CN112521494B - Monoclonal antibody 2B11 for resisting SARS-CoV-2 - Google Patents
Monoclonal antibody 2B11 for resisting SARS-CoV-2 Download PDFInfo
- Publication number
- CN112521494B CN112521494B CN202010567918.XA CN202010567918A CN112521494B CN 112521494 B CN112521494 B CN 112521494B CN 202010567918 A CN202010567918 A CN 202010567918A CN 112521494 B CN112521494 B CN 112521494B
- Authority
- CN
- China
- Prior art keywords
- seq
- amino acid
- monoclonal antibody
- acid sequence
- cov
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 241001678559 COVID-19 virus Species 0.000 title claims abstract description 29
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 14
- 239000003814 drug Substances 0.000 claims description 6
- 238000002360 preparation method Methods 0.000 claims description 6
- 101800000904 Spike protein S1 Proteins 0.000 claims description 5
- 239000003153 chemical reaction reagent Substances 0.000 claims description 5
- 201000010099 disease Diseases 0.000 claims description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 4
- 230000002265 prevention Effects 0.000 claims description 4
- 230000000890 antigenic effect Effects 0.000 claims description 2
- 230000002401 inhibitory effect Effects 0.000 claims description 2
- 150000007523 nucleic acids Chemical group 0.000 claims description 2
- 230000009385 viral infection Effects 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims 1
- 150000001413 amino acids Chemical group 0.000 description 19
- 230000000903 blocking effect Effects 0.000 description 14
- 230000027455 binding Effects 0.000 description 13
- 238000001514 detection method Methods 0.000 description 11
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 108091005609 SARS-CoV-2 Spike Subunit S1 Proteins 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 108010089804 glycyl-threonine Proteins 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 3
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 3
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 3
- 230000010530 Virus Neutralization Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- WVCJSDCHTUTONA-FXQIFTODSA-N Asn-Asp-Arg Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WVCJSDCHTUTONA-FXQIFTODSA-N 0.000 description 2
- 208000025721 COVID-19 Diseases 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- ZSWGJYOZWBHROQ-RWRJDSDZSA-N Glu-Ile-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZSWGJYOZWBHROQ-RWRJDSDZSA-N 0.000 description 2
- IBMVEYRWAWIOTN-UHFFFAOYSA-N L-Leucyl-L-Arginyl-L-Proline Natural products CC(C)CC(N)C(=O)NC(CCCN=C(N)N)C(=O)N1CCCC1C(O)=O IBMVEYRWAWIOTN-UHFFFAOYSA-N 0.000 description 2
- IBMVEYRWAWIOTN-RWMBFGLXSA-N Leu-Arg-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(O)=O IBMVEYRWAWIOTN-RWMBFGLXSA-N 0.000 description 2
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 2
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 2
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 description 2
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 description 2
- CVIXTAITYJQMPE-LAEOZQHASA-N Val-Glu-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O CVIXTAITYJQMPE-LAEOZQHASA-N 0.000 description 2
- BZWUSZGQOILYEU-STECZYCISA-N Val-Ile-Tyr Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 BZWUSZGQOILYEU-STECZYCISA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 239000005018 casein Substances 0.000 description 2
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 2
- 235000021240 caseins Nutrition 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 108010031719 prolyl-serine Proteins 0.000 description 2
- 108090000623 proteins and genes Proteins 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 1
- KXEVYGKATAMXJJ-ACZMJKKPSA-N Ala-Glu-Asp Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O KXEVYGKATAMXJJ-ACZMJKKPSA-N 0.000 description 1
- RTZCUEHYUQZIDE-WHFBIAKZSA-N Ala-Ser-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RTZCUEHYUQZIDE-WHFBIAKZSA-N 0.000 description 1
- PQWTZSNVWSOFFK-FXQIFTODSA-N Arg-Asp-Asn Chemical compound C(C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)CN=C(N)N PQWTZSNVWSOFFK-FXQIFTODSA-N 0.000 description 1
- OTCJMMRQBVDQRK-DCAQKATOSA-N Arg-Asp-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O OTCJMMRQBVDQRK-DCAQKATOSA-N 0.000 description 1
- FEZJJKXNPSEYEV-CIUDSAMLSA-N Arg-Gln-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O FEZJJKXNPSEYEV-CIUDSAMLSA-N 0.000 description 1
- QLSRIZIDQXDQHK-RCWTZXSCSA-N Arg-Val-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QLSRIZIDQXDQHK-RCWTZXSCSA-N 0.000 description 1
- YQPSDMUGFKJZHR-QRTARXTBSA-N Asn-Trp-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CC(=O)N)N YQPSDMUGFKJZHR-QRTARXTBSA-N 0.000 description 1
- NJPLPRFQLBZAMH-IHRRRGAJSA-N Asn-Tyr-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCSC)C(O)=O NJPLPRFQLBZAMH-IHRRRGAJSA-N 0.000 description 1
- MJIJBEYEHBKTIM-BYULHYEWSA-N Asn-Val-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)N)N MJIJBEYEHBKTIM-BYULHYEWSA-N 0.000 description 1
- RDRMWJBLOSRRAW-BYULHYEWSA-N Asp-Asn-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O RDRMWJBLOSRRAW-BYULHYEWSA-N 0.000 description 1
- VAWNQIGQPUOPQW-ACZMJKKPSA-N Asp-Glu-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O VAWNQIGQPUOPQW-ACZMJKKPSA-N 0.000 description 1
- KFAFUJMGHVVYRC-DCAQKATOSA-N Asp-Leu-Met Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(O)=O KFAFUJMGHVVYRC-DCAQKATOSA-N 0.000 description 1
- JSHWXQIZOCVWIA-ZKWXMUAHSA-N Asp-Ser-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O JSHWXQIZOCVWIA-ZKWXMUAHSA-N 0.000 description 1
- ALMIMUZAWTUNIO-BZSNNMDCSA-N Asp-Tyr-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ALMIMUZAWTUNIO-BZSNNMDCSA-N 0.000 description 1
- GYNUXDMCDILYIQ-QRTARXTBSA-N Asp-Val-Trp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(=O)O)N GYNUXDMCDILYIQ-QRTARXTBSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 208000028399 Critical Illness Diseases 0.000 description 1
- FCXJJTRGVAZDER-FXQIFTODSA-N Cys-Val-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O FCXJJTRGVAZDER-FXQIFTODSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- UFNSPPFJOHNXRE-AUTRQRHGSA-N Gln-Gln-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O UFNSPPFJOHNXRE-AUTRQRHGSA-N 0.000 description 1
- MSHXWFKYXJTLEZ-CIUDSAMLSA-N Gln-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N MSHXWFKYXJTLEZ-CIUDSAMLSA-N 0.000 description 1
- FQCILXROGNOZON-YUMQZZPRSA-N Gln-Pro-Gly Chemical compound NC(=O)CC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O FQCILXROGNOZON-YUMQZZPRSA-N 0.000 description 1
- RWQCWSGOOOEGPB-FXQIFTODSA-N Gln-Ser-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O RWQCWSGOOOEGPB-FXQIFTODSA-N 0.000 description 1
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 1
- HQTDNEZTGZUWSY-XVKPBYJWSA-N Glu-Val-Gly Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)CCC(O)=O)C(=O)NCC(O)=O HQTDNEZTGZUWSY-XVKPBYJWSA-N 0.000 description 1
- KRRMJKMGWWXWDW-STQMWFEESA-N Gly-Arg-Phe Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KRRMJKMGWWXWDW-STQMWFEESA-N 0.000 description 1
- BYYNJRSNDARRBX-YFKPBYRVSA-N Gly-Gln-Gly Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O BYYNJRSNDARRBX-YFKPBYRVSA-N 0.000 description 1
- QPCVIQJVRGXUSA-LURJTMIESA-N Gly-Gly-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)CNC(=O)CN QPCVIQJVRGXUSA-LURJTMIESA-N 0.000 description 1
- ULZCYBYDTUMHNF-IUCAKERBSA-N Gly-Leu-Glu Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O ULZCYBYDTUMHNF-IUCAKERBSA-N 0.000 description 1
- MIIVFRCYJABHTQ-ONGXEEELSA-N Gly-Leu-Val Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O MIIVFRCYJABHTQ-ONGXEEELSA-N 0.000 description 1
- OJNZVYSGVYLQIN-BQBZGAKWSA-N Gly-Met-Asp Chemical compound [H]NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(O)=O OJNZVYSGVYLQIN-BQBZGAKWSA-N 0.000 description 1
- JQFILXICXLDTRR-FBCQKBJTSA-N Gly-Thr-Gly Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)NCC(O)=O JQFILXICXLDTRR-FBCQKBJTSA-N 0.000 description 1
- TVTZEOHWHUVYCG-KYNKHSRBSA-N Gly-Thr-Thr Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O TVTZEOHWHUVYCG-KYNKHSRBSA-N 0.000 description 1
- FBGXMKUWQFPHFB-JBDRJPRFSA-N Ile-Ser-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N FBGXMKUWQFPHFB-JBDRJPRFSA-N 0.000 description 1
- ZLFNNVATRMCAKN-ZKWXMUAHSA-N Ile-Ser-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)NCC(=O)O)N ZLFNNVATRMCAKN-ZKWXMUAHSA-N 0.000 description 1
- GPICTNQYKHHHTH-GUBZILKMSA-N Leu-Gln-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O GPICTNQYKHHHTH-GUBZILKMSA-N 0.000 description 1
- JDBQSGMJBMPNFT-AVGNSLFASA-N Leu-Pro-Val Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O JDBQSGMJBMPNFT-AVGNSLFASA-N 0.000 description 1
- KIZIOFNVSOSKJI-CIUDSAMLSA-N Leu-Ser-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N KIZIOFNVSOSKJI-CIUDSAMLSA-N 0.000 description 1
- LCNASHSOFMRYFO-WDCWCFNPSA-N Leu-Thr-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O LCNASHSOFMRYFO-WDCWCFNPSA-N 0.000 description 1
- AIMGJYMCTAABEN-GVXVVHGQSA-N Leu-Val-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O AIMGJYMCTAABEN-GVXVVHGQSA-N 0.000 description 1
- SBQDRNOLGSYHQA-YUMQZZPRSA-N Lys-Ser-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SBQDRNOLGSYHQA-YUMQZZPRSA-N 0.000 description 1
- 239000012515 MabSelect SuRe Substances 0.000 description 1
- OOSPRDCGTLQLBP-NHCYSSNCSA-N Met-Glu-Val Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O OOSPRDCGTLQLBP-NHCYSSNCSA-N 0.000 description 1
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 1
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 1
- 101001028244 Onchocerca volvulus Fatty-acid and retinol-binding protein 1 Proteins 0.000 description 1
- JARJPEMLQAWNBR-GUBZILKMSA-N Pro-Asp-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O JARJPEMLQAWNBR-GUBZILKMSA-N 0.000 description 1
- UIMCLYYSUCIUJM-UWVGGRQHSA-N Pro-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 UIMCLYYSUCIUJM-UWVGGRQHSA-N 0.000 description 1
- DXTOOBDIIAJZBJ-BQBZGAKWSA-N Pro-Gly-Ser Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(O)=O DXTOOBDIIAJZBJ-BQBZGAKWSA-N 0.000 description 1
- FDMKYQQYJKYCLV-GUBZILKMSA-N Pro-Pro-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 FDMKYQQYJKYCLV-GUBZILKMSA-N 0.000 description 1
- SQBLRDDJTUJDMV-ACZMJKKPSA-N Ser-Glu-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O SQBLRDDJTUJDMV-ACZMJKKPSA-N 0.000 description 1
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 1
- MFQMZDPAZRZAPV-NAKRPEOUSA-N Ser-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CO)N MFQMZDPAZRZAPV-NAKRPEOUSA-N 0.000 description 1
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 1
- XSLXHSYIVPGEER-KZVJFYERSA-N Thr-Ala-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O XSLXHSYIVPGEER-KZVJFYERSA-N 0.000 description 1
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 1
- IJVNLNRVDUTWDD-MEYUZBJRSA-N Thr-Leu-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O IJVNLNRVDUTWDD-MEYUZBJRSA-N 0.000 description 1
- DXPURPNJDFCKKO-RHYQMDGZSA-N Thr-Lys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O DXPURPNJDFCKKO-RHYQMDGZSA-N 0.000 description 1
- MXDOAJQRJBMGMO-FJXKBIBVSA-N Thr-Pro-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O MXDOAJQRJBMGMO-FJXKBIBVSA-N 0.000 description 1
- GFRIEEKFXOVPIR-RHYQMDGZSA-N Thr-Pro-Lys Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O GFRIEEKFXOVPIR-RHYQMDGZSA-N 0.000 description 1
- FWTFAZKJORVTIR-VZFHVOOUSA-N Thr-Ser-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O FWTFAZKJORVTIR-VZFHVOOUSA-N 0.000 description 1
- GRIUMVXCJDKVPI-IZPVPAKOSA-N Thr-Thr-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O GRIUMVXCJDKVPI-IZPVPAKOSA-N 0.000 description 1
- BKVICMPZWRNWOC-RHYQMDGZSA-N Thr-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)[C@@H](C)O BKVICMPZWRNWOC-RHYQMDGZSA-N 0.000 description 1
- KZTLZZQTJMCGIP-ZJDVBMNYSA-N Thr-Val-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KZTLZZQTJMCGIP-ZJDVBMNYSA-N 0.000 description 1
- PXQPYPMSLBQHJJ-WFBYXXMGSA-N Trp-Asp-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N PXQPYPMSLBQHJJ-WFBYXXMGSA-N 0.000 description 1
- ZHDQRPWESGUDST-JBACZVJFSA-N Trp-Phe-Gln Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)N)C(=O)N[C@@H](CCC(N)=O)C(O)=O)C1=CC=CC=C1 ZHDQRPWESGUDST-JBACZVJFSA-N 0.000 description 1
- BURPTJBFWIOHEY-UWJYBYFXSA-N Tyr-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BURPTJBFWIOHEY-UWJYBYFXSA-N 0.000 description 1
- GULIUBBXCYPDJU-CQDKDKBSSA-N Tyr-Leu-Ala Chemical compound [O-]C(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CC1=CC=C(O)C=C1 GULIUBBXCYPDJU-CQDKDKBSSA-N 0.000 description 1
- KYPMKDGKAYQCHO-RYUDHWBXSA-N Tyr-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 KYPMKDGKAYQCHO-RYUDHWBXSA-N 0.000 description 1
- ZPFLBLFITJCBTP-QWRGUYRKSA-N Tyr-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O ZPFLBLFITJCBTP-QWRGUYRKSA-N 0.000 description 1
- MWUYSCVVPVITMW-IGNZVWTISA-N Tyr-Tyr-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 MWUYSCVVPVITMW-IGNZVWTISA-N 0.000 description 1
- ANHVRCNNGJMJNG-BZSNNMDCSA-N Tyr-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CS)C(=O)O)N)O ANHVRCNNGJMJNG-BZSNNMDCSA-N 0.000 description 1
- NVJCMGGZHOJNBU-UFYCRDLUSA-N Tyr-Val-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N NVJCMGGZHOJNBU-UFYCRDLUSA-N 0.000 description 1
- 108010008685 alanyl-glutamyl-aspartic acid Proteins 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 1
- 108010070783 alanyltyrosine Proteins 0.000 description 1
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 108010056582 methionylglutamic acid Proteins 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 238000009832 plasma treatment Methods 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 108010020755 prolyl-glycyl-glycine Proteins 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 210000003370 receptor cell Anatomy 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 108010009962 valyltyrosine Proteins 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Veterinary Medicine (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a monoclonal antibody 2B11 for resisting SARS-CoV-2, six CDR areas of the antibody are: (1) heavy chain CDR1(VHCDR1) comprises the amino acid sequence shown in SEQ ID No. 1; (2) heavy chain CDR2(VHCDR2) comprises the amino acid sequence shown in SEQ ID No. 2; (3) heavy chain CDR3(VHCDR3) comprises the amino acid sequence shown in SEQ ID No. 3; (4) the light chain CDR1(VLCDR1) comprises the amino acid sequence shown in SEQ ID No. 4; (5) the light chain CDR2(VLCDR2) comprises the amino acid sequence shown in SEQ ID NO. 5; (6) the light chain CDR3(VLCDR3) comprises the amino acid sequence shown in SEQ ID NO. 6.
Description
Technical Field
The invention belongs to the technical field of biological medicines, and particularly relates to a monoclonal antibody 2B11 for resisting SARS-CoV-2.
Background
SARS-CoV-2 is a novel coronavirus which has caused a global pandemic since the outbreak in 2019, and seriously threatens global public health. At present, no vaccine or specific medicine which is proved to be effective for SARS-CoV-2 virus is available on the market, so that the development of new preventive and therapeutic measures is urgently needed.
Convalescent plasma containing high concentrations of anti-SARS-CoV-2 antibody has shown positive effects in therapy, suggesting that anti-SARS-CoV-2 specific antibodies are effective in blocking virus binding to cells. In addition, a series of monoclonal antibodies having neutralizing activity have been developed during outbreaks of severe infectious diseases such as SARS and MERS, and have been proven to be safe and effective in the prevention and treatment of diseases. These suggest that in response to SARS-CoV-2 virus, it is possible to prepare monoclonal antibodies against SARS-CoV-2, particularly fully human monoclonal antibodies. The antibody can prevent virus invasion by blocking the combination of SARS-CoV-2 and receptor cells to achieve the protection effect, has the advantage of smaller side effect compared with humanized or human-mouse chimeric antibody, and provides a new means for specific prevention and treatment of COVID-19.
Disclosure of Invention
The invention firstly relates to a monoclonal antibody 2B11 aiming at SARS-CoV-2 virus, which is characterized in that the six CDR regions of the antibody are:
(1) the heavy chain CDR1(VHCDR1) comprises the amino acid sequence shown in SEQ ID No. 1: EITVSSNYMN, respectively;
(2) the heavy chain CDR2(VHCDR2) comprises the amino acid sequence shown in SEQ ID NO. 2: VIYSGGTTYYADSVKG, respectively;
(3) the heavy chain CDR3(VHCDR3) comprises the amino acid sequence shown in SEQ ID NO. 3: DLMEVGGMDV, respectively;
(4) the light chain CDR1(VLCDR1) comprises the amino acid sequence shown in SEQ ID No. 4: SGSSSNVENDNVN, respectively;
(5) the light chain CDR2(VLCDR2) comprises the amino acid sequence shown in SEQ ID NO. 5: NDRLRPS;
(6) the light chain CDR3(VLCDR3) comprises the amino acid sequence shown in SEQ ID NO. 6: VAWDASLQSYV are provided.
Further, in the above-mentioned case,
the full length of the heavy chain variable region of the monoclonal antibody 2B11 comprises an amino acid sequence shown as SEQ ID NO. 7: EVQLVESGGGLVQPGGSLRLSCAASEITVSSNYMNWVRQAPGKGLEWVSVIYSGGTTYYADSVKGRFTISRDNSENTLYLQMNSLRAEDTAVYYCARDLMEVGGMDVWGQGTTVTVSS;
The full length of the variable region of the light chain of the monoclonal antibody 2B11 comprises an amino acid sequence shown as SEQ ID NO. 8: LPVLTQPPSASGTPGQRVTISCSGSSSNVENDNVNWFQQQVPGSTPKLVIYNDRLRPSGVPDRFSGSKSGTSAYLAISGLQSEDEADYYCVAWDASLQSYVFGTGTKVTVL。
Further, the monoclonal antibody 2B11 is a human IgG type antibody.
Furthermore, the antigen bound by the monoclonal antibody 2B11 is spike protein S1 of SARS-CoV-2 virus, and specifically, the antigenic structural region bound by the monoclonal antibody 2B11 is RBD structural region in spike protein S1 of SARS-CoV-2 virus.
Most preferably, the light chain variable region and the heavy chain variable region of monoclonal antibody 2B11 are the amino acid sequences shown in SEQ ID NO.8 and SEQ ID NO.7, respectively.
The invention also relates to a nucleic acid fragment encoding the monoclonal antibody 2B 11.
The invention also relates to an antibody, wherein the light chain of the antibody is:
(1) the amino acid sequence shown in SEQ ID NO.8 is replaced, deleted or added with one or more amino acids to form a sequence with the same function;
or (2) an amino acid sequence with homology of more than 95 percent with the amino acid sequence shown in SEQ ID NO. 8;
the heavy chain of the antibody is:
(1) the amino acid sequence shown in SEQ ID NO.7 is replaced, deleted or added with one or more amino acids to form a sequence with the same function;
or (2) an amino acid sequence with homology of more than 95 percent with the amino acid sequence shown in SEQ ID NO. 7.
The invention also includes the application of the monoclonal antibody 2B11 in the preparation of a reagent for detecting SARS-CoV-2 virus.
The invention also includes the application of the monoclonal antibody 2B11 in the preparation of a reagent for inhibiting SARS-CoV-2 virus.
The invention also includes the application of the monoclonal antibody 2B11 in preparing medicaments for preventing and/or treating diseases caused by SARS-CoV-2 virus infection.
The invention has the beneficial effects that: because there are no vaccines and specific drugs on the market for the diseases caused by SARS-CoV-2 virus, although the convalescent plasma treatment has been proved to be a promising treatment method, the large-scale preparation is limited, and the method mainly aims at patients with severe and critical illness, while the monoclonal antibody has the advantages of high purity, strong targeting property, small side effect, large-scale preparation and the like. The experimental result of the 2B11 antibody shows that the neutralizing activity and the blocking activity of the monoclonal antibody 2B11 are both high. Therefore, the human monoclonal antibody 2B11 obtained by the invention provides a new candidate drug for specific prevention and treatment of COVID-19.
Drawings
FIG. 1, SDS-PAGE electrophoresis detection of monoclonal antibody 2B 11: lane 1 is a non-reducing SDS-PAGE electrophoresis, and lane 2 is a reducing SDS-PAGE electrophoresis.
FIG. 2 SEC-HPLC detection of monoclonal antibody 2B 11.
FIG. 3, results of the detection of the binding activity of monoclonal antibody 2B 11. A is the binding activity against SARS-CoV-2 spike protein S1; b is the binding activity against the RBD domain of the SARS-CoV-2 spike protein S1.
FIG. 4 shows the results of the detection of the blocking activity of monoclonal antibody 2B 11. A is the blocking activity against SARS-CoV-2 spike protein S1; b is blocking activity against the RBD domain of SARS-CoV-2 spike protein S1.
FIG. 5 shows the result of affinity detection of monoclonal antibody 2B 11.
FIG. 6, the results of the live virus neutralization assay of monoclonal antibody 2B 11.
Detailed Description
Unless otherwise specified, the technical means used in the following examples are conventional means well known to those skilled in the art, and all reagent consumables are commercially available.
Example 1 construction, expression and purification of monoclonal antibody 2B11 expression vector
The coding gene segments containing the heavy chain and light chain variable regions of the 2B11 antibody are respectively integrated into pcDNA3.4 expression vectors containing the heavy chain and light chain constant region sequences of the human IgG1 antibody to obtain recombinant expression vectors capable of respectively expressing the heavy chain and the light chain of the target antibody.
Transfection of cells, antibody expression and purification:
1. transfection: transfection was performed using the transfection kit from Gibco, Inc. according to the instructions, and the procedure is briefly described as follows:
mixing the two recombinant expression vector total DNAs with a transfection reagent to form a DNA Expifeactine (TM) 293 complex;
then 40mL of 2.94X10 was added6one/mL in Expi293 cell culture;
finally, the cells were incubated at 37 ℃ and 125rpm with 8% CO 2.
2. And (3) purification:
after 5 days of incubation, the supernatant was collected by centrifugation at 4000rpm for 10 minutes at 25 ℃ and then purified by a MabSelect Sure affinity column. The purification steps are briefly described as follows:
equilibrating with 0.1M Tris buffer, pH 7.0;
after loading, eluting with 0.1M Tris buffer solution with pH7.0;
elution was then carried out with 1.0M Tris buffer, pH 8.0.
The eluate was collected and further dialyzed against PBS buffer. The purified antibody was subjected to SDS-PAGE and HPLC-SEC detection.
3. And (4) analyzing results: the results of SDS-PAGE are shown in FIG. 1, which shows that the human SARS-CoV-2 antibody exhibits a band with a molecular weight of about 150kDa under non-reducing conditions; two bands with molecular weights of approximately 50kDa and 25kDa are present under reducing conditions, corresponding to the heavy and light chains of the antibody, respectively. The SEC-HPLC results are shown in FIG. 2, which shows that the purity of the purified monoclonal antibody reaches more than 99%. The amino acid sequence of the purified monoclonal antibody obtained by peptide map analysis is consistent with the expected amino acid sequence. Specifically, the sequences of the light chain variable region and the heavy chain variable region are respectively the same as SEQ ID NO.8 and SEQ ID NO. 7.
Example 2 functional analysis of antibodies
1. Detection of binding Activity of human anti-SARS-CoV-2 antibody 2B11 with antigen
The binding ability of the antibody to the spike protein S1 and RBD domain of SARS-CoV-2 virus was determined by ELISA. The steps are briefly described as follows:
(1) SARS-CoV-2 spike S1-His recombinant protein (Sino company, goods number: 40591-V08H) or RBD structure domain recombinant protein (Sino company, goods number 40592-V05H) is used as coating antigen, 1.0 mu g/mL antigen is coated on an enzyme label plate by bicarbonate buffer solution, and the temperature is kept at 4 ℃ overnight;
(2) blocking with casein buffer at 37 ℃ for 1 h; adding the serially diluted antibodies to be detected, and keeping the temperature at 37 ℃ for 1 h;
(3) adding 1: 10000 diluted goat anti-human IgG-HRP (Bethyl company, cat # A80-304P), 37 ℃ for 1 h;
(4) after developing with developing solution, terminating the reaction by 2M HCl; and detecting absorbance A450 and A540 values by a microplate reader.
As a result:
the results of the detection of the binding activity of the 2B11 antibody to the antigen are shown in fig. 3, and it can be seen that the binding activity of monoclonal antibody 2B11 against S1 protein (fig. 3.a) is EC50 ═ 0.051 nM; the binding activity against the RBD domain (fig. 3.B) was EC50 ═ 0.047 nM.
2. Detection of blocking Activity of human anti-SARS-CoV-2 antibody 2B11
ELISA assay was used to test the ability of the antibody to block the binding of ACE2 recombinant protein (His-tagged) to the spike protein S1 and RBD domain of SARS-CoV-2(2019-nCoV) virus. The steps are briefly described as follows:
(1) SARS-CoV-2 spike S1 subunit protein (Sino company, cat # 40591-V02H) or RBD recombinant protein (Sino company, cat # 40592-V05H) is used as coating antigen, 1.0 mug/mL antigen is coated on the ELISA plate by bicarbonate buffer solution, and the temperature is kept at 4 ℃ overnight;
(2) blocking with casein buffer at 37 ℃ for 1 h; adding the antibody to be detected after serial dilution and ACE recombinant protein with the concentration of 0.5 mu g/mL or 0.02 mu g/mL for co-incubation at 37 ℃ for 1 h;
(3) adding 1: 3000 diluted biotin-labeled mouse anti-His tag antibody (GenScript, Cat: A00613), 1h at 37 ℃;
(4) adding 1: 20000 diluted streptavidin-HRP (Thermofeisher Co., Ltd., cat # SNN1004), 37 ℃ for 1 h; after developing with developing solution, terminating the reaction by 2M HCl; and detecting absorbance A450 and A540 values by a microplate reader.
As a result:
the detection result of the antibody blocking activity of 2B11 is shown in fig. 4, and it can be seen that the blocking activity of monoclonal antibody 2B11 against the binding of ACE2 and S1 (fig. 4.a) is IC50 ═ 2.792nM, and the maximum blocking rate is 95.43%; the blocking activity against ACE2 binding to RBD (fig. 4.B) was IC 50-1.956 nM with a maximum blocking rate of 99.21%.
3. Affinity detection of human anti-SARS-CoV-2 antibody 2B11
A Biacore 8K instrument of GE company is used for carrying out a surface plasma resonance experiment to detect the affinity of the antibody.
The results of the affinity assay for monoclonal antibody 2B11 are shown in FIG. 5, which shows that the 2B11 has a binding constant ka of 1.70E + 51/Ms, a dissociation constant KD of 8.08E-41/s, and an affinity constant KD of 4.76E-9M.
4. Living virus neutralization assay for human anti-SARS-CoV-2 antibodies
The virus plaque reduction neutralization test was carried out using the SARS-CoV-2 virus BetacoV/Wuhan/IVDC-HB-envF13/2020 strain. The steps are briefly described as follows: a quantitative amount of SARS-CoV-2 virus and a dilution series of the monoclonal antibody were mixed and incubated, and then added to a previously prepared assay plate containing Vero cells, and after incubation, the number of viral plaques was observed and the virus-neutralizing activity (expressed as IC 50) was calculated.
As a result:
the result of the live virus neutralization test of the antibody 2B11 is shown in FIG. 6, and the monoclonal antibody can well neutralize SARS-CoV-2 virus (IC50<0.98 ng/mL).
Finally, it should be noted that the above embodiments are only used to help those skilled in the art understand the essence of the present invention, and are not intended to limit the protection scope of the present invention.
SEQUENCE LISTING
<110> Wuhan Biometrics institute of Biotechnology, Inc
<120> monoclonal antibody 2B11 for resisting SARS-CoV-2
<210> 1
<211> 10
<212> PRT
<213> Artificial sequence
<400> 1
Glu Ile Thr Val Ser Ser Asn Tyr Met Asn
1 5 10
<210> 2
<211> 16
<212> PRT
<213> Artificial sequence
<400> 2
Val Ile Tyr Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val Lys Gly
1 5 10 15
<210> 3
<211> 10
<212> PRT
<213> Artificial sequence
<400> 3
Asp Leu Met Glu Val Gly Gly Met Asp Val
1 5 10
<210> 4
<211> 13
<212> PRT
<213> Artificial sequence
<400> 4
Ser Gly Ser Ser Ser Asn Val Glu Asn Asp Asn Val Asn
1 5 10
<210> 5
<211> 7
<212> PRT
<213> Artificial sequence
<400> 5
Asn Asp Arg Leu Arg Pro Ser
1 5
<210> 6
<211> 11
<212> PRT
<213> Artificial sequence
<400> 6
Val Ala Trp Asp Ala Ser Leu Gln Ser Tyr Val
1 5 10
<210> 7
<211> 118
<212> PRT
<213> Artificial sequence
<400> 7
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Glu Ile Thr Val Ser Ser Asn
20 25 30
Tyr Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Val Ile Tyr Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val Lys
50 55 60
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Glu Asn Thr Leu Tyr Leu
65 70 75 80
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95
Arg Asp Leu Met Glu Val Gly Gly Met Asp Val Trp Gly Gln Gly Thr
100 105 110
Thr Val Thr Val Ser Ser
115
<210> 8
<211> 111
<212> PRT
<213> Artificial sequence
<400> 8
Leu Pro Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln
1 5 10 15
Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Val Glu Asn Asp
20 25 30
Asn Val Asn Trp Phe Gln Gln Gln Val Pro Gly Ser Thr Pro Lys Leu
35 40 45
Val Ile Tyr Asn Asp Arg Leu Arg Pro Ser Gly Val Pro Asp Arg Phe
50 55 60
Ser Gly Ser Lys Ser Gly Thr Ser Ala Tyr Leu Ala Ile Ser Gly Leu
65 70 75 80
Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Val Ala Trp Asp Ala Ser
85 90 95
Leu Gln Ser Tyr Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu
100 105 110
Claims (8)
1. Monoclonal antibody 2B11 directed against SARS-CoV-2 virus, comprising the six CDR regions:
(1) the heavy chain CDR1(VHCDR1) amino acid sequence is shown in SEQ ID NO. 1: EITVSSNYMN, respectively;
(2) the heavy chain CDR2(VHCDR2) amino acid sequence is shown in SEQ ID NO. 2: VIYSGGTTYYADSVKG, respectively;
(3) the heavy chain CDR3(VHCDR3) amino acid sequence is shown in SEQ ID NO. 3: DLMEVGGMDV, respectively;
(4) the light chain CDR1(VLCDR1) has the amino acid sequence shown in SEQ ID NO. 4: SGSSSNVENDNVN, respectively;
(5) the light chain CDR2(VLCDR2) has the amino acid sequence shown in SEQ ID NO. 5: NDRLRPS;
(6) the light chain CDR3(VLCDR3) has the amino acid sequence shown in SEQ ID NO. 6: VAWDASLQSYV are provided.
2. The antibody of claim 1,
the full length of the heavy chain variable region of the monoclonal antibody 2B11 comprises an amino acid sequence shown as SEQ ID NO. 7;
the full length of the variable region of the light chain of the monoclonal antibody 2B11 comprises an amino acid sequence shown in SEQ ID NO. 8.
3. The antibody of claim 1 or 2, wherein monoclonal antibody 2B11 is a human IgG-type antibody.
4. The antibody of claim 1 or 2, wherein the antigenic domain to which monoclonal antibody 2B11 binds is the RBD domain of the spike protein S1 of SARS-CoV-2 virus.
5. A nucleic acid fragment encoding the antibody of any one of claims 1-4.
6. Use of the monoclonal antibody 2B11 of any one of claims 1-4 in the preparation of a reagent for detecting SARS-CoV-2 virus.
7. Use of the monoclonal antibody 2B11 of any one of claims 1-4 in the preparation of a reagent for inhibiting SARS-CoV-2 virus.
8. Use of the monoclonal antibody 2B11 of any one of claims 1-4 in the manufacture of a medicament for the prevention and/or treatment of a disease caused by SARS-CoV-2 virus infection.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202010567918.XA CN112521494B (en) | 2020-06-19 | 2020-06-19 | Monoclonal antibody 2B11 for resisting SARS-CoV-2 |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202010567918.XA CN112521494B (en) | 2020-06-19 | 2020-06-19 | Monoclonal antibody 2B11 for resisting SARS-CoV-2 |
Publications (2)
Publication Number | Publication Date |
---|---|
CN112521494A CN112521494A (en) | 2021-03-19 |
CN112521494B true CN112521494B (en) | 2021-06-25 |
Family
ID=74978666
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202010567918.XA Active CN112521494B (en) | 2020-06-19 | 2020-06-19 | Monoclonal antibody 2B11 for resisting SARS-CoV-2 |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN112521494B (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP7116256B1 (en) | 2020-04-02 | 2022-08-09 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Anti-SARS-COV-2-Spike Glycoprotein Antibodies and Antigen-Binding Fragments |
CR20220660A (en) | 2020-06-03 | 2023-02-17 | Regeneron Pharma | METHODS FOR TREATING OR PREVENTING SARS-CoV-2 INFECTIONS AND COVID-19 WITH ANTI-SARS-CoV-2 SPIKE GLYCOPROTEIN ANTIBODIES |
EP4206224A1 (en) * | 2020-08-26 | 2023-07-05 | National University Corporation Kumamoto University | Human antibody or antigen-binding fragment thereof against coronavirus spike protein |
CN113354733B (en) * | 2021-06-04 | 2022-02-18 | 武汉生物制品研究所有限责任公司 | Monoclonal antibody 20D8 for resisting SARS-CoV-2 epidemic mutant strain |
CN113274494B (en) * | 2021-06-07 | 2022-09-20 | 武汉生物制品研究所有限责任公司 | Liquid preparation of recombinant fully human monoclonal antibody for resisting SARS-CoV-2 |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111153991A (en) * | 2020-02-26 | 2020-05-15 | 北京博奥森生物技术有限公司 | Human SARS-CoV-2 monoclonal antibody and its preparation method and use |
CN111269313B (en) * | 2020-03-07 | 2021-05-28 | 北京舜景生物医药技术有限公司 | Monoclonal antibody for detecting novel coronavirus and application of monoclonal antibody in preparation of kit |
-
2020
- 2020-06-19 CN CN202010567918.XA patent/CN112521494B/en active Active
Also Published As
Publication number | Publication date |
---|---|
CN112521494A (en) | 2021-03-19 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111690059B (en) | Monoclonal antibody 1D7 for resisting SARS-CoV-2 | |
CN111718411B (en) | Monoclonal antibody 1F2 for resisting SARS-CoV-2 | |
CN112521494B (en) | Monoclonal antibody 2B11 for resisting SARS-CoV-2 | |
CN111732654B (en) | Monoclonal antibody 1E10 for resisting SARS-CoV-2 | |
AU2015295936B2 (en) | Anti-CTLA4 monoclonal antibody or antigen binding fragment thereof, medicinal composition and use | |
HUE025329T2 (en) | Monoclonal antibodies capable of reacting with a plurality of influenza virus a subtypes | |
CN110016079B (en) | Neutralizing antibody for resisting respiratory syncytial virus and application thereof | |
RU2764740C1 (en) | Bispecific antibody against rabies virus and its application | |
CN113354733B (en) | Monoclonal antibody 20D8 for resisting SARS-CoV-2 epidemic mutant strain | |
CN105992772A (en) | IgA multi-specific binding molecules | |
CN108026166A (en) | Polyomavirus neutralizing antibody | |
US20170158753A1 (en) | Monoclonal antibodies directed against envelope glycoproteins from multiple filovirus species | |
US10689434B2 (en) | Antibody against hepatitis B surface antigen and use thereof | |
WO2020186687A1 (en) | Human antibody specifically binding four serotypes of dengue viruses | |
CN115093477A (en) | Monoclonal antibody for resisting N terminal region of novel coronavirus nucleoprotein and application thereof | |
CN111153988B (en) | Broad-spectrum neutralizing monoclonal antibody against enterovirus D68 | |
CN113817051B (en) | Monoclonal antibody 1B6 against SARS-CoV-2 | |
EP4353744A1 (en) | Antibody against respiratory syncytial virus and use thereof | |
CN107207583A (en) | There are specific human monoclonal antibodies to the F protein of respiratory syncytial virus (RSV) (RSV) | |
CN113817050B (en) | Monoclonal antibody 1H8 against SARS-CoV-2 | |
CN115260306A (en) | Monoclonal antibody targeting SARS-CoV-2 receptor binding motif and its identified antigen epitope and use | |
CN112574297B (en) | Monoclonal antibody against neuraminidase and application thereof | |
US20240209065A1 (en) | Secretory iga antibodies against covid infection | |
WO2023131262A1 (en) | Antigen-binding protein specifically bound to sars-cov-2 | |
US20230348568A1 (en) | Epstein-barr virus monoclonal antibodies and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant | ||
TR01 | Transfer of patent right | ||
TR01 | Transfer of patent right |
Effective date of registration: 20211228 Address after: 100024 2F, building 2, yard 2, Shuangqiao Road B, Chaoyang District, Beijing Patentee after: China Biotechnology Co.,Ltd. Patentee after: Wuhan Biological Products Research Institute Co., Ltd Address before: 430207 No.1, Huangjin Industrial Park Road, Zhengdian Town, Jiangxia District, Wuhan City, Hubei Province Patentee before: WUHAN INSTITUTE OF BIOLOGICAL PRODUCTS Co.,Ltd. |