CN112430570B - Use of adipose-derived stem cells edited by gene editing technology for improving differentiation efficiency - Google Patents

Abstract

The invention relates to application of an adipose-derived stem cell edited by a gene editing technology in improving differentiation efficiency. After the optimal gRNA sequence is obtained through screening and optimization, miR-221 is knocked out to obtain a transgenic adipose-derived stem cell, a specific monoclonal antibody is obtained through screening aiming at RUNX2, the monoclonal antibody can inhibit the activity of RUNX2, and after the monoclonal antibody is added into an induction culture medium, the differentiation of the adipose-derived stem cell into a chondrocyte can be specifically promoted, so that the induction efficiency and the application value are good.

Description

Use of adipose-derived stem cells edited by gene editing technology for improving differentiation efficiency

Technical Field

The invention relates to the field of biology, in particular to application of an adipose-derived stem cell edited by a gene editing technology in improving differentiation efficiency.

Background

The treatment of articular cartilage pathologies, and in particular knee joint pathologies, has always been one of the most challenging clinical problems. Articular cartilage belongs to hyaline cartilage and has important functions of buffering mechanical stress and ensuring flexible movement of joints. However, the articular cartilage tissue of the adult lacks blood vessels and nerves, does not have lymphatic return, has single tissue cell type and high differentiation, and the chondrocytes are embedded in a large amount of compact matrixes, so that the proliferation and migration capacity of the chondrocytes are limited. Thus, the self-healing capacity of the tissue is limited, and even minor cartilage damage can lead to osteoarthritis and progress to progressive inflammation leading to joint degeneration and loss of motor capacity. At present, methods for treating articular cartilage injury through operations mainly comprise subchondral drilling, microfracture, abrasive plasty, joint replacement, autologous chondrocyte transplantation and the like, but the methods are limited due to the technical difficulty, poor tissue integration and the influence of fibrocartilage development, and a new thought is provided for cartilage tissue engineering to solve the problems.

The main goal of cartilage tissue engineering is to produce new hyaline cartilage with biological function similar to that of natural cartilage through the effective combination of seed cells, bioactive molecules with induced differentiation capacity and biological materials (such as scaffold) capable of creating proper environment for cell growth, so as to realize the regeneration of tissue structure and function. The seed cells can be derived from chondrocytes, embryonic stem cells or tissue stem cells, and are the key for repairing or replacing damaged tissues, wherein the application of the adult multifunctional stem cells does not relate to ethical problems, the sources are relatively sufficient, the proliferation and repair capacity is strong, and the adult multifunctional stem cells become ideal research objects. The adipose-derived stem cells ADSCs are the most deeply researched MSCs in cartilage tissue engineering, and the ADSCs have the main advantages that the tissue sources are rich and easy to obtain, and the ADSCs can be differentiated into chondrocytes under the action of specific induction factors.

The differentiation medium required for inducing chondrogenic differentiation of the ADSCs in vitro is generally a mixture containing a series of growth factors. Among them, transforming growth factor beta (TGF- β) is the most important component in the chondrogenic differentiation medium of ADSCs, and there are 3 subtypes in the mammalian body: TGF-. beta.1, -beta.2, and-. beta.3. TGF-beta enables an I type receptor, namely activin receptor-like kinase-5 (ALK-5), to be phosphorylated by combining with an ADSCs surface receptor, so that a Smad channel is activated, and the transcription of cartilage specific genes is started. TGF-. beta.1 has a biphasic action: enhancing proliferation and invasion effect of endothelial cells in the concentration range of 100pg/mL-1ng/mL, inhibiting endothelial cell invasion and capillary formation in the concentration range of 5-10ng/mL, and inducing chondrogenic differentiation of ADSCs. 3 subtypes of TGF-beta have a certain chondrogenic induction effect on ADSCs, but the difference of the 3 subtypes is still uncertain, and the current research shows that the induction effects of TGF-beta 1 and TGF-beta 3 are not significantly different for ADSCs.

In response to the low efficiency and short half-life of exogenous growth factors, researchers have proposed a long-term stable induction method, i.e., the gene is used to transfect the target gene of the growth factor to obtain the endogenous growth factor, which acts through the secretory pathway. Although genetic manipulation can control the secretion of specific growth factors, targeting only one gene at a time limits the potential for gene transfection since chondrogenesis is coordinated by multiple growth factors and other signaling molecules, but current research is insufficient and there is much room for improvement.

Disclosure of Invention

The present invention overcomes the deficiencies of the prior art and provides an improved method for inducing stem cells into chondrocytes.

Specifically, the inventors found that by knocking out miR-221 and inhibiting the activity of RUNX2 in adipose stem cells, differentiation of adipose stem cells into chondrocytes can be specifically promoted.

In one aspect, the invention provides a genetically-edited modified adipose-derived stem cell.

The modification is to knock out miR-221 of the adipose-derived stem cells.

Specifically, a plurality of groups of gRNA sequences are designed according to a precursor sequence of miR221, wherein optimal g4-RNA is obtained through screening and is used as an experimental sequence. The specific gRNA sequence is shown in SEQ ID NO: 1, gRNA4: TGTAGATTTCTGTGTTCGTTAGG.

In another aspect, the present invention provides a monoclonal antibody specifically targeting RUNX2, which antibody is capable of specifically binding to RUNX2 and thereby affecting the activity of RUNX 2.

Furthermore, the monoclonal antibody targeting RUNX2 has an amino acid sequence of the light chain variable region as shown in SEQ ID NO: 2, and the heavy chain variable region sequence is shown as SEQ ID NO: 3, respectively.

Furthermore, a method for inducing differentiation of the fat stem cells into the chondrocytes is provided, wherein the method comprises the step of inducing and differentiating the fat stem cells with miR-221 knockout in a cartilage induction culture medium (high-glucose DMEM, 1% fetal bovine serum, 5 mu g/L R monoclonal antibody, 5 mu g/L TGF-beta 1, 5 mu g/L TGF-beta 3, 10 mu g/L BMP-6, 50nmol/L ascorbic acid, 2mg/L insulin and 1% streptomycin stock solution) for 10d, and changing the solution once every 2d to obtain the differentiated chondrocytes.

The method for inducing the generation of the chondrocytes can induce the differentiation of the cartilage at a high level without a hypoxic environment, obviously shortens the induction time from the normal 2-week time to 10 days, and has better induction effect.

Advantageous effects

In the adipose-derived stem cells, the optimal gRNA sequence is obtained through screening optimization, miR-221 is knocked out to obtain the adipose-derived stem cells, a specific monoclonal antibody is obtained through screening against RUNX2, the monoclonal antibody can inhibit the activity of RUNX2, and after the monoclonal antibody is added into an induction culture medium, the adipose-derived stem cells can be specifically promoted to be differentiated into chondrocytes, so that the induction efficiency and the application value are good.

Drawings

FIG. 1 expression level diagram of RT-PCR detection of miR-221

FIG. 2 is a diagram showing the results of ELISA detection of monoclonal antibodies

FIG. 3 is a graph showing the detection results of Western blot on monoclonal antibodies

FIG. 4RT-qPCR results of agrecen and Co2A1mRNA level detection

Detailed Description

The following describes in detail embodiments of the present invention. The following examples are illustrative only and are not to be construed as limiting the invention. The examples do not specify particular techniques or conditions, and are performed according to techniques or conditions described in literature in the art or according to the product specification. The reagents or instruments used are not indicated by the manufacturer, and are all conventional products commercially available.

Example 1 preparation of adipose-derived stem cells

Extracting abdominal subcutaneous fat by vacuum liposuction under aseptic condition, collecting 10g, rinsing with PBS containing 500U/ml double antibody for 3 times, removing macroscopic blood vessel and connective tissue, cutting with ophthalmic scissors, repeatedly washing with PBS, and removing red blood cells as much as possible. Adding 0.2% type I collagenase 2 times the volume of the mixture, shaking and mixing, and digesting in a constant temperature water bath at 37 ℃ for 60 min. Digestion was stopped by adding an equal volume of low-sugar DMEM medium containing 10% FBS. Centrifuging at 1800r/min for 10 min. Discarding the upper and middle layers, adding 2ml complete medium (low sugar DMEM + 10% FBS +100U/ml penicillin-streptomycin) for resuspending cell pellet, filtering with 70 μm cell sieve, adjusting cell concentration of the filtrate to 1 × 10 ⁸ The cells were inoculated in 60mm cell culture dishes at 37 ℃ with 5% CO ₂ Culturing in cell incubator for 24 hr, performing half-amount liquid exchange, performing full-amount liquid exchange after 48 hr, and removing residual red blood cells and cell debris. And then changing the solution every 2d for 1 time to obtain purified ADSCs, culturing for 7-9d to ensure that the growth fusion of the primary ADSCs reaches 90%, conventionally digesting with 0.25% trypsin (containing 0.2% EDTA), and then subculturing to a new cell culture dish at a ratio of 1: 3 for continuous in vitro amplification culture to a third generation for detection. The 3 rd generation ADSCs are taken to identify cell surface specific markers CD34, CD44, CD45 and CD105, the experimental steps are that the ADSCs are digested by pancreatin, centrifuged at 1000r/min for 4min, resuspended by PBS, counted, 3 multiplied by 105 cells are taken from each 2ml EP tube, centrifuged at 1000r/min for 4min, the supernatant is discarded, and 50 or 100 mul PBS is added for resuspension. Incubation of cells with antibody: a. blank cell control group: add 50. mu.l PBS; b. add 1. mu. lCD44-FITC antibody + 99. mu.l PBS; c. add 2.5. mu. lCD105-PE antibody + 47.5. mu.l PBS; d. add 2.5. mu. lCD34-APC antibody + 47.5. mu.l PBS; e. 2.5. mu.l of CD45-PerCPCyanine5.5 antibody + 47.5. mu.l PBS was added; f. mu.l, 5. mu.l, and 5. mu.l of the above 4 antibodies were added to the cells in + 84. mu.l of PBS, respectively. Incubate at 4 ℃ for 45min in the dark (shake 1 time every 15 min). (3) After incubation, 1ml PBS was added for resuspension, centrifuged at 1000r/min for 4min, the supernatant was discarded, 1ml PBS was added for further washing, and 200. mu.l PBS was finally added for resuspension. (4) Detection was performed using a flow cytometer. The results show that the expression of CD44 and CD105 is positive, the expression of CD34 is ultralow, and the expression of CD45 is negative, which indicates that the adipose-derived stem cells are obtained by separation.

Example 2 Gene editing technique targeting miR-221

According to a precursor sequence of miR221, a plurality of groups of gRNA sequences are designed, wherein optimal g4-RNA is obtained through screening and is used as an experimental sequence. The specific gRNA sequence is shown in SEQ ID NO: 1, gRNA4: TGTAGATTTCTGTGTTCGTTAGG.

Shanghai Biotech synthesizes a forward nucleotide sequence of CACC added to the 5 'end of the DNA sequence corresponding to gRNA4, adds a reverse nucleotide sequence of AAAC to the 5' end of the complementary strand, and denatures and anneals the synthesized forward and reverse nucleotide sequences to obtain double-stranded DNA fragments. The specific experimental conditions were as follows: 1ul of a forward nucleotide sequence (100 uM); 1ul of an inverted nucleotide sequence (100 uM); 1ul 10 XT 4Ligation buffer (NEB); 6.5ul ddH ₂ O; 0.5ul T4PNK (NEB). Placing the reaction system in a PCR instrument, wherein the reaction conditions are as follows: 30min at 37 ℃; 95 deg.C5 min; then, the temperature of the reaction system is reduced to 25 ℃ at the rate of 5 ℃/min to obtain the double-stranded DNA fragment. The lentivirus expression vector lentiCRISPR/Cas 9 lentiCRISPRrv 2 is digested by BbsI for 30min, and then DNA electrophoresis recovery is carried out. The DNA primers that had been complementarily ligated and the excised lentiCRISPRV2 plasmid were recovered in the following manner 1: 1 at room temperature, and the DNA ligation reaction is carried out by using a rapid ligation kit. The ligated DNA primers and lentiCRISPRv2 plasmid were transformed into competent bacteria. And on the next day, selecting a connection positive clone for sequencing identification, and determining that the gRNA/CPRISPR/cas9 expression vector is successfully constructed. Taking P3 as a substitute for the adipose-derived stem cells prepared by separation in example 1, conventionally digesting, and finally suspending the cells to prepare a single-cell suspension; the Lipofectamine 3000 liposome transfection method is used for transfecting the Lipofectamine into the adipose-derived stem cells of the P3 generation, and the liquid is changed after 8 hours of transfection. And observing the fluorescent expression condition through an inverted fluorescent microscope, screening to obtain stem cells with positive gene editing interference, culturing the stem cells with the positive gene editing interference for 48 hours, and detecting the expression level of miR-221 by RT-PCR. The primer is an upstream primer: GGGAAGCTACATTGTCTGC, the downstream primer is: CAGTGCGTGTCGTGGAGT are provided. The untransfected vector group was set as Contro 1. The results are shown in FIG. 1.

As can be seen from FIG. 1, the RT-qPCR result shows that miR-221 expression in the cell after gene editing is obviously lower than that in the untransfected group (P <0.01), which indicates that miR-221 expression in the cell can be effectively silenced after CRISPR editing.

Example 3 preparation of monoclonal antibodies targeting RUNX2

Aiming at the conserved region of RUNX2, the inventor screens and obtains an epitope with high immunogenicity, and the specific sequence is as follows:

DENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSA

the antigen peptide synthesized by the sequence is used as immunogen and is fully mixed with equal volume of Freund complete adjuvant, and 50 mu g of fusion protein is injected into BALB/c mice at multiple subcutaneous points. First time exemptionThe immunization was performed by subcutaneous multi-point injection at the back for 4 weeks, and the immunization was performed again after 4 weeks, with 50. mu.g of immunogen being used per time. And (4) measuring the serum antibody titer by ELISA (enzyme-linked immuno sorbent assay) of tail vein blood collection 7-10 d after the 3 rd immunization. The 1 mouse with the highest antibody titer was selected 4d before the fusion and boosted by intraperitoneal injection of 150. mu.g of non-adjuvant antigen. Taking the splenocytes of the mice with enhanced immunity BALB/c aseptically, taking 50% polyethylene glycol as a fusion agent, fusing SP2/0 myeloma cells and the splenocytes of the mice according to the ratio of 1: 5-1: 10, adding HAT selective culture solution, inoculating a 96-well plate, placing at 37 ℃ and 5% CO ₂ Culturing in an incubator, sucking culture supernatant in growing cloning holes after 7-10 days, using immunogen as coating antigen, performing primary screening by ELISA, screening out 37 strains of positive hybridoma only reacting with the immunogen, performing counter-screening by BSA, selecting 2 strains of R4D5 and R3F6 with strongest positive reaction only reacting with the immunogen, performing 4 rounds of subcloning by a limiting dilution method, and performing expanded culture and strain establishment until the single clones are all positive. 2 hybridoma cells R4D5 and R3F6 were injected intraperitoneally into BALB/c mice 2X 10 ⁶ After about 7 days, the abdomen of the mouse is obviously expanded, ascites is sucked up, 2000r/min is carried out, centrifugation is carried out for 20min, and the supernatant is taken. After dilution with equilibration buffer, the mixture was filtered through a 0.45 μm filter. Passing the filtered ascites through a Purify protein purifier at the flow rate of 1ml/min, washing with a balance buffer solution to remove impure proteins, eluting the antibody with an eluent (glycine-hydrochloric acid pH2.8100mmol/L), collecting the antibody with OD280 more than 0.5, dialyzing with PBS at 4 ℃, storing for later use, and adjusting the concentration of the monoclonal antibody to 100mg/ml for later use.

Example 4 ELISA assay for R3F6 monoclonal antibodies

A96-well plate was coated with immunogen (2. mu.g/ml) at 50. mu.l/well overnight at 4 ℃. The next day, 5 times PBS wash, 5% skimmed milk powder (prepared from PBST) add, block for 2h at room temperature, 5 times PBS wash. R3F6 monoclonal antibody (2. mu.g/ml) and IgG (as a control) were added to the ELISA plate at 50. mu.l/well, and reacted at room temperature for 1 hour, 3 times in PBST and 2 times in PBS. HRP-labeled goat anti-mouse IgG (1: 2000) was added at 50. mu.l/well and reacted at room temperature for 1 hour, PBST washed 3 times, PBS washed 2 times. Adding substrate color developing solution TMB, developing at room temperature for 15min with 100 μ l/well, adding 12.5% H ₂ SO ₄ Stop, 50. mu.l/well. OD450 values were measured with a microplate reader. The results are shown in FIG. 2.

As can be seen from FIG. 2, the R3F6 monoclonal antibody only reacts specifically with the corresponding immunogenic fragment, but does not react with GST protein, and thus maintains better specificity.

Example 5 Western blot detection of R3F6 monoclonal antibodies

The immunogenic protein was added to 2 x SDS lysates and 5ng loaded (GST protein as control). After SDS-PAGE, proteins were transferred to nitrocellulose membranes; after 5% skim milk powder (prepared in TBST) was blocked at room temperature for 2h, it was incubated with R3F6 mab (2. mu.g/ml) overnight at 4 ℃ with anti-GST mab as a positive control. After the next day of washing, HRP-labeled goat anti-mouse IgG (1: 2000) was added, incubated at room temperature for 50min, and ECL chemiluminescence was developed. The results are shown in FIG. 3.

As can be seen from the results in FIG. 3, in the Western blot experiment, the R3F6 monoclonal antibody can only specifically bind to the corresponding immunogenic protein, but does not bind to GST (FIG. 3), thus showing better specificity.

Example 6 detection of binding Activity of R3F6 monoclonal antibodies and sequencing

To characterize the binding properties of R3F6 mab, the binding kinetics between R3F6 mab and purified RUNX2 protein were measured by Biacore3000, and the association and dissociation rate constants (ka and kd) were determined by using Biaevaluation 4.0 software. The dissociation constant KD is calculated from the determined rate constant by the relation KD ═ KD/ka. As shown in table 1:

TABLE 1

Antibodies	KD(M)
		R3F6 monoclonal antibody	2.57E-10

The cloning analysis of the variable region gene of the R3F6 monoclonal antibody comprises the following steps: and (3) cracking the monoclonal hybridoma cell strain, and extracting the total RNA of the hybridoma cell. RNA from hybridoma cells was reverse transcribed to cDNA using the HiFi Script cDNA Synthesis kit. The variable region genes of the heavy and light chains of the antibody were amplified by PCR using the cDNA as a template and degenerate primers. The reaction was carried out in a S1000TM thermal cycler for 30 cycles: denaturation at 94 ℃ for 1.5 min; annealing at 50 ℃ for 1 minute; the synthesis was carried out at 72 ℃ and 1 minute. At the end of the 30 th cycle, the reaction mixture was extended by incubation for a further 7 minutes at 72 ℃. The PCR mixture was electrophoresed in a 1% agarose/Tris-borate gel containing 0.5. mu.g/ml ethidium bromide. DNA fragments of the expected size were excised from the gel and purified. Mu.l of the purified PCR product was cloned into pMD-18T vector, DH 5. alpha. competent cells were transformed, plated and cultured overnight at 37 ℃. The monoclonal was picked from the plate, amplified, and plasmid was extracted to determine the gene sequence of the antibody. The full-length amino acid sequences of the variable regions of the heavy and light chains of the resulting antibodies are shown below.

Light chain variable region:

DVVMAQTPLTLSFTIGQPASISCDSSQSPPDSDGKTYLSWLLQRPGQSPKRLIYQRSELVDGVPDRFTGSGSGDDFTLQISRVEAEDLGVYYCFTGTHFPSSFGGGTKLEIKRA

heavy chain variable region:

DVQLQESGPGLVKPSQRLSLTCTVTGYSITPGYAWAWIRQFPGNKLEWWGGSRNSGRTSYNPSLSDRISITRDTSKNHFVLQSNSVTTEDTATYYCTRTGHHDLQDVWGQGTTLTVSS

example 7 Induction of differentiation of adipose Stem cells into chondrocytes

The isolated adipose-derived stem cells of P3 generation and the adipose-derived stem cells of example 2 were used for chondrocyte induction experiments under the following conditions:

inoculating the above two cells into 25cm ² After the cells are overgrown, the culture flask is changed into a cartilage induction culture medium (high-glucose DMEM, 1% fetal calf serum, 5 mu g/L R3F6 monoclonal antibody, 5 mu g/L TGF-beta 1, 5 mu g/L TGF-beta 3, 10 mu g/L BMP-6, 50nmol/L ascorbic acid, 2mg/L insulin and 1% streptomycin stock solution) to induce and differentiate for 10 days, and the solution is changed once every 2 days. The same procedure was carried out using cartilage induction medium under the same conditions without addition of monoclonal antibody as a controlInduction of culture conditions. Collecting the chondrocyte mass after induction culture for 10d, and detecting the expression of the genes related to cartilage differentiation. Respectively extracting each group of RNA by using Trizo1, carrying out reverse transcription according to the instruction of a reverse transcription kit to obtain cDNA, respectively preparing the obtained cDNA samples into a Real-time PCR reaction system, and placing the system on a Real 1-time PCR instrument for PCR reaction. After the reaction, Ct values were read on a PCR instrument, expression of Collagen 1I and aggrecan was analyzed using GAPDH as an internal reference, and the relative expression amount of mRNA of each target gene was calculated. Wherein the primer sequence is as follows: col2a 1: an upstream primer: f: 5'-TGGTGGAGCAGCAAGAGCAA-3', downstream primer: r: 5'-CCGTGGACAGCAGGCGTAGGAAG-3'; aggrecan: an upstream primer: f: 5'-CAGGGTTCCCAGTGTTCAGT-3', downstream primer: r: 5'-CTGCTCCCAGTCTCAACTCC-3', respectively; GAPDH upstream primer F: 5'-GGAAAGCTGTGGCGTGAT-3', downstream primer R: 5'-AAGGTGGAAGAATGGGAGTT-3' is added. The results are shown in FIG. 4 below.

As can be seen from the results of fig. 4, with the gene-edited stem cells and in the presence of the induction medium containing antibodies, there was a better effect of cartilage differentiation than with the non-gene-edited and non-antibody-containing adipose-derived stem cells, and the RT-qPCR results also confirmed that the agrececan and Co2A1mRNA level expression was also significantly increased (P <0.O5), see fig. 4.

Example 8 characterization of chondrogenic Properties of chondrocytes

The cell patch construction is carried out by using the chondrocyte prepared by inducing the adipose-derived stem cell with the gene editing of the example 7 for 10d under the condition of the monoclonal antibody induction medium, and the cell patch construction is carried out by using the chondrocyte prepared by inducing the adipose-derived stem cell with the gene editing-free adipose-derived stem cell with the gene editing of the example 7 for 10d without the monoclonal antibody induction medium as a control, and the specific steps are as follows: continuously culturing the chondrocytes in a chondrocyte culture solution (Ham's F-12 culture solution prepared from 10 volume percent of fetal calf serum, 300mg/L of glutamine, 50mg/L of L-ascorbic acid and 100U/mL of each of penicillin and streptomycin) until the cells reach a 100 percent confluence state, and continuously culturing for 2 weeks to see that milky white thin film-like substances appear at the bottom of the culture dish. After 2 weeks of monolayer membrane culture, chondrocytes obtained by induction of example 7 were collected at 5X 10 ⁴ /cm ² Concentration-superimposed inoculation withAnd (3) continuously covering and growing the cells above the monolayer cell membrane, and continuously culturing for 2 weeks to form a double-layer cell membrane structure. The cell membrane is carefully scraped from the outside to the inside by a sterile cell scraper starting from the edge of the dish bottom. After the cell membrane is scraped, the cell membrane is placed in a fresh chondrocyte culture solution (Ham's F-12 culture solution prepared by 10 percent of fetal calf serum, 300mg/L of glutamine, 50mg/L of L-ascorbic acid and 100U/mL of each of penicillin and streptomycin), the culture is continued, and the bilayer cell membrane cultured for 4 weeks in vitro is implanted into BALB/c nude mice. Subcutaneous tissue bags were made on the left and right backs of each nude mouse, and a cartilage-like structure formed by a double-layered cell sheet was implanted into each bag. The animals are anesthetized by using 0.5mL/kg of thiamethoxam hydrochloride injection. After the animal is anesthetized, the back of the nude mouse is disinfected by wiping with iodophor, the skin of the side back is cut off by scissors, the length is about 0.5cm, the nude mouse is peeled off along the subcutaneous tissue by hemostatic forceps to form a subcutaneous tissue bag, the cell membrane block is put into the bag, and the wound is closed and sutured. After the operation is finished. Normal diet was given after surgery, without activity restriction, and observations were continued for 8 weeks. After 8 weeks of in vivo culture, excess xylazine hydrochloride injection was injected and the animals were sacrificed and the material was taken. The specimen was peeled from the surrounding soft tissue and used for quantitative analysis of DNA and extracellular matrix content. The sample was subdivided into 2 portions, one of which was minced and digested with 10% proteinase K at 56 ℃ overnight, DNA was extracted and purified using Qiagen DNeasy kit, and DNA content was analyzed using PicoGreen dsDNA method. The other was used for analysis of extracellular matrix components. Lyophilizing at low temperature, weighing, and digesting with papain (containing 125g/L papain, 10mmol/L L-cysteine and 10mmol/L EDTA, pH 6.3) at 60 deg.C for 16 h. The digestive juice is used for content of glycosaminoglycan and hydroxyproline. The content of glycosaminoglycan was measured by a spectrophotometer using a standard solution of chondroitin sulfate after staining with dimethyl methylene blue. Hydroxyproline content was measured using the Stegemann hydroxyproline assay. Normal human nasal septal cartilage was used for digestion extraction and biochemical analysis of DNA and extracellular matrix content as a normal control. The method is the same as above. The main observation indexes are that: reflecting the density of chondrocytes in the artificially constructed cartilage; content of glycosaminoglycan and hydroxyproline: the content of cartilage matrix in unit mass of cartilage tissue reflects the cartilage matrix of artificial cartilageA condition of mass secretion; and thirdly, evaluating the performance of the artificial cartilage by comparing the artificial cartilage with the natural nasal septum cartilage. The results are shown in Table 2.

TABLE 2

As can be seen from the results in Table 2, the DNA content test results show that the DNA content of each gram of cartilage prepared from the gene-edited stem cells and the monoclonal antibody-induced chondrocytes is higher than that of the natural septal cartilage of the nose of a human body, which indicates that the artificial cartilage tissue contains more chondrocytes in unit volume. The detection results of the content of glycosaminoglycan and the content of hydroxyproline show that the artificial cartilage has basically the same conformation as the natural cartilage and has better effect.

It is to be understood that the invention is not necessarily limited in its application to the details of construction and the arrangement of components set forth in the following description and/or illustrated in the drawings. The invention is capable of embodiments in addition to those described and of being practiced or carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.

Sequence listing

<110> Beijing Song Biotechnology Ltd

<120> use of adipose-derived stem cells edited by gene editing technology for improving differentiation efficiency

<160> 3

<170> SIPOSequenceListing 1.0

<210> 1

<211> 23

<212> DNA

<213> Artificial Sequence (Artificial Sequence)

<400> 1

tgtagatttc tgtgttcgtt agg 23

<210> 2

<211> 114

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 2

Asp Val Val Met Ala Gln Thr Pro Leu Thr Leu Ser Phe Thr Ile Gly

1 5 10 15

Gln Pro Ala Ser Ile Ser Cys Asp Ser Ser Gln Ser Pro Pro Asp Ser

20 25 30

Asp Gly Lys Thr Tyr Leu Ser Trp Leu Leu Gln Arg Pro Gly Gln Ser

35 40 45

Pro Lys Arg Leu Ile Tyr Gln Arg Ser Glu Leu Val Asp Gly Val Pro

50 55 60

Asp Arg Phe Thr Gly Ser Gly Ser Gly Asp Asp Phe Thr Leu Gln Ile

65 70 75 80

Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Thr Gly

85 90 95

Thr His Phe Pro Ser Ser Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys

100 105 110

Arg Ala

<210> 3

<211> 118

<212> PRT

<213> Artificial Sequence (Artificial Sequence)

<400> 3

Asp Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln

1 5 10 15

Arg Leu Ser Leu Thr Cys Thr Val Thr Gly Tyr Ser Ile Thr Pro Gly

20 25 30

Tyr Ala Trp Ala Trp Ile Arg Gln Phe Pro Gly Asn Lys Leu Glu Trp

35 40 45

Trp Gly Gly Ser Arg Asn Ser Gly Arg Thr Ser Tyr Asn Pro Ser Leu

50 55 60

Ser Asp Arg Ile Ser Ile Thr Arg Asp Thr Ser Lys Asn His Phe Val

65 70 75 80

Leu Gln Ser Asn Ser Val Thr Thr Glu Asp Thr Ala Thr Tyr Tyr Cys

85 90 95

Thr Arg Thr Gly His His Asp Leu Gln Asp Val Trp Gly Gln Gly Thr

100 105 110

Thr Leu Thr Val Ser Ser

115

Claims (2)

1. A monoclonal antibody R3F6 specifically targeting RUNX2, characterized in that the amino acid sequence of the variable region of the light chain of the antibody is as shown in SEQ ID NO: 2, and the heavy chain variable region sequence is shown as SEQ ID NO: 3, respectively.

2. Use of the monoclonal antibody R3F6 according to claim 1 for inducing differentiation of adipose-derived stem cells into chondrocytes in vitro.

Images