CN112409495A - Streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application - Google Patents
Streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application Download PDFInfo
- Publication number
- CN112409495A CN112409495A CN202011172487.3A CN202011172487A CN112409495A CN 112409495 A CN112409495 A CN 112409495A CN 202011172487 A CN202011172487 A CN 202011172487A CN 112409495 A CN112409495 A CN 112409495A
- Authority
- CN
- China
- Prior art keywords
- recombinant
- zsd
- protein
- epitope
- streptococcus suis
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 241000194021 Streptococcus suis Species 0.000 title claims abstract description 76
- 229940031626 subunit vaccine Drugs 0.000 title claims abstract description 38
- 239000013612 plasmid Substances 0.000 title claims description 32
- 238000002360 preparation method Methods 0.000 title claims description 11
- 108010008038 Synthetic Vaccines Proteins 0.000 title abstract description 4
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 139
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 130
- 102100023319 Dihydrolipoyl dehydrogenase, mitochondrial Human genes 0.000 claims abstract description 49
- 101710144432 Dihydrolipoyl dehydrogenase, mitochondrial Proteins 0.000 claims abstract description 49
- 230000014509 gene expression Effects 0.000 claims abstract description 25
- 229960005486 vaccine Drugs 0.000 claims abstract description 20
- 239000002773 nucleotide Substances 0.000 claims abstract description 18
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 18
- 210000004027 cell Anatomy 0.000 claims description 48
- 150000001413 amino acids Chemical class 0.000 claims description 33
- 238000000034 method Methods 0.000 claims description 31
- 239000013613 expression plasmid Substances 0.000 claims description 24
- 230000009465 prokaryotic expression Effects 0.000 claims description 20
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 17
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 16
- 238000012216 screening Methods 0.000 claims description 13
- 241000588724 Escherichia coli Species 0.000 claims description 12
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 10
- 230000007923 virulence factor Effects 0.000 claims description 10
- 239000000304 virulence factor Substances 0.000 claims description 10
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 claims description 9
- 108010042653 IgA receptor Proteins 0.000 claims description 8
- 102100034014 Prolyl 3-hydroxylase 3 Human genes 0.000 claims description 8
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims description 8
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims description 8
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 claims description 8
- 238000001962 electrophoresis Methods 0.000 claims description 7
- 230000003834 intracellular effect Effects 0.000 claims description 7
- 238000010276 construction Methods 0.000 claims description 6
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 claims description 6
- 238000003259 recombinant expression Methods 0.000 claims description 6
- 241001465754 Metazoa Species 0.000 claims description 5
- 238000004458 analytical method Methods 0.000 claims description 5
- 229920001184 polypeptide Polymers 0.000 claims description 5
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 5
- 238000001262 western blot Methods 0.000 claims description 5
- 108020004705 Codon Proteins 0.000 claims description 4
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 4
- 101710117021 Tyrosine-protein phosphatase YopH Proteins 0.000 claims description 4
- 230000006698 induction Effects 0.000 claims description 4
- 230000001537 neural effect Effects 0.000 claims description 4
- 229910052759 nickel Inorganic materials 0.000 claims description 4
- 108091008146 restriction endonucleases Proteins 0.000 claims description 4
- 238000012795 verification Methods 0.000 claims description 4
- 206010067482 No adverse event Diseases 0.000 claims description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 3
- 238000010367 cloning Methods 0.000 claims description 3
- 231100000252 nontoxic Toxicity 0.000 claims description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims 5
- 241000282898 Sus scrofa Species 0.000 abstract description 7
- 241000194017 Streptococcus Species 0.000 abstract description 2
- 238000012360 testing method Methods 0.000 abstract description 2
- 231100000956 nontoxicity Toxicity 0.000 abstract 1
- 229940124551 recombinant vaccine Drugs 0.000 abstract 1
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 18
- 239000012528 membrane Substances 0.000 description 15
- 239000002033 PVDF binder Substances 0.000 description 12
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 12
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 12
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 description 10
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- QMOQBVOBWVNSNO-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(O)=O QMOQBVOBWVNSNO-UHFFFAOYSA-N 0.000 description 6
- 239000007853 buffer solution Substances 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- 102000007079 Peptide Fragments Human genes 0.000 description 5
- 108010087230 Sincalide Proteins 0.000 description 5
- 238000010609 cell counting kit-8 assay Methods 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 4
- INLIXXRWNUKVCF-JTQLQIEISA-N Gly-Gly-Tyr Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 INLIXXRWNUKVCF-JTQLQIEISA-N 0.000 description 4
- 230000027455 binding Effects 0.000 description 4
- 238000001976 enzyme digestion Methods 0.000 description 4
- 238000010353 genetic engineering Methods 0.000 description 4
- 238000007789 sealing Methods 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 201000009906 Meningitis Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 206010040047 Sepsis Diseases 0.000 description 3
- PIFJAFRUVWZRKR-QMMMGPOBSA-N Val-Gly-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O PIFJAFRUVWZRKR-QMMMGPOBSA-N 0.000 description 3
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 238000005336 cracking Methods 0.000 description 3
- 238000005520 cutting process Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 108010073093 leucyl-glycyl-glycyl-glycine Proteins 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 208000013223 septicemia Diseases 0.000 description 3
- XWTNPSHCJMZAHQ-QMMMGPOBSA-N 2-[[2-[[2-[[(2s)-2-amino-4-methylpentanoyl]amino]acetyl]amino]acetyl]amino]acetic acid Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(=O)NCC(O)=O XWTNPSHCJMZAHQ-QMMMGPOBSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- UFPXDFOYHVEIPI-BYPYZUCNSA-N Gly-Gly-Asp Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O UFPXDFOYHVEIPI-BYPYZUCNSA-N 0.000 description 2
- 239000012880 LB liquid culture medium Substances 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- VBMOVTMNHWPZJR-SUSMZKCASA-N Thr-Thr-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O VBMOVTMNHWPZJR-SUSMZKCASA-N 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000007918 pathogenicity Effects 0.000 description 2
- 239000008055 phosphate buffer solution Substances 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 239000012474 protein marker Substances 0.000 description 2
- 238000002791 soaking Methods 0.000 description 2
- 238000003892 spreading Methods 0.000 description 2
- 230000007480 spreading Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 1
- CXRCVCURMBFFOL-FXQIFTODSA-N Ala-Ala-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O CXRCVCURMBFFOL-FXQIFTODSA-N 0.000 description 1
- ZIWWTZWAKYBUOB-CIUDSAMLSA-N Ala-Asp-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O ZIWWTZWAKYBUOB-CIUDSAMLSA-N 0.000 description 1
- PCIFXPRIFWKWLK-YUMQZZPRSA-N Ala-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N PCIFXPRIFWKWLK-YUMQZZPRSA-N 0.000 description 1
- NINQYGGNRIBFSC-CIUDSAMLSA-N Ala-Lys-Ser Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CO)C(O)=O NINQYGGNRIBFSC-CIUDSAMLSA-N 0.000 description 1
- IORKCNUBHNIMKY-CIUDSAMLSA-N Ala-Pro-Glu Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O IORKCNUBHNIMKY-CIUDSAMLSA-N 0.000 description 1
- NHWYNIZWLJYZAG-XVYDVKMFSA-N Ala-Ser-His Chemical compound C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N NHWYNIZWLJYZAG-XVYDVKMFSA-N 0.000 description 1
- SAHQGRZIQVEJPF-JXUBOQSCSA-N Ala-Thr-Lys Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN SAHQGRZIQVEJPF-JXUBOQSCSA-N 0.000 description 1
- ZVWXMTTZJKBJCI-BHDSKKPTSA-N Ala-Trp-Ala Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](C)C(O)=O)=CNC2=C1 ZVWXMTTZJKBJCI-BHDSKKPTSA-N 0.000 description 1
- GIVATXIGCXFQQA-FXQIFTODSA-N Arg-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N GIVATXIGCXFQQA-FXQIFTODSA-N 0.000 description 1
- RIQBRKVTFBWEDY-RHYQMDGZSA-N Arg-Lys-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O RIQBRKVTFBWEDY-RHYQMDGZSA-N 0.000 description 1
- CGWVCWFQGXOUSJ-ULQDDVLXSA-N Arg-Tyr-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O CGWVCWFQGXOUSJ-ULQDDVLXSA-N 0.000 description 1
- NYGILGUOUOXGMJ-YUMQZZPRSA-N Asn-Lys-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O NYGILGUOUOXGMJ-YUMQZZPRSA-N 0.000 description 1
- YRTOMUMWSTUQAX-FXQIFTODSA-N Asn-Pro-Asp Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O YRTOMUMWSTUQAX-FXQIFTODSA-N 0.000 description 1
- XIDSGDJNUJRUHE-VEVYYDQMSA-N Asn-Thr-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(O)=O XIDSGDJNUJRUHE-VEVYYDQMSA-N 0.000 description 1
- KVMPVNGOKHTUHZ-GCJQMDKQSA-N Asp-Ala-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KVMPVNGOKHTUHZ-GCJQMDKQSA-N 0.000 description 1
- WBDWQKRLTVCDSY-WHFBIAKZSA-N Asp-Gly-Asp Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O WBDWQKRLTVCDSY-WHFBIAKZSA-N 0.000 description 1
- USNJAPJZSGTTPX-XVSYOHENSA-N Asp-Phe-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O USNJAPJZSGTTPX-XVSYOHENSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101800005151 Cholecystokinin-8 Proteins 0.000 description 1
- 102400000888 Cholecystokinin-8 Human genes 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- XXLBHPPXDUWYAG-XQXXSGGOSA-N Gln-Ala-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XXLBHPPXDUWYAG-XQXXSGGOSA-N 0.000 description 1
- XOKGKOQWADCLFQ-GARJFASQSA-N Gln-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XOKGKOQWADCLFQ-GARJFASQSA-N 0.000 description 1
- SYZZMPFLOLSMHL-XHNCKOQMSA-N Gln-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N)C(=O)O SYZZMPFLOLSMHL-XHNCKOQMSA-N 0.000 description 1
- VAZZOGXDUQSVQF-NUMRIWBASA-N Glu-Asn-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)O)N)O VAZZOGXDUQSVQF-NUMRIWBASA-N 0.000 description 1
- DSPQRJXOIXHOHK-WDSKDSINSA-N Glu-Asp-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O DSPQRJXOIXHOHK-WDSKDSINSA-N 0.000 description 1
- AUTNXSQEVVHSJK-YVNDNENWSA-N Glu-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O AUTNXSQEVVHSJK-YVNDNENWSA-N 0.000 description 1
- MTAOBYXRYJZRGQ-WDSKDSINSA-N Glu-Gly-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O MTAOBYXRYJZRGQ-WDSKDSINSA-N 0.000 description 1
- XIKYNVKEUINBGL-IUCAKERBSA-N Glu-His-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)NCC(O)=O XIKYNVKEUINBGL-IUCAKERBSA-N 0.000 description 1
- KIEICAOUSNYOLM-NRPADANISA-N Glu-Val-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O KIEICAOUSNYOLM-NRPADANISA-N 0.000 description 1
- PYTZFYUXZZHOAD-WHFBIAKZSA-N Gly-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)CN PYTZFYUXZZHOAD-WHFBIAKZSA-N 0.000 description 1
- QSDKBRMVXSWAQE-BFHQHQDPSA-N Gly-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN QSDKBRMVXSWAQE-BFHQHQDPSA-N 0.000 description 1
- PMNHJLASAAWELO-FOHZUACHSA-N Gly-Asp-Thr Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PMNHJLASAAWELO-FOHZUACHSA-N 0.000 description 1
- SOEATRRYCIPEHA-BQBZGAKWSA-N Gly-Glu-Glu Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SOEATRRYCIPEHA-BQBZGAKWSA-N 0.000 description 1
- CCQOOWAONKGYKQ-BYPYZUCNSA-N Gly-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)CN CCQOOWAONKGYKQ-BYPYZUCNSA-N 0.000 description 1
- KMSGYZQRXPUKGI-BYPYZUCNSA-N Gly-Gly-Asn Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(N)=O KMSGYZQRXPUKGI-BYPYZUCNSA-N 0.000 description 1
- XMPXVJIDADUOQB-RCOVLWMOSA-N Gly-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C([O-])=O)NC(=O)CNC(=O)C[NH3+] XMPXVJIDADUOQB-RCOVLWMOSA-N 0.000 description 1
- XPJBQTCXPJNIFE-ZETCQYMHSA-N Gly-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)CN XPJBQTCXPJNIFE-ZETCQYMHSA-N 0.000 description 1
- UPADCCSMVOQAGF-LBPRGKRZSA-N Gly-Gly-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)CNC(=O)CN)C(O)=O)=CNC2=C1 UPADCCSMVOQAGF-LBPRGKRZSA-N 0.000 description 1
- XVYKMNXXJXQKME-XEGUGMAKSA-N Gly-Ile-Tyr Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 XVYKMNXXJXQKME-XEGUGMAKSA-N 0.000 description 1
- COVXELOAORHTND-LSJOCFKGSA-N Gly-Ile-Val Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O COVXELOAORHTND-LSJOCFKGSA-N 0.000 description 1
- VBOBNHSVQKKTOT-YUMQZZPRSA-N Gly-Lys-Ala Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O VBOBNHSVQKKTOT-YUMQZZPRSA-N 0.000 description 1
- PDUHNKAFQXQNLH-ZETCQYMHSA-N Gly-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)NCC(O)=O PDUHNKAFQXQNLH-ZETCQYMHSA-N 0.000 description 1
- CSMYMGFCEJWALV-WDSKDSINSA-N Gly-Ser-Gln Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(N)=O CSMYMGFCEJWALV-WDSKDSINSA-N 0.000 description 1
- VNNRLUNBJSWZPF-ZKWXMUAHSA-N Gly-Ser-Ile Chemical compound [H]NCC(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VNNRLUNBJSWZPF-ZKWXMUAHSA-N 0.000 description 1
- WCORRBXVISTKQL-WHFBIAKZSA-N Gly-Ser-Ser Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WCORRBXVISTKQL-WHFBIAKZSA-N 0.000 description 1
- FKYQEVBRZSFAMJ-QWRGUYRKSA-N Gly-Ser-Tyr Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FKYQEVBRZSFAMJ-QWRGUYRKSA-N 0.000 description 1
- FFALDIDGPLUDKV-ZDLURKLDSA-N Gly-Thr-Ser Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O FFALDIDGPLUDKV-ZDLURKLDSA-N 0.000 description 1
- UZZXGLOJRZKYEL-DJFWLOJKSA-N His-Asn-Ile Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O UZZXGLOJRZKYEL-DJFWLOJKSA-N 0.000 description 1
- VBOFRJNDIOPNDO-YUMQZZPRSA-N His-Gly-Asn Chemical compound C1=C(NC=N1)C[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)N)C(=O)O)N VBOFRJNDIOPNDO-YUMQZZPRSA-N 0.000 description 1
- NPROWIBAWYMPAZ-GUDRVLHUSA-N Ile-Asp-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N NPROWIBAWYMPAZ-GUDRVLHUSA-N 0.000 description 1
- CYHJCEKUMCNDFG-LAEOZQHASA-N Ile-Gln-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)O)N CYHJCEKUMCNDFG-LAEOZQHASA-N 0.000 description 1
- GAZGFPOZOLEYAJ-YTFOTSKYSA-N Ile-Leu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N GAZGFPOZOLEYAJ-YTFOTSKYSA-N 0.000 description 1
- 241000880493 Leptailurus serval Species 0.000 description 1
- WNGVUZWBXZKQES-YUMQZZPRSA-N Leu-Ala-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O WNGVUZWBXZKQES-YUMQZZPRSA-N 0.000 description 1
- LOLUPZNNADDTAA-AVGNSLFASA-N Leu-Gln-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O LOLUPZNNADDTAA-AVGNSLFASA-N 0.000 description 1
- FIYMBBHGYNQFOP-IUCAKERBSA-N Leu-Gly-Gln Chemical compound CC(C)C[C@@H](C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)O)N FIYMBBHGYNQFOP-IUCAKERBSA-N 0.000 description 1
- RIHIGSWBLHSGLV-CQDKDKBSSA-N Leu-Tyr-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O RIHIGSWBLHSGLV-CQDKDKBSSA-N 0.000 description 1
- NFLFJGGKOHYZJF-BJDJZHNGSA-N Lys-Ala-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN NFLFJGGKOHYZJF-BJDJZHNGSA-N 0.000 description 1
- ZXEUFAVXODIPHC-GUBZILKMSA-N Lys-Glu-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ZXEUFAVXODIPHC-GUBZILKMSA-N 0.000 description 1
- LCMWVZLBCUVDAZ-IUCAKERBSA-N Lys-Gly-Glu Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)NCC(=O)N[C@H](C([O-])=O)CCC([O-])=O LCMWVZLBCUVDAZ-IUCAKERBSA-N 0.000 description 1
- PYFNONMJYNJENN-AVGNSLFASA-N Lys-Lys-Gln Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N PYFNONMJYNJENN-AVGNSLFASA-N 0.000 description 1
- AFLBTVGQCQLOFJ-AVGNSLFASA-N Lys-Pro-Arg Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(O)=O AFLBTVGQCQLOFJ-AVGNSLFASA-N 0.000 description 1
- JHNOXVASMSXSNB-WEDXCCLWSA-N Lys-Thr-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O JHNOXVASMSXSNB-WEDXCCLWSA-N 0.000 description 1
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- HHOOEUSPFGPZFP-QWRGUYRKSA-N Phe-Asn-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O HHOOEUSPFGPZFP-QWRGUYRKSA-N 0.000 description 1
- RTUWVJVJSMOGPL-KKUMJFAQSA-N Phe-Met-Glu Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N RTUWVJVJSMOGPL-KKUMJFAQSA-N 0.000 description 1
- SJRQWEDYTKYHHL-SLFFLAALSA-N Phe-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CC=CC=C3)N)C(=O)O SJRQWEDYTKYHHL-SLFFLAALSA-N 0.000 description 1
- GOUWCZRDTWTODO-YDHLFZDLSA-N Phe-Val-Asn Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O GOUWCZRDTWTODO-YDHLFZDLSA-N 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- ULIWFCCJIOEHMU-BQBZGAKWSA-N Pro-Gly-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 ULIWFCCJIOEHMU-BQBZGAKWSA-N 0.000 description 1
- XQPHBAKJJJZOBX-SRVKXCTJSA-N Pro-Lys-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O XQPHBAKJJJZOBX-SRVKXCTJSA-N 0.000 description 1
- GMJDSFYVTAMIBF-FXQIFTODSA-N Pro-Ser-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O GMJDSFYVTAMIBF-FXQIFTODSA-N 0.000 description 1
- DCHQYSOGURGJST-FJXKBIBVSA-N Pro-Thr-Gly Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O DCHQYSOGURGJST-FJXKBIBVSA-N 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- BNFVPSRLHHPQKS-WHFBIAKZSA-N Ser-Asp-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O BNFVPSRLHHPQKS-WHFBIAKZSA-N 0.000 description 1
- BGOWRLSWJCVYAQ-CIUDSAMLSA-N Ser-Asp-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O BGOWRLSWJCVYAQ-CIUDSAMLSA-N 0.000 description 1
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 1
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 1
- NADLKBTYNKUJEP-KATARQTJSA-N Ser-Thr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O NADLKBTYNKUJEP-KATARQTJSA-N 0.000 description 1
- ZSDXEKUKQAKZFE-XAVMHZPKSA-N Ser-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N)O ZSDXEKUKQAKZFE-XAVMHZPKSA-N 0.000 description 1
- HXPNJVLVHKABMJ-KKUMJFAQSA-N Ser-Tyr-His Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CO)N)O HXPNJVLVHKABMJ-KKUMJFAQSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- KEGBFULVYKYJRD-LFSVMHDDSA-N Thr-Ala-Phe Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KEGBFULVYKYJRD-LFSVMHDDSA-N 0.000 description 1
- LXWZOMSOUAMOIA-JIOCBJNQSA-N Thr-Asn-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N1CCC[C@@H]1C(=O)O)N)O LXWZOMSOUAMOIA-JIOCBJNQSA-N 0.000 description 1
- XPNSAQMEAVSQRD-FBCQKBJTSA-N Thr-Gly-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)NCC(=O)NCC(O)=O XPNSAQMEAVSQRD-FBCQKBJTSA-N 0.000 description 1
- JWQNAFHCXKVZKZ-UVOCVTCTSA-N Thr-Lys-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JWQNAFHCXKVZKZ-UVOCVTCTSA-N 0.000 description 1
- WTMPKZWHRCMMMT-KZVJFYERSA-N Thr-Pro-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WTMPKZWHRCMMMT-KZVJFYERSA-N 0.000 description 1
- UQCNIMDPYICBTR-KYNKHSRBSA-N Thr-Thr-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O UQCNIMDPYICBTR-KYNKHSRBSA-N 0.000 description 1
- ASQFIHTXXMFENG-XPUUQOCRSA-N Val-Ala-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O ASQFIHTXXMFENG-XPUUQOCRSA-N 0.000 description 1
- UDNYEPLJTRDMEJ-RCOVLWMOSA-N Val-Asn-Gly Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)NCC(=O)O)N UDNYEPLJTRDMEJ-RCOVLWMOSA-N 0.000 description 1
- HZYOWMGWKKRMBZ-BYULHYEWSA-N Val-Asp-Asp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N HZYOWMGWKKRMBZ-BYULHYEWSA-N 0.000 description 1
- UEHRGZCNLSWGHK-DLOVCJGASA-N Val-Glu-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UEHRGZCNLSWGHK-DLOVCJGASA-N 0.000 description 1
- WUFHZIRMAZZWRS-OSUNSFLBSA-N Val-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C(C)C)N WUFHZIRMAZZWRS-OSUNSFLBSA-N 0.000 description 1
- DVLWZWNAQUBZBC-ZNSHCXBVSA-N Val-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C(C)C)N)O DVLWZWNAQUBZBC-ZNSHCXBVSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 108010087924 alanylproline Proteins 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 108010010430 asparagine-proline-alanine Proteins 0.000 description 1
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 230000007921 bacterial pathogenicity Effects 0.000 description 1
- 238000003766 bioinformatics method Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000037149 energy metabolism Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 108010008237 glutamyl-valyl-glycine Proteins 0.000 description 1
- 108010049041 glutamylalanine Proteins 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- 108010026364 glycyl-glycyl-leucine Proteins 0.000 description 1
- 108010010096 glycyl-glycyl-tyrosine Proteins 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 244000144980 herd Species 0.000 description 1
- 108010018006 histidylserine Proteins 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108010056582 methionylglutamic acid Proteins 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000009149 molecular binding Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- MXHCPCSDRGLRER-UHFFFAOYSA-N pentaglycine Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(O)=O MXHCPCSDRGLRER-UHFFFAOYSA-N 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 238000012257 pre-denaturation Methods 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 108010029020 prolylglycine Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 239000003566 sealing material Substances 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 108010061238 threonyl-glycine Proteins 0.000 description 1
- 108010071097 threonyl-lysyl-proline Proteins 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 238000002525 ultrasonication Methods 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 206010048282 zoonosis Diseases 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
- A61K39/092—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/66—General methods for inserting a gene into a vector to form a recombinant vector using cleavage and ligation; Use of non-functional linkers or adaptors, e.g. linkers containing the sequence for a restriction endonuclease
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Mycology (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a streptococcus suis recombinant ZSD (ZSD-recombinant subunit vaccine), which is a recombinant tandem expression protein ZSD of proteins ZnuA, Sssna and DLDH, and the nucleotide sequence of the recombinant tandem expression protein ZSD is SEQ ID NO. 2. The vaccine of the invention has no toxicity to normal cells, and the streptococcus epitope recombinant vaccine provides a new thought and a test basis for clinically preventing and treating swine streptococcicosis.
Description
Technical Field
The invention belongs to the technical field of genetic biological engineering, and particularly relates to a streptococcus suis recombinant ZSD recombinant subunit vaccine, a recombinant epitope prokaryotic plasmid, preparation and application.
Background
Streptococcus suis (Streptococcus suis) is an important zoonosis pathogen, and can induce swine meningitis, arthritis, septicemia and the like; it can also cause meningitis and septicemia in human. According to different streptococcus suis capsular polysaccharide antigens, the streptococcus suis capsular polysaccharide can be divided into 35 serotypes, wherein types 1, 2, 3, 7 and 9 are pathotypes, and streptococcus suis type 2 has the strongest pathogenicity, is most popular in China and has the highest herd carrying rate. Since the large-scale development of intensive pig farms, the streptococcus suis disease of China is outbreak for many times, which brings huge loss to the development of pig breeding industry and affects the health of people.
The prevention and treatment of the streptococcus suis mainly depends on vaccination, and in view of the fact that the drug resistance of the streptococcus suis is gradually improved due to the abuse of antibiotics, certain treatment difficulty is brought, and efficient streptococcus suis vaccines need to be developed. The traditional vaccine has poor cross protection and is easy to have biological safety problem, while the genetic engineering subunit vaccine has the characteristics of high production efficiency, safe preparation process flow and good stability, and the tandem expression of a plurality of protective antigens or epitopes thereof of bacteria is an important research direction.
At present, no patent publication documents or reports in the aspect of recombinant epitope vaccines of streptococcus suis ZnuA, SsnA and DLDH are found at home and abroad.
Disclosure of Invention
The invention aims to overcome the defects of the prior art and provides a streptococcus suis recombinant ZSD recombinant subunit vaccine, a recombinant epitope prokaryotic plasmid, a preparation method and an application.
The technical scheme adopted by the invention for solving the technical problems is as follows:
a streptococcus suis recombinant ZSD recombinant subunit vaccine is a recombinant tandem expression protein ZSD of proteins ZnuA, Sssna and DLDH, and the nucleotide sequence of the recombinant tandem expression protein ZSD is SEQ ID NO. 2.
Moreover, the vaccine successfully predicts the B/Th cell epitope of the ZSD protein through bioinformatics, successfully constructs a prokaryotic expression plasmid pET28a-ZSD, and is obtained through purification and expression, and the tandem recombinant protein ZSD has no toxic effect on normal cells.
A recombinant epitope prokaryotic plasmid of the streptococcus suis recombinant ZSD recombinant subunit vaccine is constructed by the following steps:
screening out coexisting virulence factors ZnuA, Sssna and DLDH from streptococcus suis types 2, 3 and 9 to serve as candidate proteins;
secondly, according to amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, B/Th cell epitopes of the three proteins are respectively predicted by applying bioinformatics software TMHMM and SignalP, ABCPRed, Bepided2.0 and ProPred, and are connected in series to finally obtain nucleotide sequences of the serial epitopes;
thirdly, constructing a recombinant prokaryotic expression plasmid pET28a-ZSD, wherein the restriction sites are BamH1 and Xho1, introducing the recombinant expression plasmid into E.coli competent cells BL21 by a cold-hot alternating method, and carrying out clone identification by colony RT-RCR to correctly obtain the recombinant epitope prokaryotic plasmid of the recombinant ZSD subunit vaccine.
The recombinant epitope prokaryotic plasmid of the streptococcus suis recombinant ZSD recombinant subunit vaccine is a triple epitope gene recombinant prokaryotic expression plasmid pET28a-ZSD, and is specifically constructed by the following steps:
the method comprises the steps of screening virulence protein epitope of streptococcus suis, and specifically comprises the following steps:
screening common virulence factors ZnuA, SsnA and DLDH of streptococcus suis types 2, 3 and 9 in Tianjin region, wherein the amino acid sequences of proteins of the streptococcus suis ZnuA, SsnA and DLDH published according to NCBI are ABP91052.1, ABP90934.1 and AKG41058.1 respectively;
secondly, predicting the primary structure of the protein structure: according to the amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, analyzing a protein transmembrane region http:// www.cbs.dtu.dk/services/TMHMM/, by using an online TMHMM tool; analyzing a protein signal peptide region http:// www.cbs.dtu.dk/services/SignalP by using an online SignalP tool, and removing an intracellular peptide segment;
protein dominant B/Th cell epitope prediction: adopting ABCPred, namely an artificial network neural algorithm http:// crdd. osdd. net/raghava/ABCPred/ABC _ submissions. html and BepiPred2.0 method http:// www.cbs.dtu.dk/services/BepiPred/respectively predicting B cell epitopes of ZnuA, SnA and DLDH on line based on hydrophilicity, flexibility, accessibility, polarity, exposed surface, corner and hidden Markov model of amino acid, and taking an overlapping part of the two methods; predicting the Th cell epitopes of the three proteins by using a ProPred program, wherein the prediction types are selected from DRB1-0101, DRB1-0102 and DRB 1-0301;
predicting a secondary structure of the protein: in order to further verify the accuracy of the predicted three protein B/Th epitopes, SOPMA software is adopted to carry out online analysis on the protein secondary structure of the ZSD protein, and whether the obtained protein B/T cell epitope section is positioned on the exposed surface, the random coil and the corner of the antibody easily generated by the protein is detected; the hydrophilicity and antigenicity of ZnuA, SsnA and DLDH proteins are analyzed by Protean software;
the method comprises the following steps of:
combining and splicing epitopes in sequence according to SsnA-DLDH-Zuna sequence and acquiring SSNA-DLDH-Zuna tandem epitope protein amino acid sequence, namely SEQ ID NO. by adopting GGGGGG flexible segment of indirect head amino acid of each polypeptide according to the predicted dominant B cell and Th cell epitope of the acquired ZnuA, SsnA and DLDH proteins; after the epitopes are connected in series, the amino acid sequence is converted into a nucleotide sequence, and the nucleotide sequence is optimized according to the preference of the escherichia coli codon, so that the nucleotide sequence SEQ ID NO.2 of the epitope connected in series is finally obtained.
Secondly, constructing a recombinant prokaryotic expression plasmid PET28a-ZSD, wherein the restriction enzyme sites are BamH1 and Xho1, introducing the recombinant expression plasmid into E.coli competent cells BL21 by a cold-hot alternation method, and carrying out cloning identification through a colony RT-RCR to obtain the recombinant epitope prokaryotic plasmid.
The intracellular peptide segment in the step II is a signal peptide segment and a transmembrane peptide segment.
The method for preparing the streptococcus suis recombinant ZSD recombinant subunit vaccine by using the recombinant epitope prokaryotic plasmid comprises the following steps:
and (2) inoculating the recombinant epitope prokaryotic plasmid into Kan/LB culture solution in a ratio of 1:100, performing induction expression by IPTG, performing vertical electrophoresis by 12% SDS-PAGE, performing Western Blot verification to determine correct protein expression, and purifying by a His nickel column to obtain the ZSD protein, thereby obtaining the recombinant subunit vaccine of the streptococcus suis.
The application of the streptococcus suis recombinant ZSD recombinant subunit vaccine in the preparation of the vaccine.
The recombinant ZSD subunit vaccine of the streptococcus suis is applied to the aspect of being used as a genetic engineering vaccine capable of preventing a plurality of strains of streptococcus suis in the animal husbandry.
The application of the streptococcus suis recombinant ZSD recombinant subunit vaccine in the construction of a streptococcus suis epitope prediction vaccine which can prevent and target multiple strains of streptococcus suis.
The invention has the advantages and positive effects that:
1. the streptococcus suis strains have various serotype types, and the genetic engineering vaccine capable of preventing the streptococcus of various serotype types in the animal husbandry is not reported at present.
2. The invention relates to prediction and design synthesis of dominant B/Th cell epitopes of streptococcus suis DLDH, SsnA and Zuna proteins, constructs a recombinant prokaryotic expression plasmid pET28a-ZSD and obtains a purified protein ZSD, in particular to a prokaryotic expression plasmid pET28a-ZSD which obtains DLDH, SsnA and Zuna gene epitope prediction sequences by using bioinformatics and application thereof. The invention aims to construct recombinant protein capable of preventing various serotype streptococcus suis and provides a certain test basis for the prevention and treatment of the streptococcus suis in animal husbandry.
3. The invention discloses a streptococcus suis 2, 3 and 9 type DLDH, SsnA and Zuna protein epitope tandem subunit vaccine. The swine streptococcosis is a common bacterial infectious disease in the swine industry worldwide, can cause the infection of pigs of different ages and breeds, is mainly manifested as arthrocele, meningitis, pneumonia, septicemia and the like, and causes very serious economic loss to the global swine industry. The invention separates the streptococcus suis types 2, 3 and 9 with stronger pathogenicity from Tianjin area, detects virulence factors DLDH, SsnA and Zuna shared by three serotypes of streptococcus suis through RT-PCR, and is used as candidate protein of a streptococcus suis tandem subunit vaccine. NCBI finds out protein sequences DLDH, SsnA and Zuna, and passes through an ABCPredict Server; bepided 2.0 Server; MHC Class-I Binding Peptide Prediction Server; MHC Class-II Binding Peptide Prediction Server predicts 2 dominant B cell epitopes and 2 dominant Th cell epitopes of each protein respectively, and the dominant epitopes are connected to obtain epitope sequences. Constructing a pET28a-ZSD cloning vector containing a target gene fragment; after enzyme digestion and identification of RCR specific primers, carrying out induced expression and purification to obtain a recombinant protein ZSD; the toxicity of the recombinant protein on Marc-145, RAW246.7 and PK-15 cell lines is determined by a CCK-8 method.
4. The invention utilizes 3 important protective antigens of streptococcus suis, namely high affinity zinc absorption protein (ZnuA), secreted nuclease (SsnA) and FAD dependent enzyme (DLDH), wherein the ZnuA protein is related to zinc absorption and bacterial pathogenicity and has better immunogenicity; SsnA has deoxyribonuclease activity and is able to act directly on DNA, a key macromolecular substance in cells, and is therefore presumed to be a potential virulence factor. DLDH is one of pyruvate dehydrogenase components, is involved in cellular respiratory energy metabolism, is presumed to have a function of transporting saccharides, and is detected to have high immunogenicity.
5. The invention designs recombinant epitope polypeptide molecules of streptococcus suis candidate vaccine proteins ZnuA, Sssna and DLDH (ZSD protein for short) by using a bioinformatics method. Screening coexisting virulence factors from streptococcus suis types 2, 3 and 9, analyzing a protein transmembrane region and a signal peptide region by using online tools TMHMM and SignalP, predicting B cell epitopes of ZnuA, Ssna and DLDH proteins by using ABCPred and Bepipred software, and predicting Th epitopes of the proteins by using MHC-II molecule binding peptide; and performing online structure analysis on the protein by using SOPMA software, and further verifying the accuracy of the obtained B/Th cell epitope. Screening dominant B cell epitope and Th cell epitope, connecting the epitopes in series in sequence to construct recombinant plasmid pET28a-ZSD, inducing and transforming E.coli expression strain by recombinant plasmid IPTG, ultrasonically crushing bacterial liquid, purifying by inclusion body of precipitated protein and nickel column of supernatant protein to obtain purified protein, and performing cytotoxicity test by using the purified protein.
Drawings
FIG. 1 is a graph of the results of TMHMM tool prediction of the transmembrane domain of proteins of the present invention; wherein A is a prediction result of a DLDH protein transmembrane region; b is the prediction result of the transmembrane region of the SsnA protein; c is a prediction result graph of a transmembrane region of the ZnuA protein;
FIG. 2 is a graph showing the results of predicting signal peptide fragments of proteins using the SignalP tool of the present invention; wherein A is a prediction result of a DLDH protein signal peptide fragment; b is a prediction result of a SsnA protein signal peptide segment; c is a prediction result of Zuna protein signal peptide;
FIG. 3 is a diagram of the secondary structure of the predicted DLDH-SsnA-Zuna protein by SOPMA software in the present invention; note: c is random crimp; e is a beta-sheet layer; h is an alpha-helix; t is a beta-turn;
FIG. 4 is a graph showing the hydrophilicity and antigenicity of DLDH-SsnA-Zuna protein predicted by Protean software of the present invention;
FIG. 5 is a diagram showing the results of double digestion with pET28a-ZSD according to the present invention; note: m: DL5000 DNASMarker; 1,2: repeating the wells;
FIG. 6 is a partial ZSD gene PCR amplification chart in the invention; note: m: DL2000 Marker; 1: partial ZSD gene PCR results;
FIG. 7 is a Western Blot result chart of ZSD prokaryotic expression protein in the invention; note: 1: blank control (BL21 no load); 2: the ZSD expression strain cracking supernatant; 3: cracking and precipitating the ZSD expression strain;
FIG. 8 is a SDS-PAGE pattern of ZSD protein purification in accordance with the present invention; note: m: a 250kDa protein Marker; 1: the ZSD expression strain cracking supernatant; 2: effluent liquid after passing through the Ni column; 3: collecting liquid after washing by buffer solution; 4: eluting with 100mmol of imidazole; 5: eluting with 200mmol of imidazole; 6: eluting with 300mmol of imidazole;
FIG. 9 is a graph showing the results of tandem protein ZSD on cell CCK-8 in accordance with the present invention; note: a: ZSD vs. Marc-145 CCK-8 results; b: ZSD vs RAW246.7 cells CCK-8 results; c: ZSD vs PK-15 cells CCK-8 results; NS means no statistical difference compared to the control group.
Detailed Description
The present invention is further illustrated by the following examples, which are intended to be illustrative, not limiting and are not intended to limit the scope of the invention.
The raw materials used in the invention are all conventional commercial products if no special description exists, the method used in the invention is all conventional methods in the field if no special description exists, and the mass of all the substances used in the invention is the conventional use mass; the experimental method of the present invention, in which specific conditions are not specified, is generally carried out according to conventional conditions, such as molecular cloning: the conditions described in the Laboratory Manual (New York Cold Spring Harbor Laboratory Press, 1989). Materials, reagents and the like used in the following examples are commercially available unless otherwise specified.
A streptococcus suis recombinant ZSD recombinant subunit vaccine is a recombinant tandem expression protein ZSD of proteins ZnuA, Sssna and DLDH, and the nucleotide sequence of the recombinant tandem expression protein ZSD is SEQ ID NO. 2.
Preferably, the vaccine successfully predicts the B/Th cell epitope of the ZSD protein through bioinformatics, successfully constructs a prokaryotic expression plasmid pET28a-ZSD, and performs purification expression to obtain the recombinant protein ZSD, wherein the tandem recombinant protein ZSD has no toxic effect on normal cells.
A recombinant epitope prokaryotic plasmid of the streptococcus suis recombinant ZSD recombinant subunit vaccine is constructed by the following steps:
screening out coexisting virulence factors ZnuA, Sssna and DLDH from streptococcus suis types 2, 3 and 9 to serve as candidate proteins;
secondly, according to amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, B/Th cell epitopes of the three proteins are respectively predicted by applying bioinformatics software TMHMM and SignalP, ABCPRed, Bepided2.0 and ProPred, and are connected in series to finally obtain nucleotide sequences of the serial epitopes;
thirdly, constructing a recombinant prokaryotic expression plasmid pET28a-ZSD, wherein the restriction sites are BamH1 and Xho1, introducing the recombinant expression plasmid into E.coli competent cells BL21 by a cold-hot alternating method, and carrying out clone identification by colony RT-RCR to correctly obtain the recombinant epitope prokaryotic plasmid of the recombinant ZSD subunit vaccine.
The recombinant epitope prokaryotic plasmid of the streptococcus suis recombinant ZSD recombinant subunit vaccine is a triple epitope gene recombinant prokaryotic expression plasmid pET28a-ZSD, and is specifically constructed by the following steps:
the method comprises the steps of screening virulence protein epitope of streptococcus suis, and specifically comprises the following steps:
screening common virulence factors ZnuA, SsnA and DLDH of streptococcus suis types 2, 3 and 9 in Tianjin region, wherein the amino acid sequences of proteins of the streptococcus suis ZnuA, SsnA and DLDH published according to NCBI are ABP91052.1, ABP90934.1 and AKG41058.1 respectively;
secondly, predicting the primary structure of the protein structure: according to the amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, analyzing a protein transmembrane region http:// www.cbs.dtu.dk/services/TMHMM/, by using an online TMHMM tool; analyzing a protein signal peptide region http:// www.cbs.dtu.dk/services/SignalP by using an online SignalP tool, and removing an intracellular peptide segment;
protein dominant B/Th cell epitope prediction: adopting ABCPred, namely an artificial network neural algorithm http:// crdd. osdd. net/raghava/ABCPred/ABC _ submissions. html and BepiPred2.0 method http:// www.cbs.dtu.dk/services/BepiPred/respectively predicting B cell epitopes of ZnuA, SnA and DLDH on line based on hydrophilicity, flexibility, accessibility, polarity, exposed surface, corner and hidden Markov model of amino acid, and taking an overlapping part of the two methods; predicting the Th cell epitopes of the three proteins by using a ProPred program, wherein the prediction types are selected from DRB1-0101, DRB1-0102 and DRB 1-0301;
predicting a secondary structure of the protein: in order to further verify the accuracy of the predicted three protein B/Th epitopes, SOPMA software is adopted to carry out online analysis on the protein secondary structure of the ZSD protein, and whether the obtained protein B/T cell epitope section is positioned on the exposed surface, the random coil and the corner of the antibody easily generated by the protein is detected; the hydrophilicity and antigenicity of ZnuA, SsnA and DLDH proteins are analyzed by Protean software;
the method comprises the following steps of:
combining and splicing epitopes in sequence according to SsnA-DLDH-Zuna sequence and acquiring SSNA-DLDH-Zuna tandem epitope protein amino acid sequence, namely SEQ ID NO. by adopting GGGGGG flexible segment of indirect head amino acid of each polypeptide according to the predicted dominant B cell and Th cell epitope of the acquired ZnuA, SsnA and DLDH proteins; after the epitopes are connected in series, the amino acid sequence is converted into a nucleotide sequence, and the nucleotide sequence is optimized according to the preference of the escherichia coli codon, so that the nucleotide sequence SEQ ID NO.2 of the epitope connected in series is finally obtained.
Secondly, constructing a recombinant prokaryotic expression plasmid PET28a-ZSD, wherein the restriction enzyme sites are BamH1 and Xho1, introducing the recombinant expression plasmid into E.coli competent cells BL21 by a cold-hot alternation method, and carrying out cloning identification through a colony RT-RCR to obtain the recombinant epitope prokaryotic plasmid.
Preferably, the intracellular peptide segment in the step I is a signal peptide segment and a transmembrane peptide segment.
The method for preparing the streptococcus suis recombinant ZSD recombinant subunit vaccine by using the recombinant epitope prokaryotic plasmid comprises the following steps:
and (2) inoculating the recombinant epitope prokaryotic plasmid into Kan/LB culture solution in a ratio of 1:100, performing induction expression by IPTG, performing vertical electrophoresis by 12% SDS-PAGE, performing Western Blot verification to determine correct protein expression, and purifying by a His nickel column to obtain the ZSD protein, thereby obtaining the recombinant subunit vaccine of the streptococcus suis.
The application of the streptococcus suis recombinant ZSD recombinant subunit vaccine in the preparation of the vaccine.
The recombinant ZSD subunit vaccine of the streptococcus suis is applied to the aspect of being used as a genetic engineering vaccine capable of preventing a plurality of strains of streptococcus suis in the animal husbandry.
The application of the streptococcus suis recombinant ZSD recombinant subunit vaccine in the construction of a streptococcus suis epitope prediction vaccine which can prevent and target multiple strains of streptococcus suis.
Specifically, the preparation and detection examples related to the present invention are as follows:
an epitope gene recombination prokaryotic expression plasmid pET28a-ZSD, an epitope tandem subunit vaccine, comprises the following construction steps:
1. the method for screening the streptococcus suis virulence protein epitope comprises the following specific steps:
(1) screening common virulence factors ZnuA, SsnA and DLDH of streptococcus suis types 2, 3 and 9 in Tianjin region, and respectively obtaining ABP91052.1(317aa), ABP90934.1(1059aa) and AKG41058.1(586aa) according to amino acid sequences of proteins ZnuA, SsnA and DLDH of streptococcus suis published by NCBI.
(2) Prediction of primary structure of protein structure: according to the amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, analyzing a protein transmembrane region (http:// www.cbs.dtu.dk/services/TMHMM /) by using an online TMHMM tool; the signal peptide region of the protein (http:// www.cbs.dtu.dk/services/SignalP) was analyzed by using an on-line SignalP tool to remove intracellular peptide fragments such as signal peptide fragments and transmembrane peptide fragments.
Detecting that no transmembrane region exists in DLDH protein by a TMHMM tool, wherein 1-586 amino acid sequences of the DLDH protein are extracellular fragments (shown in figure 1A), two transmembrane regions 1-50 and 1036-1059 exist in SsnA protein, amino acids at positions 51-1053 are extracellular fragments (shown in figure 1B), one transmembrane region exists in Zuna protein, amino acids at positions 1-35, and the rest amino acids are extracellular fragments (shown in figure 1C); no signal peptide segment of DLDH protein was detected by SignalP tool (FIG. 2A), amino acids 54-56 of SsnA protein were signal peptide segment (FIG. 2B), and amino acids 28-30 of Zuna protein were signal peptide segment (FIG. 2C).
(3) Prediction of protein dominant B/Th cell epitope: b cell epitopes of ZnuA, SsnA and DLDH three proteins are respectively predicted on line by adopting ABCPred (artificial network neural algorithm) (http:// crdd. osdd. net/raghava/ABCPred/ABC _ submissions. html) and BepiPred2.0 method (http:// www.cbs.dtu.dk/services/BepiPred /) based on hydrophilicity, flexibility, accessibility, polarity, exposed surface, corner and invisible Markov model of amino acid, and overlapping parts of the two methods are taken; predicting the Th cell epitopes of the three proteins by using a ProPred program, wherein the prediction types are selected from DRB1-0101, DRB1-0102 and DRB 1-0301.
(4) Prediction of protein secondary structure: in order to further verify the accuracy of the predicted three protein B/Th epitopes, SOPMA software is adopted to carry out online analysis on the protein secondary structure of the ZSD protein, and whether the obtained protein B/T cell epitope section is positioned on the exposed surface, the random coil and the corner of the antibody easily generated by the protein is detected; the results show that the amino acid sequences of the ZSD protein are in random coil and corner sections (figure 3), which indicates that the predicted dominant B/Th cell epitope is reasonable. The hydrophilicity and antigenicity of ZnuA, SsnA and DLDH proteins are analyzed by Protean software, and the results show that the predicted amino acid fragments are all in sections with better antigenicity, and the rationality of the dominant B/Th cell epitope obtained through prediction is supported (figure 4).
2. Designing a tandem epitope vaccine and constructing a plasmid, which comprises the following specific steps:
according to the predicted dominant B cell and Th cell antigenic epitopes of the obtained ZnuA, SsnA and DLDH proteins, the epitopes are sequentially combined and spliced according to the sequence of SsnA-DLDH-ZnuA, the indirect head amino acid of each polypeptide adopts GGGGG flexible fragments to obtain the amino acid sequence of the SSNA-DLDH-ZUNA tandem epitope protein, and the amino acid sequence is as follows: FYPSYHSTPQRPGGGGIQGASHQSPLGGGGTSENTATKPSDLGGGGKATTEAGLGKGGGGDVTPDGDTKTSDGGGGNSSGTAFDATNKGGGGWAAVRKTLAGGGGYKGELQLTTGGGGYVDDSTLPTGGGGFMEEHGRASGGGGIDPTNPAWAGGGGGQVNPDKTGGGGSIPGIYAPGDVNGGGGATPAAAPGGGGKKQEGDFVNGGGGIVHGNGATVGGGGYGKENILIGGGGEVAQATADLGGGGSVEVGAALAGGGGVTIFNGLGQGGGGSQTTEGSSKPRVAGGGGLAPEGEEGDTGGGGNTMEDGEEIVGGGGYVAKSSDLSGGGGIPKESRYLVGGGGDHNIKAIFTGGGGSYDFTLYAP, the amino acid number of the recombinant protein is 366 aa. Converting an amino acid sequence into a nucleotide sequence after epitope tandem, optimizing the nucleotide sequence according to the preference of an escherichia coli codon, respectively adding enzyme cutting sites BamH1 and Xho1 at the N end and the C end, and finally obtaining the nucleotide sequence of the tandem epitope protein as the nucleotide sequence of the tandem epitope, wherein the optimized sequence is as follows:
GGATCCTTTTATCCGAGCTATCATAGTACCCCGCAGCGTCCGGGCGGCGGTGGTATTCAGGGTGCCTCACATCAGTCTCCGTTAGGCGGTGGTGGCACCTCTGAAAATACCGCAACCAAACCGTCCGACCTGGGCGGTGGTGGCAAAGCCACCACCGAAGCAGGTCTGGGCAAAGGTGGTGGCGGCGATGTGACCCCGGATGGTGATACCAAAACCTCAGATGGCGGCGGTGGTAATAGTTCAGGTACCGCCTTTGATGCAACCAATAAAGGTGGCGGTGGCTGGGCCGCCGTTCGTAAAACCTTAGCAGGCGGCGGCGGTTATAAAGGCGAATTACAGCTGACCACCGGCGGCGGTGGCTATGTTGATGATTCTACCCTGCCGACCGGCGGTGGCGGCTTTATGGAAGAACATGGTCGCGCCTCAGGCGGCGGTGGCATTGATCCGACCAATCCGGCCTGGGCAGGTGGTGGCGGTGGTCAGGTTAATCCGGATAAAACCGGCGGTGGCGGTTCAATTCCGGGTATTTATGCGCCTGGTGATGTGAATGGTGGTGGCGGCGCCACCCCCGCGGCAGCTCCAGGCGGTGGCGGTAAAAAACAGGAAGGCGATTTTGTTAATGGTGGCGGTGGTATTGTGCATGGTAATGGTGCAACCGTTGGTGGTGGCGGCTATGGTAAAGAAAATATTCTGATTGGCGGCGGTGGTGAAGTTGCACAGGCTACTGCCGATCTGGGTGGTGGCGGTAGCGTTGAAGTTGGCGCAGCATTAGCAGGTGGCGGCGGTGTGACCATTTTTAATGGCTTAGGCCAGGGTGGTGGCGGCTCACAGACCACCGAAGGCTCTAGTAAACCGCGTGTTGCAGGTGGTGGCGGCTTGGCCCCGGAAGGCGAAGAAGGCGATACCGGCGGTGGTGGCAATACGATGGAAGATGGTGAAGAAATTGTTGGTGGTGGCGGTTATGTTGCCAAATCAAGCGATCTGTCAGGTGGCGGCGGCATTCCGAAAGAATCTCGCTATTTAGTTGGCGGTGGCGGCGATCATAATATTAAAGCCATTTTTACCGGTGGCGGCGGTAGCTATGATTTTACCCTGTATGCCCCGCTCGAG。
preferably, the gene sequence is synthesized by Shanghai Czeri biological Limited, a synthesized recombinant prokaryotic expression plasmid is pET28a-ZSD, plasmids are extracted by a plasmid extraction kit, restriction enzymes BamH1 and Xoh1 are respectively used for double enzyme digestion verification, and an enzyme digestion reaction system is shown in Table 1.
TABLE 1 digestion reaction System
The recombinant prokaryotic expression plasmid pET28a-ZSD is identified by double enzyme digestion as shown in figure 5.
3. Prokaryotic expression and purification of tandem protein comprise the following specific steps:
(1) transferring a recombinant plasmid pET28a-ZSD into E.coli competent cells BL21 by a heat shock method, centrifuging (5000r/min, 5min) the recovered competent cells, suspending the cells in 100 mu L LB liquid culture medium, uniformly spreading the suspended cells on an LB plate with Kanamycin (Kanamycin, Kan), culturing overnight in a 37 ℃ culture box, selecting a single colony, and carrying out clone identification by using a PCR method, wherein a ZSD upstream primer:
5'-TGGCGGCGGTGGTAATAGTTCAGG-3', ZSD downstream primer:
5'-GCGCCGCCACCACCATTCACAT-3' are provided. The PCR reaction system is shown in Table 2.
TABLE 2 PCR reaction System
Note: reaction procedure: pre-denaturation at 95 ℃ for 5 min; {95 ℃, 30 s; 30s at 60 ℃; 73 ℃ for 1min 35 cycles; extension at 73 ℃ for 15 min. Storing at 4 deg.C for use.
After the reaction, the amplified product was electrophoresed using 1.0% agarose gel to detect the target fragment.
The results of PCR identification of the above colonies are shown in FIG. 6.
(2) Inoculating the tandem protein expression strain into Kan/LB liquid culture medium (the final concentration of Kan is 50 mu g/mL) at the ratio of 1:100, and performing shake culture at 37 ℃ for 2-3 h until the concentration of the bacterial liquid reaches OD600Adding isopropyl-beta-D-thiogalactoside (IPT) when the concentration is 0.4-0.6G) And (3) performing induction expression until the final concentration is 1mmol/mL, continuing shaking culture for 4-6 h, centrifuging to collect precipitates, adding a proper amount of PBS (phosphate buffer solution) for ultrasonication, centrifuging to collect supernate and precipitates respectively, adding SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis) loading buffer solution, boiling for 5min, and performing the same treatment on a strain BL21 containing pET28a empty plasmid. And (3) separating proteins by SDS-PAGE, transferring the proteins to a PVDF membrane, conventionally incubating a primary antibody and a secondary antibody, and developing by ImageLab to obtain the tandem protein expression condition.
The specific steps of step (2) are as follows:
SDS-PAGE electrophoresis
Correctly assembling an electrophoresis tank, and putting prefabricated glue; pouring an electrophoresis buffer solution, removing the comb, and sequentially adding a pre-dyed protein marker and a sample to be detected; performing constant-pressure 120V electrophoresis at room temperature until the bottom of the gel is finished;
die for spreading medicine
Cutting a PVDF membrane with a proper size, soaking in methanol for 1min, and soaking the soaked PVDF membrane and filter paper in a membrane transferring buffer solution;
taking out the gel, and cutting the gel containing the target protein by contrasting with the Marker;
thirdly, paving the filter paper-PVDF membrane-gel-filter paper in sequence, and removing bubbles to ensure that the gel is fully contacted with the membrane;
fourthly, rotating the membrane for 45min at room temperature and 15V;
sealing by using a three-dimensional sealing material
After the membrane conversion is finished, taking out the PVDF membrane, and washing the PVDF membrane for 3 times with PBST on a 60r/min shaking bed, wherein each time lasts for 5 min; preparing 5% skim milk as a sealing liquid, fully contacting the PVDF membrane with the sealing liquid, and sealing overnight at 4 ℃;
fourth binding antibody
In combination with an antibody:
diluting the His-tag antibody with a blocking solution according to the antibody specification, wherein the dilution is 1: 1000; placing the sealed PVDF membrane in the diluted primary antibody, incubating at room temperature for 90min, taking out the PVDF membrane, washing with PBST for 5min each time for 3 times;
binding of secondary antibody:
according to the antibody specification, the secondary antibody is diluted by using a blocking solution, and the dilution of the goat anti-rabbit IgG antibody is 1: 1000; incubating the PVDF membrane after primary incubation and the diluted secondary antibody, incubating at room temperature for 1h, taking out the PVDF membrane, and washing with PBST for 3 times, 5min each time;
development by the ECL method
And (3) taking the equal amount of the solution A and the solution B in the ECL kit, fully mixing, contacting with a PVDF membrane, and reacting for 5min at room temperature in a dark place. Images were collected with a BIO-RAD gel imager and scanned for gray scale using ImageLab software.
The Western Blot results of the ZSD protein are shown in FIG. 7, and show that the ZSD protein has the size of 44KDa and exists in both the supernatant and the precipitate after the ultrasonic cleavage.
(3) The His-tag ZSD protein is purified by using Ni-NTA, and the specific steps are as follows:
firstly, column assembling: resuspending the medium, adding a proper amount of the medium into the chromatographic column according to the amount of the protein to be purified, and standing;
the balance is achieved: balancing the chromatographic column with a 5-10 times column volume of a balancing buffer solution (and adding low-concentration imidazole into the balancing buffer solution);
the sample is loaded, and in order to avoid blocking the chromatographic column, the sample is filtered by using a 0.45 mu m filter in advance;
fourthly, washing: after the sample loading is finished, washing the chromatographic column by using a 5-10 times column volume of balance buffer solution, and collecting effluent liquid;
carrying out elution: eluting the target protein by imidazole with different concentrations, and performing gradient elution.
The results after purification of the ZSD protein are shown in FIG. 8, which shows that the ZSD protein is successfully purified and the elution effect of 200mmol of imidazole is the best.
4. The effect of tandem protein ZSD on normal cells comprises the following specific steps:
marc-145, RAW246.7, PK-15 cells were cultured routinely, passaged in 96-well plates at 100. mu.L per well in 5% CO2The cells were incubated overnight at 37 ℃ and the tandem protein ZSD was added to give final concentrations of 500, 200. mu.g/mL, 100. mu.g/mL, 50. mu.g/mL, 20. mu.g/mL, and 10. mu.g/mL, respectively. Each set was set with 4 replicates. After incubation for 4h in a cell incubator 10. mu.L of CCK8 was added to each well, incubated at 37 ℃ for 40min, the absorbance of each well was read at OD490 nm and OD630 nm, respectively, and the results were recorded.
The result shows that the purified tandem protein ZSD has no obvious toxic effect on three cells, namely Marc-145, RAW246.7 and PK-15 (figure 9), and the biological safety of the invention is proved.
Although the embodiments of the present invention have been disclosed for illustrative purposes, those skilled in the art will appreciate that: various substitutions, changes and modifications are possible without departing from the spirit and scope of the invention and the appended claims, and therefore the scope of the invention is not limited to the embodiments disclosed.
Sequence listing
<110> Tianjin college of agriculture
<120> streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application
<160> 4
<170> SIPOSequenceListing 1.0
<210> 1
<211> 366
<212> PRT
<213> SSNA-DLDH-ZUNA tandem epitope protein amino acid sequence (Unknown)
<400> 1
Phe Tyr Pro Ser Tyr His Ser Thr Pro Gln Arg Pro Gly Gly Gly Gly
1 5 10 15
Ile Gln Gly Ala Ser His Gln Ser Pro Leu Gly Gly Gly Gly Thr Ser
20 25 30
Glu Asn Thr Ala Thr Lys Pro Ser Asp Leu Gly Gly Gly Gly Lys Ala
35 40 45
Thr Thr Glu Ala Gly Leu Gly Lys Gly Gly Gly Gly Asp Val Thr Pro
50 55 60
Asp Gly Asp Thr Lys Thr Ser Asp Gly Gly Gly Gly Asn Ser Ser Gly
65 70 75 80
Thr Ala Phe Asp Ala Thr Asn Lys Gly Gly Gly Gly Trp Ala Ala Val
85 90 95
Arg Lys Thr Leu Ala Gly Gly Gly Gly Tyr Lys Gly Glu Leu Gln Leu
100 105 110
Thr Thr Gly Gly Gly Gly Tyr Val Asp Asp Ser Thr Leu Pro Thr Gly
115 120 125
Gly Gly Gly Phe Met Glu Glu His Gly Arg Ala Ser Gly Gly Gly Gly
130 135 140
Ile Asp Pro Thr Asn Pro Ala Trp Ala Gly Gly Gly Gly Gly Gln Val
145 150 155 160
Asn Pro Asp Lys Thr Gly Gly Gly Gly Ser Ile Pro Gly Ile Tyr Ala
165 170 175
Pro Gly Asp Val Asn Gly Gly Gly Gly Ala Thr Pro Ala Ala Ala Pro
180 185 190
Gly Gly Gly Gly Lys Lys Gln Glu Gly Asp Phe Val Asn Gly Gly Gly
195 200 205
Gly Ile Val His Gly Asn Gly Ala Thr Val Gly Gly Gly Gly Tyr Gly
210 215 220
Lys Glu Asn Ile Leu Ile Gly Gly Gly Gly Glu Val Ala Gln Ala Thr
225 230 235 240
Ala Asp Leu Gly Gly Gly Gly Ser Val Glu Val Gly Ala Ala Leu Ala
245 250 255
Gly Gly Gly Gly Val Thr Ile Phe Asn Gly Leu Gly Gln Gly Gly Gly
260 265 270
Gly Ser Gln Thr Thr Glu Gly Ser Ser Lys Pro Arg Val Ala Gly Gly
275 280 285
Gly Gly Leu Ala Pro Glu Gly Glu Glu Gly Asp Thr Gly Gly Gly Gly
290 295 300
Asn Thr Met Glu Asp Gly Glu Glu Ile Val Gly Gly Gly Gly Tyr Val
305 310 315 320
Ala Lys Ser Ser Asp Leu Ser Gly Gly Gly Gly Ile Pro Lys Glu Ser
325 330 335
Arg Tyr Leu Val Gly Gly Gly Gly Asp His Asn Ile Lys Ala Ile Phe
340 345 350
Thr Gly Gly Gly Gly Ser Tyr Asp Phe Thr Leu Tyr Ala Pro
355 360 365
<210> 2
<211> 1110
<212> DNA/RNA
<213> nucleotide sequence of tandem epitope protein (Unknown)
<400> 2
ggatcctttt atccgagcta tcatagtacc ccgcagcgtc cgggcggcgg tggtattcag 60
ggtgcctcac atcagtctcc gttaggcggt ggtggcacct ctgaaaatac cgcaaccaaa 120
ccgtccgacc tgggcggtgg tggcaaagcc accaccgaag caggtctggg caaaggtggt 180
ggcggcgatg tgaccccgga tggtgatacc aaaacctcag atggcggcgg tggtaatagt 240
tcaggtaccg cctttgatgc aaccaataaa ggtggcggtg gctgggccgc cgttcgtaaa 300
accttagcag gcggcggcgg ttataaaggc gaattacagc tgaccaccgg cggcggtggc 360
tatgttgatg attctaccct gccgaccggc ggtggcggct ttatggaaga acatggtcgc 420
gcctcaggcg gcggtggcat tgatccgacc aatccggcct gggcaggtgg tggcggtggt 480
caggttaatc cggataaaac cggcggtggc ggttcaattc cgggtattta tgcgcctggt 540
gatgtgaatg gtggtggcgg cgccaccccc gcggcagctc caggcggtgg cggtaaaaaa 600
caggaaggcg attttgttaa tggtggcggt ggtattgtgc atggtaatgg tgcaaccgtt 660
ggtggtggcg gctatggtaa agaaaatatt ctgattggcg gcggtggtga agttgcacag 720
gctactgccg atctgggtgg tggcggtagc gttgaagttg gcgcagcatt agcaggtggc 780
ggcggtgtga ccatttttaa tggcttaggc cagggtggtg gcggctcaca gaccaccgaa 840
ggctctagta aaccgcgtgt tgcaggtggt ggcggcttgg ccccggaagg cgaagaaggc 900
gataccggcg gtggtggcaa tacgatggaa gatggtgaag aaattgttgg tggtggcggt 960
tatgttgcca aatcaagcga tctgtcaggt ggcggcggca ttccgaaaga atctcgctat 1020
ttagttggcg gtggcggcga tcataatatt aaagccattt ttaccggtgg cggcggtagc 1080
tatgatttta ccctgtatgc cccgctcgag 1110
<210> 3
<211> 24
<212> DNA/RNA
<213> ZSD upstream primer (Unknown)
<400> 3
tggcggcggt ggtaatagtt cagg 24
<210> 4
<211> 22
<212> DNA/RNA
<213> ZSD downstream primer (Unknown)
<400> 4
gcgccgccac caccattcac at 22
Claims (9)
1. A streptococcus suis recombinant ZSD recombinant subunit vaccine is characterized in that: the vaccine is a recombinant tandem expression protein ZSD of proteins ZnuA, Sssna and DLDH, and the nucleotide sequence of the recombinant tandem expression protein ZSD is SEQ ID NO. 2.
2. The streptococcus suis recombinant ZSD recombinant subunit vaccine of claim 1, characterized in that: the vaccine is obtained by successfully predicting the B/Th cell epitope of the ZSD protein through bioinformatics, successfully constructing a prokaryotic expression plasmid pET28a-ZSD and purifying and expressing the prokaryotic expression plasmid, and the tandem recombinant protein ZSD has no toxic effect on normal cells.
3. A recombinant epitope prokaryotic plasmid of a streptococcus suis recombinant ZSD subunit vaccine according to claim 1 or 2, characterized in that: the construction steps are as follows:
screening out coexisting virulence factors ZnuA, Sssna and DLDH from streptococcus suis types 2, 3 and 9 to serve as candidate proteins;
secondly, according to amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, B/Th cell epitopes of the three proteins are respectively predicted by applying bioinformatics software TMHMM and SignalP, ABCPRed, Bepided2.0 and ProPred, and are connected in series to finally obtain nucleotide sequences of the serial epitopes;
thirdly, constructing a recombinant prokaryotic expression plasmid pET28a-ZSD, wherein the restriction sites are BamH1 and Xho1, introducing the recombinant expression plasmid into E.coli competent cells BL21 by a cold-hot alternating method, and carrying out clone identification by colony RT-RCR to correctly obtain the recombinant epitope prokaryotic plasmid of the recombinant ZSD subunit vaccine.
4. A recombinant epitope prokaryotic plasmid of a streptococcus suis recombinant ZSD subunit vaccine according to claim 1 or 2, characterized in that: the recombinant epitope prokaryotic plasmid is a triple epitope gene recombinant prokaryotic expression plasmid pET28a-ZSD, and the specific construction steps are as follows:
the method comprises the steps of screening virulence protein epitope of streptococcus suis, and specifically comprises the following steps:
screening common virulence factors ZnuA, SsnA and DLDH of streptococcus suis types 2, 3 and 9 in Tianjin region, wherein the amino acid sequences of proteins of the streptococcus suis ZnuA, SsnA and DLDH published according to NCBI are ABP91052.1, ABP90934.1 and AKG41058.1 respectively;
secondly, predicting the primary structure of the protein structure: according to the amino acid sequence information of three proteins of ZnuA, SsnA and DLDH, analyzing a protein transmembrane region http:// www.cbs.dtu.dk/services/TMHMM/, by using an online TMHMM tool; analyzing a protein signal peptide region http:// www.cbs.dtu.dk/services/SignalP by using an online SignalP tool, and removing an intracellular peptide segment;
protein dominant B/Th cell epitope prediction: adopting ABCPred, namely an artificial network neural algorithm http:// crdd. osdd. net/raghava/ABCPred/ABC _ submissions. html and BepiPred2.0 method http:// www.cbs.dtu.dk/services/BepiPred/respectively predicting B cell epitopes of ZnuA, SnA and DLDH on line based on hydrophilicity, flexibility, accessibility, polarity, exposed surface, corner and hidden Markov model of amino acid, and taking an overlapping part of the two methods; predicting the Th cell epitopes of the three proteins by using a ProPred program, wherein the prediction types are selected from DRB1-0101, DRB1-0102 and DRB 1-0301;
predicting a secondary structure of the protein: in order to further verify the accuracy of the predicted three protein B/Th epitopes, SOPMA software is adopted to carry out online analysis on the protein secondary structure of the ZSD protein, and whether the obtained protein B/T cell epitope section is positioned on the exposed surface, the random coil and the corner of the antibody easily generated by the protein is detected; the hydrophilicity and antigenicity of ZnuA, SsnA and DLDH proteins are analyzed by Protean software;
the method comprises the following steps of:
combining and splicing epitopes in sequence according to SsnA-DLDH-Zuna sequence and acquiring SSNA-DLDH-Zuna tandem epitope protein amino acid sequence, namely SEQ ID NO. by adopting GGGGGG flexible segment of indirect head amino acid of each polypeptide according to the predicted dominant B cell and Th cell epitope of the acquired ZnuA, SsnA and DLDH proteins; after the epitopes are connected in series, converting the amino acid sequence into a nucleotide sequence, and optimizing the nucleotide sequence according to the preference of an escherichia coli codon to finally obtain the nucleotide sequence SEQ ID NO.2 of the epitope connected in series;
secondly, constructing a recombinant prokaryotic expression plasmid PET28a-ZSD, wherein the restriction enzyme sites are BamH1 and Xho1, introducing the recombinant expression plasmid into E.coli competent cells BL21 by a cold-hot alternation method, and carrying out cloning identification through a colony RT-RCR to obtain the recombinant epitope prokaryotic plasmid.
5. The recombinant epitope prokaryotic plasmid according to claim 4, characterized in that: the intracellular peptide segment is a signal peptide segment and a transmembrane peptide segment.
6. Method for the preparation of a streptococcus suis recombinant ZSD subunit vaccine using a recombinant epitope prokaryotic plasmid according to any one of claims 3 to 5, characterized in that: the method comprises the following steps:
and (2) inoculating the recombinant epitope prokaryotic plasmid into Kan/LB culture solution in a ratio of 1:100, performing induction expression by IPTG, performing vertical electrophoresis by 12% SDS-PAGE, performing Western Blot verification to determine correct protein expression, and purifying by a His nickel column to obtain the ZSD protein, thereby obtaining the recombinant subunit vaccine of the streptococcus suis.
7. Use of a streptococcus suis recombinant ZSD recombinant subunit vaccine according to claim 1 or 2 for the preparation of a vaccine.
8. The use of the recombinant ZSD subunit vaccine of streptococcus suis as claimed in claim 1 or 2 as a genetically engineered vaccine capable of preventing multiple strains of streptococcus suis in animal husbandry.
9. Use of the recombinant ZSD subunit vaccine of streptococcus suis according to claim 1 or 2 for the construction of a streptococcus suis epitope predictive vaccine capable of preventing against multiple strains of streptococcus suis.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202011172487.3A CN112409495A (en) | 2020-10-28 | 2020-10-28 | Streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202011172487.3A CN112409495A (en) | 2020-10-28 | 2020-10-28 | Streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN112409495A true CN112409495A (en) | 2021-02-26 |
Family
ID=74840814
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202011172487.3A Pending CN112409495A (en) | 2020-10-28 | 2020-10-28 | Streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN112409495A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023273829A1 (en) * | 2021-07-02 | 2023-01-05 | 江苏省农业科学院 | Vaccine against streptococcus suis disease |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004018683A1 (en) * | 2002-08-12 | 2004-03-04 | Akzo Nobel N.V. | Streptococcus uberis protein, nucleic acid sequence encoding the same and its use in a mastitis vaccine |
| CN109180822A (en) * | 2018-11-14 | 2019-01-11 | 上海交通大学 | A kind of Streptococcus suis B cell Dominant Epitopes series connection vaccine and preparation method thereof |
| CN109678968A (en) * | 2018-12-20 | 2019-04-26 | 武汉科前生物股份有限公司 | Mycoplasma hyopneumoniae subunit vaccine and the preparation method and application thereof |
-
2020
- 2020-10-28 CN CN202011172487.3A patent/CN112409495A/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004018683A1 (en) * | 2002-08-12 | 2004-03-04 | Akzo Nobel N.V. | Streptococcus uberis protein, nucleic acid sequence encoding the same and its use in a mastitis vaccine |
| CN109180822A (en) * | 2018-11-14 | 2019-01-11 | 上海交通大学 | A kind of Streptococcus suis B cell Dominant Epitopes series connection vaccine and preparation method thereof |
| CN109678968A (en) * | 2018-12-20 | 2019-04-26 | 武汉科前生物股份有限公司 | Mycoplasma hyopneumoniae subunit vaccine and the preparation method and application thereof |
Non-Patent Citations (4)
| Title |
|---|
| 刘祥: "猪链球菌Lmb、Sao、ZnuA蛋白的抗原表位、二级结构分析及重组表位疫苗分子的设计", 《生物技术》 * |
| 刘祥: "猪链球菌Lmb、Sao、ZnuA蛋白的抗原表位、二级结构分析及重组表位疫苗分子的设计", 《生物技术》, no. 02, 30 April 2016 (2016-04-30), pages 1 * |
| 张海燕等: "猪链球菌毒力因子研究新进展", 《芜湖职业技术学院学报》 * |
| 张海燕等: "猪链球菌毒力因子研究新进展", 《芜湖职业技术学院学报》, no. 03, 31 December 2018 (2018-12-31), pages 37 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023273829A1 (en) * | 2021-07-02 | 2023-01-05 | 江苏省农业科学院 | Vaccine against streptococcus suis disease |
| US11957743B2 (en) | 2021-07-02 | 2024-04-16 | Jiangsu Academy Of Agricultural Sciences | Streptococcus suis (S. suis) vaccine |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7038012B1 (en) | Enrichment process for H. pylori neutrophil activating protein (NAP) utilizing metal chelate chromatography | |
| JPH07508649A (en) | Mycobacterial membrane-associated immunogens | |
| CN108586618B (en) | Preparation and application of porcine epidemic diarrhea subunit vaccine | |
| CN110684116B (en) | Mycobacterium tuberculosis EEC fusion protein, preparation method and application thereof | |
| CN113956362B (en) | Recombinant feline parvovirus VP2 protein antigen and application thereof in antibody diagnosis and vaccine preparation | |
| CN109180822B (en) | Streptococcus suis B cell dominant epitope tandem vaccine and preparation method thereof | |
| CN107056898A (en) | 3 type of carp herpesviral, 1301 plants of ORF136 DNA recombinant expressions albumen, antibody and its application | |
| CN110642927B (en) | Application of protein in preparation of medicine for preventing cryptococcus pyogenes infection | |
| CN111856006A (en) | Application of mycoplasma bovis secretory protein MbovP274 | |
| CN113203854B (en) | Indirect ELISA kit for detecting cat coronavirus antibody | |
| Frey et al. | Genetic and serological analysis of the immunogenic 67-kDa lipoprotein of Mycoplasma sp. bovine group 7 | |
| CN112409495A (en) | Streptococcus suis recombinant ZSD recombinant subunit vaccine, recombinant epitope prokaryotic plasmid, preparation and application | |
| CN105734001A (en) | O antigen carbohydrate chain elongation salmonella paratyphi A and use thereof | |
| CN116478302A (en) | Variant pseudorabies virus gBgCgD epitope concatemer fusion protein and application thereof | |
| CN104862331B (en) | A kind of method of solubility expression Rhodococcus equi Disease-causing gene VapA albumen | |
| CN110257405A (en) | Mycoplasma bovis alcohol dehydrogenase gene and its coding albumen and application | |
| CN116474081A (en) | Acinetobacter baumannii vaccine and preparation method thereof | |
| Yousefi et al. | Cloning and molecular characterization of Omp31 gene from Brucella melitensis Rev 1 strain | |
| CN113512098B (en) | Indirect ELISA (enzyme-Linked immuno sorbent assay) method for identifying swine fever virus and bovine viral diarrhea virus serum antibodies and application thereof | |
| Henrich et al. | Repetitive elements of the Mycoplasma hominis adhesin p50 can be differentiated by monoclonal antibodies | |
| Vemulapalli et al. | Cloning and molecular analysis of genes encoding two immunodominant antigensofEhrlichia risticii | |
| Kovach et al. | Cloning and nucleotide sequence analysis of aBrucella abortusgene encoding an 18 kDa immunoreactive protein | |
| Perrig et al. | Assessment of the potential utility of different regions of Streptococcus uberis adhesion molecule (SUAM) for mastitis subunit vaccine development | |
| CN114525287A (en) | Toxic Eimeria tenella SAG20 antigen subunit vaccine and preparation method and application thereof | |
| CN112159480A (en) | Chicken infectious bursal disease virus multi-antigen epitope protein and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20210226 |
|
| RJ01 | Rejection of invention patent application after publication |