, all cells in SP2/O control wells die. After 10-14 days, large hybridoma cell clones can be seen, and when the culture solution is yellowish, part of the supernatant can be sucked out for detection.
Screening positive hybridoma cells by an ELISA method to obtain 7 positive hybridoma cell strains in total, observing the growth condition of positive hole cells under a microscope, and finally selecting two strains of cells 1B4 and 5C5 as subclones. The 2 selected cell lines were subcloned by limiting dilution method, and after the 2 cells were cultured in an enlarged scale, the supernatant was collected for antibody purification and the cells were stored for future use. At the same time, a certain number of cells are left to make ascites.
1 week before ascites preparation, 10-week-old female Balb/c mice were injected intraperitoneally with 500 ul/mouse Freund's incomplete adjuvant. Respectively culturing 1B4 and 5C5 positive hybridoma cells to logarithmic growth phase, centrifuging and removing supernatant; resuspend and wash cells 2 times with pre-warmed serum-free IMDM Medium while performing the cytometryCounting; then, the cells were resuspended in an appropriate amount of pre-warmed physiological saline, and hybridoma cells 2X10 were injected intraperitoneally into each mouse6One seed/300 ul. When the ascites of the mouse is obvious, the ascites is collected by a No. 12 injection needle under the aseptic condition, the supernatant is collected by centrifugation at 2000rpm for 10min at 4 ℃, the antibody ascites is purified by adopting a Protein-G immunoaffinity chromatography method and is stored at the temperature of minus 20 ℃ for later use.
Detection by Western blotting: the heparin prepared after purification in example 1 and the crude product in example 1 are used as immunogen to prepare Western blot samples, BSA is used as a control, electrophoresis and membrane conversion are carried out, two monoclonal antibodies to be detected, namely 1B4 and 5C5, are sequentially incubated, the reaction is carried out overnight at 4 ℃, and goat anti-mouse IgG secondary antibody marked by HRP is incubated for 40min at room temperature and then developed. The results are shown in FIG. 1.
From the results in FIG. 1, it can be seen that the purified heparin prepared in example 1 was detected by the two mAbs 1B4 and 5C5 ( lanes 1 and 2, respectively).
Example 25 identification of the subclasses of the C5 and 1B4 antibodies
The subclass of the monoclonal antibody was identified using a mouse antibody subclass identification kit. ELISA plates were coated with antigen, 50 ul/well, and left overnight at 4 ℃. The supernatant was discarded, 200 ul/well of blocking solution was added, and the mixture was incubated at 37 ℃ for 1 hour. The washing solution was washed 3 times, and 1B4 or 5C5 mAbs were added to 9 different wells, 50 ul/well, and wells were set up. Positive controls were added to well 10 and incubated at 37 ℃ for l hours. The liquid was removed and the wash washed 3 times. Normal rabbit serum was added to well 1, specific antibodies against immunoglobulin class or subclass of rabbit were added to wells 2-9, respectively, positive control wells were added with rabbit anti-mouse IgGl antibody, 50 ul/well, and incubated at 37 ℃ for 1 hour. The liquid was removed and the wash washed 3 times. HRP-goat anti-rabbit lgG antibody was added at 50 ul/well and incubated at 37 ℃ for l h. The liquid was removed and the wash washed 3 times. TMB color developing solution is added, 50 ul/hole. Developing at room temperature for 5min, adding 100ul stop solution to terminate the reaction, measuring OD value at 450nm, recording and judging the result. The results are shown in Table 1.
TABLE 1 antibody subtype detection
Clone number
|
Heavy chain class/subclass
|
Light chain subtype
|
1B4
|
IgM
|
κ
|
5C5
|
IgM
|
κ |
As can be seen from the results in Table 1, both antibodies 1B4 and 5C5 are of the IgM subtype and the light chains are kappa.
Example 35C 5 antibody affinity identification
Purified 5C5 antibody was diluted to 10ug/ml with PBST and heparin was diluted with PBST with a gradient using AMC sensors: 444.4nmol/ml, 222.2nmol/ml, 111.1nmol/ml, 55.6nmol/ml, 27.8nmol/ml, 0 nmol/ml; the operation flow is as follows: the balance of PBST is 60s, the immobilized antibody in the antibody solution is 300s, PBST is incubated for 180s, the antigen in the solution is combined for 420s, the dissociation in buffer solution 2 is 1200s, 10mM pH 1.69GLY solution is used for sensor regeneration, data are output, and the result shows that the Kd value of the 5C5 antibody is 4.88E-09M and has better combination property.
Example 45C 5 antibody sequence identification
The total RNA of the 5C5 hybridoma cell is extracted by a kit, and the cDNA is synthesized by reverse transcription. Designing a primer, wherein the specific primer sequence is as follows: heavy chain: an upstream primer: 5'-TGAGGAGACGGTGACCGTGGTCCCTTGGCCCCAGAGGTGCAACTGCAGCAGTCAGG-3', the downstream primer is 5 '-AGGTSMARCTGCAGSAGTCWGG-3' (S/M/R is a degenerate base). Light chain: an upstream primer: 5'-GATGTGAGCTCGTGATGACCCAGACTCC-3', downstream primer: 5 '-GCGCCGTCTAGAATFAACACTCATTCCTGTTGAA-3'. The primers are adopted to carry out PCR amplification, after amplification, a target gene fragment is inserted into a pMD18-T vector, the vector is transferred into a competent cell DH5a, bacteria liquid PCR identification, sequencing and sequencing results are analyzed by IMGT/V-Quest software, and the results show that the light chain sequence and the heavy chain sequence of the 5C5 antibody are respectively shown as follows.
Light chain variable region (SEQ ID NO: 1)
DIVITQAPALMAASPGEKVTITCFGTTYFSADSPYWYQQKSGISPKPWIYTTHPPHRGVPARFSGSGSGTSYSLTITSMEAEDAATYYCATRPTRHVKFGAGTKLELK
Heavy chain variable region (SEQ ID NO: 2)
EVQLEESATELARPGARVKLSCKASGYIFSNEIGHWIKQRPGQGLEWIGEWWGQGYFLMQLPIAYGKATLTADKSSSTAYMQLSSLASEDSAVYYCAGSCNNTKGWGLGTTLAVSS。
Example 5 detection of heparin content in blood
2 cases of hemodialysis, collecting blood 30min after heparinization, wherein the administration dose is 62.6-100U/kg, collecting blood by vein 9: 1 proportion, 10 for anticoagulant9Centrifuging at 3000r/min for 15min with mmol/L sodium citrate, and collecting plasma for detection.
ELISA detection method: the heparin is diluted by PBS in a series of concentration gradients, a 96-well plate is coated at 37 ℃ for 2h, 3% fetal bovine serum is sealed, 5C5 monoclonal antibody diluted 2000 times is added, then goat anti-mouse IgG marked by HRP is added, ABTS is used for color development, the absorbance at 450nm is measured, and a standard curve is drawn. The results of calculating the heparin concentration according to the ELISA detection method and the standard curve using the above plasma as a detection sample are shown in Table 2 below. Spectrophotometry as commonly used in the art was used as a control.
TABLE 2 heparin content
Sample(s)
|
ELISA assay(s) (ii)U/L)
|
Spectrophotometry (U/L)
|
Case 1
|
452.8±24.63
|
458.9±19.23
|
Case 2
|
486.1±21.03
|
491.9±21.03 |
The detection results of case 1 and case 2 are basically consistent with the heparin content which is conventionally detected by using the spectroscopic photovoltaic light emission in the field, which shows that the monoclonal antibody of the invention can be used for detecting the heparin content in blood.
Example 6 detection of heparin content in urine of patients with bladder cancer
10 patients with bladder cancer in clinical stages of Ta-T1 stage and 10 patients with normal bladder cancer are taken, and 10mL of clean midnight urine is left in each group of subjects. The heparin level in the sample was measured in a similar manner to example 5, and the results are shown in Table 3.
TABLE 3 heparin content
As can be seen from Table 3, the content of heparin in the urine of patients with bladder cancer is higher than that of healthy persons, and the results of the detection method using the monoclonal antibody of the present invention are substantially similar to those of the spectrophotometric detection method commonly used in the art. But the detection operation of the invention is more convenient, the batch rapid detection can be realized, and the effect is higher.
Finally, it should be noted that: the above embodiments are only used to illustrate the technical solution of the present invention, and not to limit the same; while the invention has been described in detail and with reference to the foregoing embodiments, it will be understood by those skilled in the art that: the technical solutions described in the foregoing embodiments may still be modified, or some or all of the technical features may be equivalently replaced; and the modifications or the substitutions do not make the essence of the corresponding technical solutions depart from the scope of the technical solutions of the embodiments of the present invention.
Sequence listing
<110> Beijing Bao Picture Biotechnology Ltd
<120> monoclonal antibody and application thereof in disease diagnosis and detection
<160> 2
<170> SIPOSequenceListing 1.0
<210> 1
<211> 108
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 1
Asp Ile Val Ile Thr Gln Ala Pro Ala Leu Met Ala Ala Ser Pro Gly
1 5 10 15
Glu Lys Val Thr Ile Thr Cys Phe Gly Thr Thr Tyr Phe Ser Ala Asp
20 25 30
Ser Pro Tyr Trp Tyr Gln Gln Lys Ser Gly Ile Ser Pro Lys Pro Trp
35 40 45
Ile Tyr Thr Thr His Pro Pro His Arg Gly Val Pro Ala Arg Phe Ser
50 55 60
Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Thr Ser Met Glu
65 70 75 80
Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Ala Thr Arg Pro Thr Arg His
85 90 95
Val Lys Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
100 105
<210> 2
<211> 116
<212> PRT
<213> Artificial Sequence (Artificial Sequence)
<400> 2
Glu Val Gln Leu Glu Glu Ser Ala Thr Glu Leu Ala Arg Pro Gly Ala
1 5 10 15
Arg Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Ile Phe Ser Asn Glu
20 25 30
Ile Gly His Trp Ile Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45
Gly Glu Trp Trp Gly Gln Gly Tyr Phe Leu Met Gln Leu Pro Ile Ala
50 55 60
Tyr Gly Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr
65 70 75 80
Met Gln Leu Ser Ser Leu Ala Ser Glu Asp Ser Ala Val Tyr Tyr Cys
85 90 95
Ala Gly Ser Cys Asn Asn Thr Lys Gly Trp Gly Leu Gly Thr Thr Leu
100 105 110
Ala Val Ser Ser
115