CN111778169A - Method for improving in vitro protein synthesis efficiency - Google Patents
Method for improving in vitro protein synthesis efficiency Download PDFInfo
- Publication number
- CN111778169A CN111778169A CN202010673244.1A CN202010673244A CN111778169A CN 111778169 A CN111778169 A CN 111778169A CN 202010673244 A CN202010673244 A CN 202010673244A CN 111778169 A CN111778169 A CN 111778169A
- Authority
- CN
- China
- Prior art keywords
- glu
- lys
- ala
- ser
- pro
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 230000014616 translation Effects 0.000 title claims abstract description 176
- 238000000338 in vitro Methods 0.000 title claims abstract description 122
- 238000001243 protein synthesis Methods 0.000 title claims abstract description 114
- 238000000034 method Methods 0.000 title claims abstract description 42
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 132
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 79
- 230000014509 gene expression Effects 0.000 claims abstract description 72
- 210000004027 cell Anatomy 0.000 claims abstract description 70
- 230000000694 effects Effects 0.000 claims abstract description 61
- 101710163270 Nuclease Proteins 0.000 claims abstract description 49
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 47
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 47
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 40
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 40
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 40
- 210000005253 yeast cell Anatomy 0.000 claims abstract description 39
- 239000000284 extract Substances 0.000 claims abstract description 36
- 101710137500 T7 RNA polymerase Proteins 0.000 claims abstract description 12
- 238000010353 genetic engineering Methods 0.000 claims abstract 8
- 150000001413 amino acids Chemical group 0.000 claims description 50
- 230000015572 biosynthetic process Effects 0.000 claims description 49
- 241001138401 Kluyveromyces lactis Species 0.000 claims description 47
- DRBBFCLWYRJSJZ-UHFFFAOYSA-N N-phosphocreatine Chemical compound OC(=O)CN(C)C(=N)NP(O)(O)=O DRBBFCLWYRJSJZ-UHFFFAOYSA-N 0.000 claims description 34
- 101710091919 Eukaryotic translation initiation factor 4G Proteins 0.000 claims description 24
- 238000003786 synthesis reaction Methods 0.000 claims description 23
- 239000002773 nucleotide Substances 0.000 claims description 22
- 125000003729 nucleotide group Chemical group 0.000 claims description 22
- 229920001223 polyethylene glycol Polymers 0.000 claims description 16
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 16
- 239000000758 substrate Substances 0.000 claims description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 16
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 claims description 15
- 239000002202 Polyethylene glycol Substances 0.000 claims description 15
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 claims description 14
- 229950007002 phosphocreatine Drugs 0.000 claims description 12
- 108091029865 Exogenous DNA Proteins 0.000 claims description 11
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical group NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 claims description 9
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 claims description 9
- 229920001184 polypeptide Polymers 0.000 claims description 9
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 9
- 230000002194 synthesizing effect Effects 0.000 claims description 9
- 229930006000 Sucrose Natural products 0.000 claims description 8
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 8
- 150000001875 compounds Chemical class 0.000 claims description 8
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 claims description 8
- 239000005720 sucrose Substances 0.000 claims description 8
- 102000053602 DNA Human genes 0.000 claims description 7
- BLIMFWGRQKRCGT-YUMQZZPRSA-N Ala-Gly-Lys Chemical compound C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN BLIMFWGRQKRCGT-YUMQZZPRSA-N 0.000 claims description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 6
- 239000012634 fragment Substances 0.000 claims description 6
- 230000001965 increasing effect Effects 0.000 claims description 5
- 230000008929 regeneration Effects 0.000 claims description 5
- 238000011069 regeneration method Methods 0.000 claims description 5
- 108091026890 Coding region Proteins 0.000 claims description 4
- JLVVSXFLKOJNIY-UHFFFAOYSA-N Magnesium ion Chemical compound [Mg+2] JLVVSXFLKOJNIY-UHFFFAOYSA-N 0.000 claims description 4
- 150000003278 haem Chemical class 0.000 claims description 4
- 229910001425 magnesium ion Inorganic materials 0.000 claims description 4
- 229910001414 potassium ion Inorganic materials 0.000 claims description 4
- 229940063673 spermidine Drugs 0.000 claims description 4
- 108010075254 C-Peptide Proteins 0.000 claims description 3
- 239000003125 aqueous solvent Substances 0.000 claims description 3
- 108010038633 aspartylglutamate Proteins 0.000 claims description 3
- 108010078144 glutaminyl-glycine Proteins 0.000 claims description 3
- 239000002904 solvent Substances 0.000 claims description 3
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 claims description 2
- ZZJVYSAQQMDIRD-UWVGGRQHSA-N Gly-Pro-His Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O ZZJVYSAQQMDIRD-UWVGGRQHSA-N 0.000 claims description 2
- 230000006819 RNA synthesis Effects 0.000 claims description 2
- BDMWLJLPPUCLNV-XGEHTFHBSA-N Ser-Thr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O BDMWLJLPPUCLNV-XGEHTFHBSA-N 0.000 claims description 2
- WLDUCKSCDRIVLJ-NUMRIWBASA-N Thr-Gln-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O WLDUCKSCDRIVLJ-NUMRIWBASA-N 0.000 claims description 2
- 239000006172 buffering agent Substances 0.000 claims description 2
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 claims description 2
- 108010040030 histidinoalanine Proteins 0.000 claims description 2
- IKDOHQHEFPPGJG-FXQIFTODSA-N Gln-Asp-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O IKDOHQHEFPPGJG-FXQIFTODSA-N 0.000 claims 1
- NTBOEZICHOSJEE-YUMQZZPRSA-N Gly-Lys-Ser Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O NTBOEZICHOSJEE-YUMQZZPRSA-N 0.000 claims 1
- PEYNRYREGPAOAK-LSJOCFKGSA-N Pro-His-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C([O-])=O)NC(=O)[C@H]1[NH2+]CCC1)C1=CN=CN1 PEYNRYREGPAOAK-LSJOCFKGSA-N 0.000 claims 1
- AKHDFZHUPGVFEJ-YEPSODPASA-N Thr-Val-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O AKHDFZHUPGVFEJ-YEPSODPASA-N 0.000 claims 1
- XEYUMGGWQCIWAR-XVKPBYJWSA-N Val-Gln-Gly Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)O)N XEYUMGGWQCIWAR-XVKPBYJWSA-N 0.000 claims 1
- 108020004414 DNA Proteins 0.000 description 80
- 235000018102 proteins Nutrition 0.000 description 69
- 238000013519 translation Methods 0.000 description 49
- 239000013612 plasmid Substances 0.000 description 40
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 39
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 39
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 32
- 229940024606 amino acid Drugs 0.000 description 29
- 235000001014 amino acid Nutrition 0.000 description 29
- 239000000047 product Substances 0.000 description 26
- 108060001084 Luciferase Proteins 0.000 description 25
- 239000005089 Luciferase Substances 0.000 description 25
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 25
- 239000007788 liquid Substances 0.000 description 23
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 21
- 239000000203 mixture Substances 0.000 description 21
- 239000002777 nucleoside Substances 0.000 description 20
- 230000014621 translational initiation Effects 0.000 description 20
- 235000011178 triphosphate Nutrition 0.000 description 20
- 239000001226 triphosphate Substances 0.000 description 20
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 19
- 238000003752 polymerase chain reaction Methods 0.000 description 19
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 18
- 230000008569 process Effects 0.000 description 18
- 238000005119 centrifugation Methods 0.000 description 17
- 102000004190 Enzymes Human genes 0.000 description 16
- 108090000790 Enzymes Proteins 0.000 description 16
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 16
- 238000004458 analytical method Methods 0.000 description 16
- 229940088598 enzyme Drugs 0.000 description 16
- 230000035897 transcription Effects 0.000 description 16
- 238000013518 transcription Methods 0.000 description 16
- 230000003321 amplification Effects 0.000 description 15
- 238000003199 nucleic acid amplification method Methods 0.000 description 15
- 108060002716 Exonuclease Proteins 0.000 description 14
- 241000235649 Kluyveromyces Species 0.000 description 14
- 230000033228 biological regulation Effects 0.000 description 14
- 102000013165 exonuclease Human genes 0.000 description 14
- 239000012880 LB liquid culture medium Substances 0.000 description 13
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 13
- 239000007787 solid Substances 0.000 description 13
- ZKHQWZAMYRWXGA-KQYNXXCUSA-J ATP(4-) Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-J 0.000 description 12
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 12
- 108010044843 Peptide Initiation Factors Proteins 0.000 description 12
- 102000005877 Peptide Initiation Factors Human genes 0.000 description 12
- 108010049041 glutamylalanine Proteins 0.000 description 12
- 238000001727 in vivo Methods 0.000 description 12
- 239000002609 medium Substances 0.000 description 12
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 12
- 108020005004 Guide RNA Proteins 0.000 description 11
- 108010005233 alanylglutamic acid Proteins 0.000 description 11
- 210000000349 chromosome Anatomy 0.000 description 11
- 150000003833 nucleoside derivatives Chemical class 0.000 description 11
- 108091033409 CRISPR Proteins 0.000 description 10
- 108010042407 Endonucleases Proteins 0.000 description 10
- PKVWNYGXMNWJSI-CIUDSAMLSA-N Gln-Gln-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O PKVWNYGXMNWJSI-CIUDSAMLSA-N 0.000 description 10
- 238000012408 PCR amplification Methods 0.000 description 10
- 108010083644 Ribonucleases Proteins 0.000 description 10
- 102000006382 Ribonucleases Human genes 0.000 description 10
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 10
- 239000000872 buffer Substances 0.000 description 10
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 10
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 10
- 108010017391 lysylvaline Proteins 0.000 description 10
- 230000004048 modification Effects 0.000 description 10
- 238000012986 modification Methods 0.000 description 10
- -1 nucleoside monophosphates Chemical class 0.000 description 10
- 238000012163 sequencing technique Methods 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 238000005406 washing Methods 0.000 description 10
- BFEZQZKEPRKKHV-SRVKXCTJSA-N Glu-Pro-Lys Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CCC(=O)O)N)C(=O)N[C@@H](CCCCN)C(=O)O BFEZQZKEPRKKHV-SRVKXCTJSA-N 0.000 description 9
- 239000011248 coating agent Substances 0.000 description 9
- 238000000576 coating method Methods 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 108010034529 leucyl-lysine Proteins 0.000 description 9
- UEGPKNKPLBYCNK-UHFFFAOYSA-L magnesium acetate Chemical compound [Mg+2].CC([O-])=O.CC([O-])=O UEGPKNKPLBYCNK-UHFFFAOYSA-L 0.000 description 9
- 229940069446 magnesium acetate Drugs 0.000 description 9
- 235000011285 magnesium acetate Nutrition 0.000 description 9
- 239000011654 magnesium acetate Substances 0.000 description 9
- 235000011056 potassium acetate Nutrition 0.000 description 9
- 102100031780 Endonuclease Human genes 0.000 description 8
- 108090000331 Firefly luciferases Proteins 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 8
- XKMLYUALXHKNFT-UUOKFMHZSA-N Guanosine-5'-triphosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O XKMLYUALXHKNFT-UUOKFMHZSA-N 0.000 description 8
- QVTDVTONTRSQMF-WDCWCFNPSA-N Lys-Thr-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](N)CCCCN QVTDVTONTRSQMF-WDCWCFNPSA-N 0.000 description 8
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 8
- 240000000220 Panda oleosa Species 0.000 description 8
- 235000016496 Panda oleosa Nutrition 0.000 description 8
- UDQBCBUXAQIZAK-GLLZPBPUSA-N Thr-Glu-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UDQBCBUXAQIZAK-GLLZPBPUSA-N 0.000 description 8
- 230000009471 action Effects 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 8
- 210000003705 ribosome Anatomy 0.000 description 8
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 description 7
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 description 7
- 238000010354 CRISPR gene editing Methods 0.000 description 7
- 241000206602 Eukaryota Species 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 238000010276 construction Methods 0.000 description 7
- 238000013461 design Methods 0.000 description 7
- DBLXOVFQHHSKRC-UHFFFAOYSA-N ethanesulfonic acid;2-piperazin-1-ylethanol Chemical compound CCS(O)(=O)=O.OCCN1CCNCC1 DBLXOVFQHHSKRC-UHFFFAOYSA-N 0.000 description 7
- 239000001963 growth medium Substances 0.000 description 7
- 108010053725 prolylvaline Proteins 0.000 description 7
- 108010026333 seryl-proline Proteins 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 6
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 6
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 6
- 108010053770 Deoxyribonucleases Proteins 0.000 description 6
- 102000016911 Deoxyribonucleases Human genes 0.000 description 6
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 6
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 6
- MUSGDMDGNGXULI-DCAQKATOSA-N Glu-Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O MUSGDMDGNGXULI-DCAQKATOSA-N 0.000 description 6
- PHONAZGUEGIOEM-GLLZPBPUSA-N Glu-Glu-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PHONAZGUEGIOEM-GLLZPBPUSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108010065920 Insulin Lispro Proteins 0.000 description 6
- 241000880493 Leptailurus serval Species 0.000 description 6
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 6
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 6
- 229920002562 Polyethylene Glycol 3350 Polymers 0.000 description 6
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 6
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 6
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 description 6
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 6
- 230000000977 initiatory effect Effects 0.000 description 6
- 108010054155 lysyllysine Proteins 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 230000002103 transcriptional effect Effects 0.000 description 6
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 5
- UBAVPHLFRVPRCI-CRBCFSCISA-N 2-[[(e)-2-carboxyethenyl]amino]-n-methoxy-2-oxoethanimine oxide Chemical compound CO\[N+]([O-])=C\C(=O)N\C=C\C(O)=O UBAVPHLFRVPRCI-CRBCFSCISA-N 0.000 description 5
- 102000007469 Actins Human genes 0.000 description 5
- 108010085238 Actins Proteins 0.000 description 5
- 102000016938 Catalase Human genes 0.000 description 5
- 108010053835 Catalase Proteins 0.000 description 5
- 241000196324 Embryophyta Species 0.000 description 5
- 101710121765 Endo-1,4-beta-xylanase Proteins 0.000 description 5
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 5
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 5
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 5
- 108010073141 Hepatitis C virus glycoprotein E2 Proteins 0.000 description 5
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 108090001061 Insulin Proteins 0.000 description 5
- 102000004877 Insulin Human genes 0.000 description 5
- 108010078049 Interferon alpha-2 Proteins 0.000 description 5
- 102100040018 Interferon alpha-2 Human genes 0.000 description 5
- 102000003777 Interleukin-1 beta Human genes 0.000 description 5
- 108090000193 Interleukin-1 beta Proteins 0.000 description 5
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 5
- HGCNKOLVKRAVHD-UHFFFAOYSA-N L-Met-L-Phe Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 HGCNKOLVKRAVHD-UHFFFAOYSA-N 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- 102000016943 Muramidase Human genes 0.000 description 5
- 108010014251 Muramidase Proteins 0.000 description 5
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 5
- 108010071690 Prealbumin Proteins 0.000 description 5
- DWGFLKQSGRUQTI-IHRRRGAJSA-N Pro-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1 DWGFLKQSGRUQTI-IHRRRGAJSA-N 0.000 description 5
- 102000001253 Protein Kinase Human genes 0.000 description 5
- 102000007562 Serum Albumin Human genes 0.000 description 5
- 108010071390 Serum Albumin Proteins 0.000 description 5
- 102000009190 Transthyretin Human genes 0.000 description 5
- 102000003425 Tyrosinase Human genes 0.000 description 5
- 108060008724 Tyrosinase Proteins 0.000 description 5
- GBIUHAYJGWVNLN-UHFFFAOYSA-N Val-Ser-Pro Natural products CC(C)C(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O GBIUHAYJGWVNLN-UHFFFAOYSA-N 0.000 description 5
- 102000004139 alpha-Amylases Human genes 0.000 description 5
- 108090000637 alpha-Amylases Proteins 0.000 description 5
- 229940024171 alpha-amylase Drugs 0.000 description 5
- 108010047857 aspartylglycine Proteins 0.000 description 5
- 230000001851 biosynthetic effect Effects 0.000 description 5
- 230000015556 catabolic process Effects 0.000 description 5
- 239000013592 cell lysate Substances 0.000 description 5
- 229960002433 cysteine Drugs 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 229940104302 cytosine Drugs 0.000 description 5
- 238000006731 degradation reaction Methods 0.000 description 5
- 230000002708 enhancing effect Effects 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 5
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 5
- 108010077515 glycylproline Proteins 0.000 description 5
- 239000005090 green fluorescent protein Substances 0.000 description 5
- 229940125396 insulin Drugs 0.000 description 5
- 239000004325 lysozyme Substances 0.000 description 5
- 229960000274 lysozyme Drugs 0.000 description 5
- 235000010335 lysozyme Nutrition 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 108060006633 protein kinase Proteins 0.000 description 5
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 5
- 229940035893 uracil Drugs 0.000 description 5
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 5
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 4
- 101001082110 Acanthamoeba polyphaga mimivirus Eukaryotic translation initiation factor 4E homolog Proteins 0.000 description 4
- FJVAQLJNTSUQPY-CIUDSAMLSA-N Ala-Ala-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCCN FJVAQLJNTSUQPY-CIUDSAMLSA-N 0.000 description 4
- WKOBSJOZRJJVRZ-FXQIFTODSA-N Ala-Glu-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WKOBSJOZRJJVRZ-FXQIFTODSA-N 0.000 description 4
- REWSWYIDQIELBE-FXQIFTODSA-N Ala-Val-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O REWSWYIDQIELBE-FXQIFTODSA-N 0.000 description 4
- QAODJPUKWNNNRP-DCAQKATOSA-N Arg-Glu-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O QAODJPUKWNNNRP-DCAQKATOSA-N 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 4
- RCFGLXMZDYNRSC-CIUDSAMLSA-N Asn-Lys-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O RCFGLXMZDYNRSC-CIUDSAMLSA-N 0.000 description 4
- LJRPYAZQQWHEEV-FXQIFTODSA-N Asp-Gln-Gln Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O LJRPYAZQQWHEEV-FXQIFTODSA-N 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 4
- PCDQPRRSZKQHHS-CCXZUQQUSA-N Cytarabine Triphosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 PCDQPRRSZKQHHS-CCXZUQQUSA-N 0.000 description 4
- 101001082109 Danio rerio Eukaryotic translation initiation factor 4E-1B Proteins 0.000 description 4
- OGMQXTXGLDNBSS-FXQIFTODSA-N Glu-Ala-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O OGMQXTXGLDNBSS-FXQIFTODSA-N 0.000 description 4
- NCWOMXABNYEPLY-NRPADANISA-N Glu-Ala-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O NCWOMXABNYEPLY-NRPADANISA-N 0.000 description 4
- PVBBEKPHARMPHX-DCAQKATOSA-N Glu-Gln-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCC(O)=O PVBBEKPHARMPHX-DCAQKATOSA-N 0.000 description 4
- KUTPGXNAAOQSPD-LPEHRKFASA-N Glu-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)N)C(=O)O KUTPGXNAAOQSPD-LPEHRKFASA-N 0.000 description 4
- QOXDAWODGSIDDI-GUBZILKMSA-N Glu-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)N QOXDAWODGSIDDI-GUBZILKMSA-N 0.000 description 4
- CAQXJMUDOLSBPF-SUSMZKCASA-N Glu-Thr-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAQXJMUDOLSBPF-SUSMZKCASA-N 0.000 description 4
- KKBWDNZXYLGJEY-UHFFFAOYSA-N Gly-Arg-Pro Natural products NCC(=O)NC(CCNC(=N)N)C(=O)N1CCCC1C(=O)O KKBWDNZXYLGJEY-UHFFFAOYSA-N 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- DGLAHESNTJWGDO-SRVKXCTJSA-N His-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N DGLAHESNTJWGDO-SRVKXCTJSA-N 0.000 description 4
- COWHUQXTSYTKQC-RWRJDSDZSA-N Ile-Thr-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N COWHUQXTSYTKQC-RWRJDSDZSA-N 0.000 description 4
- 235000014663 Kluyveromyces fragilis Nutrition 0.000 description 4
- 241000235058 Komagataella pastoris Species 0.000 description 4
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 4
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- VQHUBNVKFFLWRP-ULQDDVLXSA-N Leu-Tyr-Val Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C(C)C)C(O)=O)CC1=CC=C(O)C=C1 VQHUBNVKFFLWRP-ULQDDVLXSA-N 0.000 description 4
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 4
- PBIPLDMFHAICIP-DCAQKATOSA-N Lys-Glu-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PBIPLDMFHAICIP-DCAQKATOSA-N 0.000 description 4
- JMNRXRPBHFGXQX-GUBZILKMSA-N Lys-Ser-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O JMNRXRPBHFGXQX-GUBZILKMSA-N 0.000 description 4
- RMKJOQSYLQQRFN-KKUMJFAQSA-N Lys-Tyr-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O RMKJOQSYLQQRFN-KKUMJFAQSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- CDQCFGOQNYOICK-IHRRRGAJSA-N Phe-Glu-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 CDQCFGOQNYOICK-IHRRRGAJSA-N 0.000 description 4
- WEMYTDDMDBLPMI-DKIMLUQUSA-N Phe-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N WEMYTDDMDBLPMI-DKIMLUQUSA-N 0.000 description 4
- 229920002594 Polyethylene Glycol 8000 Polymers 0.000 description 4
- OOLOTUZJUBOMAX-GUBZILKMSA-N Pro-Ala-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O OOLOTUZJUBOMAX-GUBZILKMSA-N 0.000 description 4
- FRKBNXCFJBPJOL-GUBZILKMSA-N Pro-Glu-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O FRKBNXCFJBPJOL-GUBZILKMSA-N 0.000 description 4
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 4
- 235000018368 Saccharomyces fragilis Nutrition 0.000 description 4
- PTWIYDNFWPXQSD-GARJFASQSA-N Ser-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)N)C(=O)O PTWIYDNFWPXQSD-GARJFASQSA-N 0.000 description 4
- ADJDNJCSPNFFPI-FXQIFTODSA-N Ser-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO ADJDNJCSPNFFPI-FXQIFTODSA-N 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 4
- KRDSCBLRHORMRK-JXUBOQSCSA-N Thr-Lys-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O KRDSCBLRHORMRK-JXUBOQSCSA-N 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- MBFJIHUHHCJBSN-AVGNSLFASA-N Tyr-Asn-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MBFJIHUHHCJBSN-AVGNSLFASA-N 0.000 description 4
- DEGUERSKQBRZMZ-FXQIFTODSA-N Val-Ser-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DEGUERSKQBRZMZ-FXQIFTODSA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 229960003767 alanine Drugs 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 108010047495 alanylglycine Proteins 0.000 description 4
- 108010087924 alanylproline Proteins 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 229960003121 arginine Drugs 0.000 description 4
- 235000009697 arginine Nutrition 0.000 description 4
- 108010001271 arginyl-glutamyl-arginine Proteins 0.000 description 4
- 229960001230 asparagine Drugs 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 229960005261 aspartic acid Drugs 0.000 description 4
- 235000003704 aspartic acid Nutrition 0.000 description 4
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 4
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 4
- 239000000287 crude extract Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 238000010362 genome editing Methods 0.000 description 4
- 235000013922 glutamic acid Nutrition 0.000 description 4
- 239000004220 glutamic acid Substances 0.000 description 4
- 229960002989 glutamic acid Drugs 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 229960002743 glutamine Drugs 0.000 description 4
- 229960002449 glycine Drugs 0.000 description 4
- 108010050848 glycylleucine Proteins 0.000 description 4
- 108010015792 glycyllysine Proteins 0.000 description 4
- 108010081551 glycylphenylalanine Proteins 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 229960002885 histidine Drugs 0.000 description 4
- 235000014304 histidine Nutrition 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- 229940031154 kluyveromyces marxianus Drugs 0.000 description 4
- 229960003136 leucine Drugs 0.000 description 4
- 238000009630 liquid culture Methods 0.000 description 4
- 235000018977 lysine Nutrition 0.000 description 4
- 229960003646 lysine Drugs 0.000 description 4
- 108010064235 lysylglycine Proteins 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 229930182817 methionine Natural products 0.000 description 4
- 235000006109 methionine Nutrition 0.000 description 4
- 229960004452 methionine Drugs 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 229960005190 phenylalanine Drugs 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 229960002429 proline Drugs 0.000 description 4
- 230000007115 recruitment Effects 0.000 description 4
- 238000000926 separation method Methods 0.000 description 4
- 229960001153 serine Drugs 0.000 description 4
- 235000004400 serine Nutrition 0.000 description 4
- 108010048818 seryl-histidine Proteins 0.000 description 4
- 239000008223 sterile water Substances 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 235000008521 threonine Nutrition 0.000 description 4
- 229960002898 threonine Drugs 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 229960004799 tryptophan Drugs 0.000 description 4
- 229960004441 tyrosine Drugs 0.000 description 4
- 235000002374 tyrosine Nutrition 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 229960004295 valine Drugs 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 108010073969 valyllysine Proteins 0.000 description 4
- HQJKCXHQNUCKMY-GHCJXIJMSA-N Ala-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](C)N HQJKCXHQNUCKMY-GHCJXIJMSA-N 0.000 description 3
- CCDFBRZVTDDJNM-GUBZILKMSA-N Ala-Leu-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O CCDFBRZVTDDJNM-GUBZILKMSA-N 0.000 description 3
- PGNNQOJOEGFAOR-KWQFWETISA-N Ala-Tyr-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=C(O)C=C1 PGNNQOJOEGFAOR-KWQFWETISA-N 0.000 description 3
- ACRYGQFHAQHDSF-ZLUOBGJFSA-N Asn-Asn-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ACRYGQFHAQHDSF-ZLUOBGJFSA-N 0.000 description 3
- OLVIPTLKNSAYRJ-YUMQZZPRSA-N Asn-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N OLVIPTLKNSAYRJ-YUMQZZPRSA-N 0.000 description 3
- OOXUBGLNDRGOKT-FXQIFTODSA-N Asn-Ser-Arg Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O OOXUBGLNDRGOKT-FXQIFTODSA-N 0.000 description 3
- GHODABZPVZMWCE-FXQIFTODSA-N Asp-Glu-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O GHODABZPVZMWCE-FXQIFTODSA-N 0.000 description 3
- PAYPSKIBMDHZPI-CIUDSAMLSA-N Asp-Leu-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O PAYPSKIBMDHZPI-CIUDSAMLSA-N 0.000 description 3
- LTCKTLYKRMCFOC-KKUMJFAQSA-N Asp-Phe-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O LTCKTLYKRMCFOC-KKUMJFAQSA-N 0.000 description 3
- JSNWZMFSLIWAHS-HJGDQZAQSA-N Asp-Thr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O JSNWZMFSLIWAHS-HJGDQZAQSA-N 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010014863 Eukaryotic Initiation Factors Proteins 0.000 description 3
- ZOXBSICWUDAOHX-GUBZILKMSA-N Glu-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCC(O)=O ZOXBSICWUDAOHX-GUBZILKMSA-N 0.000 description 3
- CGOHAEBMDSEKFB-FXQIFTODSA-N Glu-Glu-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O CGOHAEBMDSEKFB-FXQIFTODSA-N 0.000 description 3
- QJCKNLPMTPXXEM-AUTRQRHGSA-N Glu-Glu-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O QJCKNLPMTPXXEM-AUTRQRHGSA-N 0.000 description 3
- IVGJYOOGJLFKQE-AVGNSLFASA-N Glu-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N IVGJYOOGJLFKQE-AVGNSLFASA-N 0.000 description 3
- DTLLNDVORUEOTM-WDCWCFNPSA-N Glu-Thr-Lys Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O DTLLNDVORUEOTM-WDCWCFNPSA-N 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- DLEBSGAVWRPTIX-PEDHHIEDSA-N Ile-Val-Ile Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)[C@@H](C)CC DLEBSGAVWRPTIX-PEDHHIEDSA-N 0.000 description 3
- WIDZHJTYKYBLSR-DCAQKATOSA-N Leu-Glu-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WIDZHJTYKYBLSR-DCAQKATOSA-N 0.000 description 3
- HYIFFZAQXPUEAU-QWRGUYRKSA-N Leu-Gly-Leu Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(C)C HYIFFZAQXPUEAU-QWRGUYRKSA-N 0.000 description 3
- HVHRPWQEQHIQJF-AVGNSLFASA-N Leu-Lys-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O HVHRPWQEQHIQJF-AVGNSLFASA-N 0.000 description 3
- OVZLLFONXILPDZ-VOAKCMCISA-N Leu-Lys-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OVZLLFONXILPDZ-VOAKCMCISA-N 0.000 description 3
- JHNOXVASMSXSNB-WEDXCCLWSA-N Lys-Thr-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O JHNOXVASMSXSNB-WEDXCCLWSA-N 0.000 description 3
- CAODKDAPYGUMLK-FXQIFTODSA-N Met-Asn-Ser Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O CAODKDAPYGUMLK-FXQIFTODSA-N 0.000 description 3
- PESQCPHRXOFIPX-UHFFFAOYSA-N N-L-methionyl-L-tyrosine Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 PESQCPHRXOFIPX-UHFFFAOYSA-N 0.000 description 3
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 108010010677 Phosphodiesterase I Proteins 0.000 description 3
- 229920002560 Polyethylene Glycol 3000 Polymers 0.000 description 3
- 101100273253 Rhizopus niveus RNAP gene Proteins 0.000 description 3
- NLQUOHDCLSFABG-GUBZILKMSA-N Ser-Arg-Arg Chemical compound NC(N)=NCCC[C@H](NC(=O)[C@H](CO)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O NLQUOHDCLSFABG-GUBZILKMSA-N 0.000 description 3
- UOLGINIHBRIECN-FXQIFTODSA-N Ser-Glu-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UOLGINIHBRIECN-FXQIFTODSA-N 0.000 description 3
- XQJCEKXQUJQNNK-ZLUOBGJFSA-N Ser-Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O XQJCEKXQUJQNNK-ZLUOBGJFSA-N 0.000 description 3
- 108010052670 arginyl-glutamyl-glutamic acid Proteins 0.000 description 3
- 108010062796 arginyllysine Proteins 0.000 description 3
- 108010092854 aspartyllysine Proteins 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 108010037850 glycylvaline Proteins 0.000 description 3
- 108010025306 histidylleucine Proteins 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 108010068488 methionylphenylalanine Proteins 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 108010051242 phenylalanylserine Proteins 0.000 description 3
- 108010090894 prolylleucine Proteins 0.000 description 3
- 239000002994 raw material Substances 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 108010068698 spleen exonuclease Proteins 0.000 description 3
- 108010003137 tyrosyltyrosine Proteins 0.000 description 3
- PGAVKCOVUIYSFO-UHFFFAOYSA-N uridine-triphosphate Natural products OC1C(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)OC1N1C(=O)NC(=O)C=C1 PGAVKCOVUIYSFO-UHFFFAOYSA-N 0.000 description 3
- 108010015385 valyl-prolyl-proline Proteins 0.000 description 3
- BRPMXFSTKXXNHF-IUCAKERBSA-N (2s)-1-[2-[[(2s)-pyrrolidine-2-carbonyl]amino]acetyl]pyrrolidine-2-carboxylic acid Chemical compound OC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H]1NCCC1 BRPMXFSTKXXNHF-IUCAKERBSA-N 0.000 description 2
- NTUPOKHATNSWCY-PMPSAXMXSA-N (2s)-2-[[(2s)-1-[(2r)-2-amino-3-phenylpropanoyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoic acid Chemical compound C([C@@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)C1=CC=CC=C1 NTUPOKHATNSWCY-PMPSAXMXSA-N 0.000 description 2
- 101710159080 Aconitate hydratase A Proteins 0.000 description 2
- 101710159078 Aconitate hydratase B Proteins 0.000 description 2
- RLMISHABBKUNFO-WHFBIAKZSA-N Ala-Ala-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O RLMISHABBKUNFO-WHFBIAKZSA-N 0.000 description 2
- XEXJJJRVTFGWIC-FXQIFTODSA-N Ala-Asn-Arg Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N XEXJJJRVTFGWIC-FXQIFTODSA-N 0.000 description 2
- SHYYAQLDNVHPFT-DLOVCJGASA-N Ala-Asn-Phe Chemical compound C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SHYYAQLDNVHPFT-DLOVCJGASA-N 0.000 description 2
- RXTBLQVXNIECFP-FXQIFTODSA-N Ala-Gln-Gln Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O RXTBLQVXNIECFP-FXQIFTODSA-N 0.000 description 2
- BLGHHPHXVJWCNK-GUBZILKMSA-N Ala-Gln-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O BLGHHPHXVJWCNK-GUBZILKMSA-N 0.000 description 2
- UHMQKOBNPRAZGB-CIUDSAMLSA-N Ala-Glu-Met Chemical compound C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCSC)C(=O)O)N UHMQKOBNPRAZGB-CIUDSAMLSA-N 0.000 description 2
- LMFXXZPPZDCPTA-ZKWXMUAHSA-N Ala-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N LMFXXZPPZDCPTA-ZKWXMUAHSA-N 0.000 description 2
- MQIGTEQXYCRLGK-BQBZGAKWSA-N Ala-Gly-Pro Chemical compound C[C@H](N)C(=O)NCC(=O)N1CCC[C@H]1C(O)=O MQIGTEQXYCRLGK-BQBZGAKWSA-N 0.000 description 2
- NBTGEURICRTMGL-WHFBIAKZSA-N Ala-Gly-Ser Chemical compound C[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O NBTGEURICRTMGL-WHFBIAKZSA-N 0.000 description 2
- VCSABYLVNWQYQE-UHFFFAOYSA-N Ala-Lys-Lys Natural products NCCCCC(NC(=O)C(N)C)C(=O)NC(CCCCN)C(O)=O VCSABYLVNWQYQE-UHFFFAOYSA-N 0.000 description 2
- CHFFHQUVXHEGBY-GARJFASQSA-N Ala-Lys-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)O)N CHFFHQUVXHEGBY-GARJFASQSA-N 0.000 description 2
- OINVDEKBKBCPLX-JXUBOQSCSA-N Ala-Lys-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OINVDEKBKBCPLX-JXUBOQSCSA-N 0.000 description 2
- MDNAVFBZPROEHO-DCAQKATOSA-N Ala-Lys-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O MDNAVFBZPROEHO-DCAQKATOSA-N 0.000 description 2
- MDNAVFBZPROEHO-UHFFFAOYSA-N Ala-Lys-Val Natural products CC(C)C(C(O)=O)NC(=O)C(NC(=O)C(C)N)CCCCN MDNAVFBZPROEHO-UHFFFAOYSA-N 0.000 description 2
- IPZQNYYAYVRKKK-FXQIFTODSA-N Ala-Pro-Ala Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IPZQNYYAYVRKKK-FXQIFTODSA-N 0.000 description 2
- ADSGHMXEAZJJNF-DCAQKATOSA-N Ala-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N ADSGHMXEAZJJNF-DCAQKATOSA-N 0.000 description 2
- XWFWAXPOLRTDFZ-FXQIFTODSA-N Ala-Pro-Ser Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O XWFWAXPOLRTDFZ-FXQIFTODSA-N 0.000 description 2
- VJVQKGYHIZPSNS-FXQIFTODSA-N Ala-Ser-Arg Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N VJVQKGYHIZPSNS-FXQIFTODSA-N 0.000 description 2
- NCQMBSJGJMYKCK-ZLUOBGJFSA-N Ala-Ser-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O NCQMBSJGJMYKCK-ZLUOBGJFSA-N 0.000 description 2
- LSMDIAAALJJLRO-XQXXSGGOSA-N Ala-Thr-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O LSMDIAAALJJLRO-XQXXSGGOSA-N 0.000 description 2
- BHFOJPDOQPWJRN-XDTLVQLUSA-N Ala-Tyr-Gln Chemical compound C[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(O)=O BHFOJPDOQPWJRN-XDTLVQLUSA-N 0.000 description 2
- BGGAIXWIZCIFSG-XDTLVQLUSA-N Ala-Tyr-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O BGGAIXWIZCIFSG-XDTLVQLUSA-N 0.000 description 2
- NLYYHIKRBRMAJV-AEJSXWLSSA-N Ala-Val-Pro Chemical compound C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N NLYYHIKRBRMAJV-AEJSXWLSSA-N 0.000 description 2
- GXCSUJQOECMKPV-CIUDSAMLSA-N Arg-Ala-Gln Chemical compound C[C@H](NC(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O GXCSUJQOECMKPV-CIUDSAMLSA-N 0.000 description 2
- IASNWHAGGYTEKX-IUCAKERBSA-N Arg-Arg-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(O)=O IASNWHAGGYTEKX-IUCAKERBSA-N 0.000 description 2
- HJVGMOYJDDXLMI-AVGNSLFASA-N Arg-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCCNC(N)=N HJVGMOYJDDXLMI-AVGNSLFASA-N 0.000 description 2
- CPSHGRGUPZBMOK-CIUDSAMLSA-N Arg-Asn-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O CPSHGRGUPZBMOK-CIUDSAMLSA-N 0.000 description 2
- NONSEUUPKITYQT-BQBZGAKWSA-N Arg-Asn-Gly Chemical compound C(C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)NCC(=O)O)N)CN=C(N)N NONSEUUPKITYQT-BQBZGAKWSA-N 0.000 description 2
- QIWYWCYNUMJBTC-CIUDSAMLSA-N Arg-Cys-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(O)=O QIWYWCYNUMJBTC-CIUDSAMLSA-N 0.000 description 2
- CYXCAHZVPFREJD-LURJTMIESA-N Arg-Gly-Gly Chemical compound NC(=N)NCCC[C@H](N)C(=O)NCC(=O)NCC(O)=O CYXCAHZVPFREJD-LURJTMIESA-N 0.000 description 2
- YQGZIRIYGHNSQO-ZPFDUUQYSA-N Arg-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N YQGZIRIYGHNSQO-ZPFDUUQYSA-N 0.000 description 2
- LKDHUGLXOHYINY-XUXIUFHCSA-N Arg-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N LKDHUGLXOHYINY-XUXIUFHCSA-N 0.000 description 2
- OKKMBOSPBDASEP-CYDGBPFRSA-N Arg-Ile-Met Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(O)=O OKKMBOSPBDASEP-CYDGBPFRSA-N 0.000 description 2
- OTZMRMHZCMZOJZ-SRVKXCTJSA-N Arg-Leu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O OTZMRMHZCMZOJZ-SRVKXCTJSA-N 0.000 description 2
- AOHKLEBWKMKITA-IHRRRGAJSA-N Arg-Phe-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N AOHKLEBWKMKITA-IHRRRGAJSA-N 0.000 description 2
- FOQFHANLUJDQEE-GUBZILKMSA-N Arg-Pro-Cys Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CCCN=C(N)N)N)C(=O)N[C@@H](CS)C(=O)O FOQFHANLUJDQEE-GUBZILKMSA-N 0.000 description 2
- ISJWBVIYRBAXEB-CIUDSAMLSA-N Arg-Ser-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O ISJWBVIYRBAXEB-CIUDSAMLSA-N 0.000 description 2
- FRBAHXABMQXSJQ-FXQIFTODSA-N Arg-Ser-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O FRBAHXABMQXSJQ-FXQIFTODSA-N 0.000 description 2
- NMTANZXPDAHUKU-ULQDDVLXSA-N Arg-Tyr-Lys Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=C(O)C=C1 NMTANZXPDAHUKU-ULQDDVLXSA-N 0.000 description 2
- XWGJDUSDTRPQRK-ZLUOBGJFSA-N Asn-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(N)=O XWGJDUSDTRPQRK-ZLUOBGJFSA-N 0.000 description 2
- XSGBIBGAMKTHMY-WHFBIAKZSA-N Asn-Asp-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O XSGBIBGAMKTHMY-WHFBIAKZSA-N 0.000 description 2
- AYKKKGFJXIDYLX-ACZMJKKPSA-N Asn-Gln-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O AYKKKGFJXIDYLX-ACZMJKKPSA-N 0.000 description 2
- HCAUEJAQCXVQQM-ACZMJKKPSA-N Asn-Glu-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HCAUEJAQCXVQQM-ACZMJKKPSA-N 0.000 description 2
- DXVMJJNAOVECBA-WHFBIAKZSA-N Asn-Gly-Asn Chemical compound NC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O DXVMJJNAOVECBA-WHFBIAKZSA-N 0.000 description 2
- IICZCLFBILYRCU-WHFBIAKZSA-N Asn-Gly-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IICZCLFBILYRCU-WHFBIAKZSA-N 0.000 description 2
- OWUCNXMFJRFOFI-BQBZGAKWSA-N Asn-Gly-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CCSC)C(O)=O OWUCNXMFJRFOFI-BQBZGAKWSA-N 0.000 description 2
- ANPFQTJEPONRPL-UGYAYLCHSA-N Asn-Ile-Asp Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O ANPFQTJEPONRPL-UGYAYLCHSA-N 0.000 description 2
- ALKWEXBKAHPJAQ-NAKRPEOUSA-N Asn-Leu-Asp-Asp Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ALKWEXBKAHPJAQ-NAKRPEOUSA-N 0.000 description 2
- RZNAMKZJPBQWDJ-SRVKXCTJSA-N Asn-Lys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)N)N RZNAMKZJPBQWDJ-SRVKXCTJSA-N 0.000 description 2
- RVHGJNGNKGDCPX-KKUMJFAQSA-N Asn-Phe-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N RVHGJNGNKGDCPX-KKUMJFAQSA-N 0.000 description 2
- GKKUBLFXKRDMFC-BQBZGAKWSA-N Asn-Pro-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O GKKUBLFXKRDMFC-BQBZGAKWSA-N 0.000 description 2
- UGXYFDQFLVCDFC-CIUDSAMLSA-N Asn-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O UGXYFDQFLVCDFC-CIUDSAMLSA-N 0.000 description 2
- QTKYFZCMSQLYHI-UBHSHLNASA-N Asn-Trp-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(N)=O)C(O)=O QTKYFZCMSQLYHI-UBHSHLNASA-N 0.000 description 2
- XEGZSHSPQNDNRH-JRQIVUDYSA-N Asn-Tyr-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XEGZSHSPQNDNRH-JRQIVUDYSA-N 0.000 description 2
- XBQSLMACWDXWLJ-GHCJXIJMSA-N Asp-Ala-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O XBQSLMACWDXWLJ-GHCJXIJMSA-N 0.000 description 2
- NJIKKGUVGUBICV-ZLUOBGJFSA-N Asp-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O NJIKKGUVGUBICV-ZLUOBGJFSA-N 0.000 description 2
- RGKKALNPOYURGE-ZKWXMUAHSA-N Asp-Ala-Val Chemical compound N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)O RGKKALNPOYURGE-ZKWXMUAHSA-N 0.000 description 2
- HMQDRBKQMLRCCG-GMOBBJLQSA-N Asp-Arg-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HMQDRBKQMLRCCG-GMOBBJLQSA-N 0.000 description 2
- SDHFVYLZFBDSQT-DCAQKATOSA-N Asp-Arg-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(=O)O)N SDHFVYLZFBDSQT-DCAQKATOSA-N 0.000 description 2
- XJQRWGXKUSDEFI-ACZMJKKPSA-N Asp-Glu-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O XJQRWGXKUSDEFI-ACZMJKKPSA-N 0.000 description 2
- HSWYMWGDMPLTTH-FXQIFTODSA-N Asp-Glu-Gln Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O HSWYMWGDMPLTTH-FXQIFTODSA-N 0.000 description 2
- KHBLRHKVXICFMY-GUBZILKMSA-N Asp-Glu-Lys Chemical compound N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O KHBLRHKVXICFMY-GUBZILKMSA-N 0.000 description 2
- RRKCPMGSRIDLNC-AVGNSLFASA-N Asp-Glu-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O RRKCPMGSRIDLNC-AVGNSLFASA-N 0.000 description 2
- SVABRQFIHCSNCI-FOHZUACHSA-N Asp-Gly-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O SVABRQFIHCSNCI-FOHZUACHSA-N 0.000 description 2
- KTTCQQNRRLCIBC-GHCJXIJMSA-N Asp-Ile-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O KTTCQQNRRLCIBC-GHCJXIJMSA-N 0.000 description 2
- LDLZOAJRXXBVGF-GMOBBJLQSA-N Asp-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC(=O)O)N LDLZOAJRXXBVGF-GMOBBJLQSA-N 0.000 description 2
- SPWXXPFDTMYTRI-IUKAMOBKSA-N Asp-Ile-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SPWXXPFDTMYTRI-IUKAMOBKSA-N 0.000 description 2
- RTXQQDVBACBSCW-CFMVVWHZSA-N Asp-Ile-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O RTXQQDVBACBSCW-CFMVVWHZSA-N 0.000 description 2
- KYQNAIMCTRZLNP-QSFUFRPTSA-N Asp-Ile-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O KYQNAIMCTRZLNP-QSFUFRPTSA-N 0.000 description 2
- IVPNEDNYYYFAGI-GARJFASQSA-N Asp-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N IVPNEDNYYYFAGI-GARJFASQSA-N 0.000 description 2
- RPUYTJJZXQBWDT-SRVKXCTJSA-N Asp-Phe-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC(=O)O)N RPUYTJJZXQBWDT-SRVKXCTJSA-N 0.000 description 2
- KPSHWSWFPUDEGF-FXQIFTODSA-N Asp-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(O)=O KPSHWSWFPUDEGF-FXQIFTODSA-N 0.000 description 2
- BWJZSLQJNBSUPM-FXQIFTODSA-N Asp-Pro-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O BWJZSLQJNBSUPM-FXQIFTODSA-N 0.000 description 2
- BRRPVTUFESPTCP-ACZMJKKPSA-N Asp-Ser-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O BRRPVTUFESPTCP-ACZMJKKPSA-N 0.000 description 2
- KNDCWFXCFKSEBM-AVGNSLFASA-N Asp-Tyr-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O KNDCWFXCFKSEBM-AVGNSLFASA-N 0.000 description 2
- SFJUYBCDQBAYAJ-YDHLFZDLSA-N Asp-Val-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SFJUYBCDQBAYAJ-YDHLFZDLSA-N 0.000 description 2
- YHZQPWIAFHYDJG-UHFFFAOYSA-M C(C)S(=O)(=O)[O-].OCCN1CCNCC1.[K+] Chemical compound C(C)S(=O)(=O)[O-].OCCN1CCNCC1.[K+] YHZQPWIAFHYDJG-UHFFFAOYSA-M 0.000 description 2
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 2
- 108020004638 Circular DNA Proteins 0.000 description 2
- GSNRZJNHMVMOFV-ACZMJKKPSA-N Cys-Asp-Glu Chemical compound C(CC(=O)O)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)N GSNRZJNHMVMOFV-ACZMJKKPSA-N 0.000 description 2
- KABHAOSDMIYXTR-GUBZILKMSA-N Cys-Glu-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N KABHAOSDMIYXTR-GUBZILKMSA-N 0.000 description 2
- DZSICRGTVPDCRN-YUMQZZPRSA-N Cys-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CS)N DZSICRGTVPDCRN-YUMQZZPRSA-N 0.000 description 2
- ZXCAQANTQWBICD-DCAQKATOSA-N Cys-Lys-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N ZXCAQANTQWBICD-DCAQKATOSA-N 0.000 description 2
- 101100232687 Drosophila melanogaster eIF4A gene Proteins 0.000 description 2
- 102100035102 E3 ubiquitin-protein ligase MYCBP2 Human genes 0.000 description 2
- 102000004533 Endonucleases Human genes 0.000 description 2
- KVYVOGYEMPEXBT-GUBZILKMSA-N Gln-Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O KVYVOGYEMPEXBT-GUBZILKMSA-N 0.000 description 2
- SHERTACNJPYHAR-ACZMJKKPSA-N Gln-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O SHERTACNJPYHAR-ACZMJKKPSA-N 0.000 description 2
- PGPJSRSLQNXBDT-YUMQZZPRSA-N Gln-Arg-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O PGPJSRSLQNXBDT-YUMQZZPRSA-N 0.000 description 2
- TWHDOEYLXXQYOZ-FXQIFTODSA-N Gln-Asn-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N TWHDOEYLXXQYOZ-FXQIFTODSA-N 0.000 description 2
- KCJJFESQRXGTGC-BQBZGAKWSA-N Gln-Glu-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O KCJJFESQRXGTGC-BQBZGAKWSA-N 0.000 description 2
- PNENQZWRFMUZOM-DCAQKATOSA-N Gln-Glu-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O PNENQZWRFMUZOM-DCAQKATOSA-N 0.000 description 2
- MWERYIXRDZDXOA-QEWYBTABSA-N Gln-Ile-Phe Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MWERYIXRDZDXOA-QEWYBTABSA-N 0.000 description 2
- FFVXLVGUJBCKRX-UKJIMTQDSA-N Gln-Ile-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CCC(=O)N)N FFVXLVGUJBCKRX-UKJIMTQDSA-N 0.000 description 2
- JNENSVNAUWONEZ-GUBZILKMSA-N Gln-Lys-Asn Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O JNENSVNAUWONEZ-GUBZILKMSA-N 0.000 description 2
- FKXCBKCOSVIGCT-AVGNSLFASA-N Gln-Lys-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O FKXCBKCOSVIGCT-AVGNSLFASA-N 0.000 description 2
- JNVGVECJCOZHCN-DRZSPHRISA-N Gln-Phe-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O JNVGVECJCOZHCN-DRZSPHRISA-N 0.000 description 2
- HHRAEXBUNGTOGZ-IHRRRGAJSA-N Gln-Phe-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O HHRAEXBUNGTOGZ-IHRRRGAJSA-N 0.000 description 2
- NYCVMJGIJYQWDO-CIUDSAMLSA-N Gln-Ser-Arg Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O NYCVMJGIJYQWDO-CIUDSAMLSA-N 0.000 description 2
- ININBLZFFVOQIO-JHEQGTHGSA-N Gln-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CCC(=O)N)N)O ININBLZFFVOQIO-JHEQGTHGSA-N 0.000 description 2
- SGVGIVDZLSHSEN-RYUDHWBXSA-N Gln-Tyr-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(O)=O SGVGIVDZLSHSEN-RYUDHWBXSA-N 0.000 description 2
- UGEZSPWLJABDAR-KKUMJFAQSA-N Gln-Tyr-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCC(=O)N)N UGEZSPWLJABDAR-KKUMJFAQSA-N 0.000 description 2
- MKRDNSWGJWTBKZ-GVXVVHGQSA-N Gln-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)N)N MKRDNSWGJWTBKZ-GVXVVHGQSA-N 0.000 description 2
- LKDIBBOKUAASNP-FXQIFTODSA-N Glu-Ala-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O LKDIBBOKUAASNP-FXQIFTODSA-N 0.000 description 2
- ITYRYNUZHPNCIK-GUBZILKMSA-N Glu-Ala-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O ITYRYNUZHPNCIK-GUBZILKMSA-N 0.000 description 2
- JJKKWYQVHRUSDG-GUBZILKMSA-N Glu-Ala-Lys Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O JJKKWYQVHRUSDG-GUBZILKMSA-N 0.000 description 2
- IRDASPPCLZIERZ-XHNCKOQMSA-N Glu-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)O)N IRDASPPCLZIERZ-XHNCKOQMSA-N 0.000 description 2
- AVZHGSCDKIQZPQ-CIUDSAMLSA-N Glu-Arg-Ala Chemical compound C[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCC(O)=O)C(O)=O AVZHGSCDKIQZPQ-CIUDSAMLSA-N 0.000 description 2
- CVPXINNKRTZBMO-CIUDSAMLSA-N Glu-Arg-Asn Chemical compound C(C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)O)N)CN=C(N)N CVPXINNKRTZBMO-CIUDSAMLSA-N 0.000 description 2
- DIXKFOPPGWKZLY-CIUDSAMLSA-N Glu-Arg-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O DIXKFOPPGWKZLY-CIUDSAMLSA-N 0.000 description 2
- OXEMJGCAJFFREE-FXQIFTODSA-N Glu-Gln-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O OXEMJGCAJFFREE-FXQIFTODSA-N 0.000 description 2
- WLIPTFCZLHCNFD-LPEHRKFASA-N Glu-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)O)N)C(=O)O WLIPTFCZLHCNFD-LPEHRKFASA-N 0.000 description 2
- WPLGNDORMXTMQS-FXQIFTODSA-N Glu-Gln-Ser Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O WPLGNDORMXTMQS-FXQIFTODSA-N 0.000 description 2
- HUFCEIHAFNVSNR-IHRRRGAJSA-N Glu-Gln-Tyr Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HUFCEIHAFNVSNR-IHRRRGAJSA-N 0.000 description 2
- IQACOVZVOMVILH-FXQIFTODSA-N Glu-Glu-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O IQACOVZVOMVILH-FXQIFTODSA-N 0.000 description 2
- OGNJZUXUTPQVBR-BQBZGAKWSA-N Glu-Gly-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O OGNJZUXUTPQVBR-BQBZGAKWSA-N 0.000 description 2
- KRGZZKWSBGPLKL-IUCAKERBSA-N Glu-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)N KRGZZKWSBGPLKL-IUCAKERBSA-N 0.000 description 2
- NJPQBTJSYCKCNS-HVTMNAMFSA-N Glu-His-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCC(=O)O)N NJPQBTJSYCKCNS-HVTMNAMFSA-N 0.000 description 2
- VSRCAOIHMGCIJK-SRVKXCTJSA-N Glu-Leu-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O VSRCAOIHMGCIJK-SRVKXCTJSA-N 0.000 description 2
- SJJHXJDSNQJMMW-SRVKXCTJSA-N Glu-Lys-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O SJJHXJDSNQJMMW-SRVKXCTJSA-N 0.000 description 2
- QDMVXRNLOPTPIE-WDCWCFNPSA-N Glu-Lys-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QDMVXRNLOPTPIE-WDCWCFNPSA-N 0.000 description 2
- ZIYGTCDTJJCDDP-JYJNAYRXSA-N Glu-Phe-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZIYGTCDTJJCDDP-JYJNAYRXSA-N 0.000 description 2
- BPLNJYHNAJVLRT-ACZMJKKPSA-N Glu-Ser-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O BPLNJYHNAJVLRT-ACZMJKKPSA-N 0.000 description 2
- GMVCSRBOSIUTFC-FXQIFTODSA-N Glu-Ser-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O GMVCSRBOSIUTFC-FXQIFTODSA-N 0.000 description 2
- DMYACXMQUABZIQ-NRPADANISA-N Glu-Ser-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O DMYACXMQUABZIQ-NRPADANISA-N 0.000 description 2
- ZYRXTRTUCAVNBQ-GVXVVHGQSA-N Glu-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZYRXTRTUCAVNBQ-GVXVVHGQSA-N 0.000 description 2
- QXPRJQPCFXMCIY-NKWVEPMBSA-N Gly-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN QXPRJQPCFXMCIY-NKWVEPMBSA-N 0.000 description 2
- VXKCPBPQEKKERH-IUCAKERBSA-N Gly-Arg-Pro Chemical compound NC(N)=NCCC[C@H](NC(=O)CN)C(=O)N1CCC[C@H]1C(O)=O VXKCPBPQEKKERH-IUCAKERBSA-N 0.000 description 2
- GWCRIHNSVMOBEQ-BQBZGAKWSA-N Gly-Arg-Ser Chemical compound [H]NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O GWCRIHNSVMOBEQ-BQBZGAKWSA-N 0.000 description 2
- BGVYNAQWHSTTSP-BYULHYEWSA-N Gly-Asn-Ile Chemical compound [H]NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BGVYNAQWHSTTSP-BYULHYEWSA-N 0.000 description 2
- FIQQRCFQXGLOSZ-WDSKDSINSA-N Gly-Glu-Asp Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O FIQQRCFQXGLOSZ-WDSKDSINSA-N 0.000 description 2
- HFXJIZNEXNIZIJ-BQBZGAKWSA-N Gly-Glu-Gln Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O HFXJIZNEXNIZIJ-BQBZGAKWSA-N 0.000 description 2
- YYPFZVIXAVDHIK-IUCAKERBSA-N Gly-Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CN YYPFZVIXAVDHIK-IUCAKERBSA-N 0.000 description 2
- ULZCYBYDTUMHNF-IUCAKERBSA-N Gly-Leu-Glu Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O ULZCYBYDTUMHNF-IUCAKERBSA-N 0.000 description 2
- IGOYNRWLWHWAQO-JTQLQIEISA-N Gly-Phe-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 IGOYNRWLWHWAQO-JTQLQIEISA-N 0.000 description 2
- SSFWXSNOKDZNHY-QXEWZRGKSA-N Gly-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN SSFWXSNOKDZNHY-QXEWZRGKSA-N 0.000 description 2
- OCPPBNKYGYSLOE-IUCAKERBSA-N Gly-Pro-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN OCPPBNKYGYSLOE-IUCAKERBSA-N 0.000 description 2
- YOBGUCWZPXJHTN-BQBZGAKWSA-N Gly-Ser-Arg Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N YOBGUCWZPXJHTN-BQBZGAKWSA-N 0.000 description 2
- MYXNLWDWWOTERK-BHNWBGBOSA-N Gly-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN)O MYXNLWDWWOTERK-BHNWBGBOSA-N 0.000 description 2
- KOYUSMBPJOVSOO-XEGUGMAKSA-N Gly-Tyr-Ile Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KOYUSMBPJOVSOO-XEGUGMAKSA-N 0.000 description 2
- DUAWRXXTOQOECJ-JSGCOSHPSA-N Gly-Tyr-Val Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O DUAWRXXTOQOECJ-JSGCOSHPSA-N 0.000 description 2
- YDIDLLVFCYSXNY-RCOVLWMOSA-N Gly-Val-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)CN YDIDLLVFCYSXNY-RCOVLWMOSA-N 0.000 description 2
- SBVMXEZQJVUARN-XPUUQOCRSA-N Gly-Val-Ser Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O SBVMXEZQJVUARN-XPUUQOCRSA-N 0.000 description 2
- FHKZHRMERJUXRJ-DCAQKATOSA-N His-Ser-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CN=CN1 FHKZHRMERJUXRJ-DCAQKATOSA-N 0.000 description 2
- UWNUQPZUSRFIIN-JUKXBJQTSA-N His-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CC2=CN=CN2)N UWNUQPZUSRFIIN-JUKXBJQTSA-N 0.000 description 2
- YKRYHWJRQUSTKG-KBIXCLLPSA-N Ile-Ala-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N YKRYHWJRQUSTKG-KBIXCLLPSA-N 0.000 description 2
- TZCGZYWNIDZZMR-UHFFFAOYSA-N Ile-Arg-Ala Natural products CCC(C)C(N)C(=O)NC(C(=O)NC(C)C(O)=O)CCCN=C(N)N TZCGZYWNIDZZMR-UHFFFAOYSA-N 0.000 description 2
- YOTNPRLPIPHQSB-XUXIUFHCSA-N Ile-Arg-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N YOTNPRLPIPHQSB-XUXIUFHCSA-N 0.000 description 2
- VZIFYHYNQDIPLI-HJWJTTGWSA-N Ile-Arg-Phe Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N VZIFYHYNQDIPLI-HJWJTTGWSA-N 0.000 description 2
- HZMLFETXHFHGBB-UGYAYLCHSA-N Ile-Asn-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N HZMLFETXHFHGBB-UGYAYLCHSA-N 0.000 description 2
- UAVQIQOOBXFKRC-BYULHYEWSA-N Ile-Asn-Gly Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O UAVQIQOOBXFKRC-BYULHYEWSA-N 0.000 description 2
- ZDNORQNHCJUVOV-KBIXCLLPSA-N Ile-Gln-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O ZDNORQNHCJUVOV-KBIXCLLPSA-N 0.000 description 2
- KUHFPGIVBOCRMV-MNXVOIDGSA-N Ile-Gln-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)O)N KUHFPGIVBOCRMV-MNXVOIDGSA-N 0.000 description 2
- MTFVYKQRLXYAQN-LAEOZQHASA-N Ile-Glu-Gly Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O MTFVYKQRLXYAQN-LAEOZQHASA-N 0.000 description 2
- ODPKZZLRDNXTJZ-WHOFXGATSA-N Ile-Gly-Phe Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N ODPKZZLRDNXTJZ-WHOFXGATSA-N 0.000 description 2
- YKLOMBNBQUTJDT-HVTMNAMFSA-N Ile-His-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N YKLOMBNBQUTJDT-HVTMNAMFSA-N 0.000 description 2
- FFJQAEYLAQMGDL-MGHWNKPDSA-N Ile-Lys-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FFJQAEYLAQMGDL-MGHWNKPDSA-N 0.000 description 2
- JZNVOBUNTWNZPW-GHCJXIJMSA-N Ile-Ser-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)N JZNVOBUNTWNZPW-GHCJXIJMSA-N 0.000 description 2
- PXKACEXYLPBMAD-JBDRJPRFSA-N Ile-Ser-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PXKACEXYLPBMAD-JBDRJPRFSA-N 0.000 description 2
- YBKKLDBBPFIXBQ-MBLNEYKQSA-N Ile-Thr-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)O)N YBKKLDBBPFIXBQ-MBLNEYKQSA-N 0.000 description 2
- JZBVBOKASHNXAD-NAKRPEOUSA-N Ile-Val-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)O)N JZBVBOKASHNXAD-NAKRPEOUSA-N 0.000 description 2
- 241000235650 Kluyveromyces marxianus Species 0.000 description 2
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 2
- 241000254158 Lampyridae Species 0.000 description 2
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 2
- WSGXUIQTEZDVHJ-GARJFASQSA-N Leu-Ala-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O WSGXUIQTEZDVHJ-GARJFASQSA-N 0.000 description 2
- ZURHXHNAEJJRNU-CIUDSAMLSA-N Leu-Asp-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ZURHXHNAEJJRNU-CIUDSAMLSA-N 0.000 description 2
- ILJREDZFPHTUIE-GUBZILKMSA-N Leu-Asp-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ILJREDZFPHTUIE-GUBZILKMSA-N 0.000 description 2
- CLVUXCBGKUECIT-HJGDQZAQSA-N Leu-Asp-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CLVUXCBGKUECIT-HJGDQZAQSA-N 0.000 description 2
- CQGSYZCULZMEDE-SRVKXCTJSA-N Leu-Gln-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(O)=O CQGSYZCULZMEDE-SRVKXCTJSA-N 0.000 description 2
- CQGSYZCULZMEDE-UHFFFAOYSA-N Leu-Gln-Pro Natural products CC(C)CC(N)C(=O)NC(CCC(N)=O)C(=O)N1CCCC1C(O)=O CQGSYZCULZMEDE-UHFFFAOYSA-N 0.000 description 2
- PRZVBIAOPFGAQF-SRVKXCTJSA-N Leu-Glu-Met Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(O)=O PRZVBIAOPFGAQF-SRVKXCTJSA-N 0.000 description 2
- KXODZBLFVFSLAI-AVGNSLFASA-N Leu-His-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(C)C)CC1=CN=CN1 KXODZBLFVFSLAI-AVGNSLFASA-N 0.000 description 2
- WRLPVDVHNWSSCL-MELADBBJSA-N Leu-His-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N2CCC[C@@H]2C(=O)O)N WRLPVDVHNWSSCL-MELADBBJSA-N 0.000 description 2
- UCNNZELZXFXXJQ-BZSNNMDCSA-N Leu-Leu-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 UCNNZELZXFXXJQ-BZSNNMDCSA-N 0.000 description 2
- ARRIJPQRBWRNLT-DCAQKATOSA-N Leu-Met-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)N)C(=O)O)N ARRIJPQRBWRNLT-DCAQKATOSA-N 0.000 description 2
- ZAVCJRJOQKIOJW-KKUMJFAQSA-N Leu-Phe-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(O)=O)C(O)=O)CC1=CC=CC=C1 ZAVCJRJOQKIOJW-KKUMJFAQSA-N 0.000 description 2
- PTRKPHUGYULXPU-KKUMJFAQSA-N Leu-Phe-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O PTRKPHUGYULXPU-KKUMJFAQSA-N 0.000 description 2
- PWPBLZXWFXJFHE-RHYQMDGZSA-N Leu-Pro-Thr Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O PWPBLZXWFXJFHE-RHYQMDGZSA-N 0.000 description 2
- UCRJTSIIAYHOHE-ULQDDVLXSA-N Leu-Tyr-Arg Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N UCRJTSIIAYHOHE-ULQDDVLXSA-N 0.000 description 2
- MVJRBCJCRYGCKV-GVXVVHGQSA-N Leu-Val-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O MVJRBCJCRYGCKV-GVXVVHGQSA-N 0.000 description 2
- 229910009891 LiAc Inorganic materials 0.000 description 2
- PNPYKQFJGRFYJE-GUBZILKMSA-N Lys-Ala-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O PNPYKQFJGRFYJE-GUBZILKMSA-N 0.000 description 2
- NFLFJGGKOHYZJF-BJDJZHNGSA-N Lys-Ala-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN NFLFJGGKOHYZJF-BJDJZHNGSA-N 0.000 description 2
- WXJKFRMKJORORD-DCAQKATOSA-N Lys-Arg-Ala Chemical compound NC(=N)NCCC[C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CCCCN WXJKFRMKJORORD-DCAQKATOSA-N 0.000 description 2
- GQUDMNDPQTXZRV-DCAQKATOSA-N Lys-Arg-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O GQUDMNDPQTXZRV-DCAQKATOSA-N 0.000 description 2
- YNNPKXBBRZVIRX-IHRRRGAJSA-N Lys-Arg-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O YNNPKXBBRZVIRX-IHRRRGAJSA-N 0.000 description 2
- YKIRNDPUWONXQN-GUBZILKMSA-N Lys-Asn-Gln Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N YKIRNDPUWONXQN-GUBZILKMSA-N 0.000 description 2
- HQVDJTYKCMIWJP-YUMQZZPRSA-N Lys-Asn-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O HQVDJTYKCMIWJP-YUMQZZPRSA-N 0.000 description 2
- HKCCVDWHHTVVPN-CIUDSAMLSA-N Lys-Asp-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O HKCCVDWHHTVVPN-CIUDSAMLSA-N 0.000 description 2
- WTZUSCUIVPVCRH-SRVKXCTJSA-N Lys-Gln-Arg Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N WTZUSCUIVPVCRH-SRVKXCTJSA-N 0.000 description 2
- GRADYHMSAUIKPS-DCAQKATOSA-N Lys-Glu-Gln Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O GRADYHMSAUIKPS-DCAQKATOSA-N 0.000 description 2
- IMAKMJCBYCSMHM-AVGNSLFASA-N Lys-Glu-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN IMAKMJCBYCSMHM-AVGNSLFASA-N 0.000 description 2
- ULUQBUKAPDUKOC-GVXVVHGQSA-N Lys-Glu-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O ULUQBUKAPDUKOC-GVXVVHGQSA-N 0.000 description 2
- LCMWVZLBCUVDAZ-IUCAKERBSA-N Lys-Gly-Glu Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)NCC(=O)N[C@H](C([O-])=O)CCC([O-])=O LCMWVZLBCUVDAZ-IUCAKERBSA-N 0.000 description 2
- NKKFVJRLCCUJNA-QWRGUYRKSA-N Lys-Gly-Lys Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN NKKFVJRLCCUJNA-QWRGUYRKSA-N 0.000 description 2
- FHIAJWBDZVHLAH-YUMQZZPRSA-N Lys-Gly-Ser Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O FHIAJWBDZVHLAH-YUMQZZPRSA-N 0.000 description 2
- IUWMQCZOTYRXPL-ZPFDUUQYSA-N Lys-Ile-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O IUWMQCZOTYRXPL-ZPFDUUQYSA-N 0.000 description 2
- MYZMQWHPDAYKIE-SRVKXCTJSA-N Lys-Leu-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O MYZMQWHPDAYKIE-SRVKXCTJSA-N 0.000 description 2
- PYFNONMJYNJENN-AVGNSLFASA-N Lys-Lys-Gln Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N PYFNONMJYNJENN-AVGNSLFASA-N 0.000 description 2
- PLDJDCJLRCYPJB-VOAKCMCISA-N Lys-Lys-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PLDJDCJLRCYPJB-VOAKCMCISA-N 0.000 description 2
- BXPHMHQHYHILBB-BZSNNMDCSA-N Lys-Lys-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O BXPHMHQHYHILBB-BZSNNMDCSA-N 0.000 description 2
- MTBLFIQZECOEBY-IHRRRGAJSA-N Lys-Met-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(O)=O MTBLFIQZECOEBY-IHRRRGAJSA-N 0.000 description 2
- PIXVFCBYEGPZPA-JYJNAYRXSA-N Lys-Phe-Gln Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N PIXVFCBYEGPZPA-JYJNAYRXSA-N 0.000 description 2
- SBQDRNOLGSYHQA-YUMQZZPRSA-N Lys-Ser-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SBQDRNOLGSYHQA-YUMQZZPRSA-N 0.000 description 2
- PLOUVAYOMTYJRG-JXUBOQSCSA-N Lys-Thr-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O PLOUVAYOMTYJRG-JXUBOQSCSA-N 0.000 description 2
- RMOKGALPSPOYKE-KATARQTJSA-N Lys-Thr-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O RMOKGALPSPOYKE-KATARQTJSA-N 0.000 description 2
- XABXVVSWUVCZST-GVXVVHGQSA-N Lys-Val-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN XABXVVSWUVCZST-GVXVVHGQSA-N 0.000 description 2
- ACYHZNZHIZWLQF-BQBZGAKWSA-N Met-Asn-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O ACYHZNZHIZWLQF-BQBZGAKWSA-N 0.000 description 2
- XMQZLGBUJMMODC-AVGNSLFASA-N Met-His-Val Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(O)=O XMQZLGBUJMMODC-AVGNSLFASA-N 0.000 description 2
- WPTDJKDGICUFCP-XUXIUFHCSA-N Met-Ile-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CCSC)N WPTDJKDGICUFCP-XUXIUFHCSA-N 0.000 description 2
- YYEIFXZOBZVDPH-DCAQKATOSA-N Met-Lys-Asp Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O YYEIFXZOBZVDPH-DCAQKATOSA-N 0.000 description 2
- VSJAPSMRFYUOKS-IUCAKERBSA-N Met-Pro-Gly Chemical compound CSCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O VSJAPSMRFYUOKS-IUCAKERBSA-N 0.000 description 2
- XIGAHPDZLAYQOS-SRVKXCTJSA-N Met-Pro-Pro Chemical compound CSCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 XIGAHPDZLAYQOS-SRVKXCTJSA-N 0.000 description 2
- RDLSEGZJMYGFNS-FXQIFTODSA-N Met-Ser-Asp Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O RDLSEGZJMYGFNS-FXQIFTODSA-N 0.000 description 2
- FXBKQTOGURNXSL-HJGDQZAQSA-N Met-Thr-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(O)=O FXBKQTOGURNXSL-HJGDQZAQSA-N 0.000 description 2
- JACMWNXOOUYXCD-JYJNAYRXSA-N Met-Val-Phe Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 JACMWNXOOUYXCD-JYJNAYRXSA-N 0.000 description 2
- VYDLZDRMOFYOGV-TUAOUCFPSA-N Met-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCSC)N VYDLZDRMOFYOGV-TUAOUCFPSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 2
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 2
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- 108010047562 NGR peptide Proteins 0.000 description 2
- 108091005461 Nucleic proteins Proteins 0.000 description 2
- 239000008118 PEG 6000 Substances 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- MPGJIHFJCXTVEX-KKUMJFAQSA-N Phe-Arg-Glu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O MPGJIHFJCXTVEX-KKUMJFAQSA-N 0.000 description 2
- HPECNYCQLSVCHH-BZSNNMDCSA-N Phe-Cys-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)O)N HPECNYCQLSVCHH-BZSNNMDCSA-N 0.000 description 2
- FIRWJEJVFFGXSH-RYUDHWBXSA-N Phe-Glu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 FIRWJEJVFFGXSH-RYUDHWBXSA-N 0.000 description 2
- CSDMCMITJLKBAH-SOUVJXGZSA-N Phe-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N)C(=O)O CSDMCMITJLKBAH-SOUVJXGZSA-N 0.000 description 2
- ZLGQEBCCANLYRA-RYUDHWBXSA-N Phe-Gly-Glu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O ZLGQEBCCANLYRA-RYUDHWBXSA-N 0.000 description 2
- NHCKESBLOMHIIE-IRXDYDNUSA-N Phe-Gly-Phe Chemical compound C([C@H](N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 NHCKESBLOMHIIE-IRXDYDNUSA-N 0.000 description 2
- KDYPMIZMXDECSU-JYJNAYRXSA-N Phe-Leu-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 KDYPMIZMXDECSU-JYJNAYRXSA-N 0.000 description 2
- DOXQMJCSSYZSNM-BZSNNMDCSA-N Phe-Lys-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O DOXQMJCSSYZSNM-BZSNNMDCSA-N 0.000 description 2
- MCIXMYKSPQUMJG-SRVKXCTJSA-N Phe-Ser-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MCIXMYKSPQUMJG-SRVKXCTJSA-N 0.000 description 2
- GCFNFKNPCMBHNT-IRXDYDNUSA-N Phe-Tyr-Gly Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)NCC(=O)O)N GCFNFKNPCMBHNT-IRXDYDNUSA-N 0.000 description 2
- DXWNFNOPBYAFRM-IHRRRGAJSA-N Phe-Val-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N DXWNFNOPBYAFRM-IHRRRGAJSA-N 0.000 description 2
- 229920002584 Polyethylene Glycol 6000 Polymers 0.000 description 2
- NPYPAHLBTDXSSS-UHFFFAOYSA-N Potassium ion Chemical compound [K+] NPYPAHLBTDXSSS-UHFFFAOYSA-N 0.000 description 2
- DBALDZKOTNSBFM-FXQIFTODSA-N Pro-Ala-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O DBALDZKOTNSBFM-FXQIFTODSA-N 0.000 description 2
- AJLVKXCNXIJHDV-CIUDSAMLSA-N Pro-Ala-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O AJLVKXCNXIJHDV-CIUDSAMLSA-N 0.000 description 2
- FYQSMXKJYTZYRP-DCAQKATOSA-N Pro-Ala-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 FYQSMXKJYTZYRP-DCAQKATOSA-N 0.000 description 2
- CGBYDGAJHSOGFQ-LPEHRKFASA-N Pro-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2 CGBYDGAJHSOGFQ-LPEHRKFASA-N 0.000 description 2
- IHCXPSYCHXFXKT-DCAQKATOSA-N Pro-Arg-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O IHCXPSYCHXFXKT-DCAQKATOSA-N 0.000 description 2
- BNBBNGZZKQUWCD-IUCAKERBSA-N Pro-Arg-Gly Chemical compound NC(N)=NCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1 BNBBNGZZKQUWCD-IUCAKERBSA-N 0.000 description 2
- MLQVJYMFASXBGZ-IHRRRGAJSA-N Pro-Asn-Tyr Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O MLQVJYMFASXBGZ-IHRRRGAJSA-N 0.000 description 2
- FISHYTLIMUYTQY-GUBZILKMSA-N Pro-Gln-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1 FISHYTLIMUYTQY-GUBZILKMSA-N 0.000 description 2
- DRIJZWBRGMJCDD-DCAQKATOSA-N Pro-Gln-Met Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(O)=O DRIJZWBRGMJCDD-DCAQKATOSA-N 0.000 description 2
- GSPPWVHVBBSPSY-FHWLQOOXSA-N Pro-His-Trp Chemical compound OC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCCN1 GSPPWVHVBBSPSY-FHWLQOOXSA-N 0.000 description 2
- CPRLKHJUFAXVTD-ULQDDVLXSA-N Pro-Leu-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CPRLKHJUFAXVTD-ULQDDVLXSA-N 0.000 description 2
- ABSSTGUCBCDKMU-UWVGGRQHSA-N Pro-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1 ABSSTGUCBCDKMU-UWVGGRQHSA-N 0.000 description 2
- MHHQQZIFLWFZGR-DCAQKATOSA-N Pro-Lys-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O MHHQQZIFLWFZGR-DCAQKATOSA-N 0.000 description 2
- WFIVLLFYUZZWOD-RHYQMDGZSA-N Pro-Lys-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O WFIVLLFYUZZWOD-RHYQMDGZSA-N 0.000 description 2
- WIPAMEKBSHNFQE-IUCAKERBSA-N Pro-Met-Gly Chemical compound CSCC[C@@H](C(=O)NCC(=O)O)NC(=O)[C@@H]1CCCN1 WIPAMEKBSHNFQE-IUCAKERBSA-N 0.000 description 2
- FYKUEXMZYFIZKA-DCAQKATOSA-N Pro-Pro-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O FYKUEXMZYFIZKA-DCAQKATOSA-N 0.000 description 2
- PCWLNNZTBJTZRN-AVGNSLFASA-N Pro-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 PCWLNNZTBJTZRN-AVGNSLFASA-N 0.000 description 2
- IURWWZYKYPEANQ-HJGDQZAQSA-N Pro-Thr-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O IURWWZYKYPEANQ-HJGDQZAQSA-N 0.000 description 2
- AIOWVDNPESPXRB-YTWAJWBKSA-N Pro-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2)O AIOWVDNPESPXRB-YTWAJWBKSA-N 0.000 description 2
- RMJZWERKFFNNNS-XGEHTFHBSA-N Pro-Thr-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O RMJZWERKFFNNNS-XGEHTFHBSA-N 0.000 description 2
- GZNYIXWOIUFLGO-ZJDVBMNYSA-N Pro-Thr-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GZNYIXWOIUFLGO-ZJDVBMNYSA-N 0.000 description 2
- QHSSUIHLAIWXEE-IHRRRGAJSA-N Pro-Tyr-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O QHSSUIHLAIWXEE-IHRRRGAJSA-N 0.000 description 2
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 2
- 102000002067 Protein Subunits Human genes 0.000 description 2
- 108010001267 Protein Subunits Proteins 0.000 description 2
- 108010003201 RGH 0205 Proteins 0.000 description 2
- 108090000944 RNA Helicases Proteins 0.000 description 2
- 102000004409 RNA Helicases Human genes 0.000 description 2
- 102000044126 RNA-Binding Proteins Human genes 0.000 description 2
- 101710105008 RNA-binding protein Proteins 0.000 description 2
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 2
- 101100246066 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PUB1 gene Proteins 0.000 description 2
- 101710204410 Scaffold protein Proteins 0.000 description 2
- HQTKVSCNCDLXSX-BQBZGAKWSA-N Ser-Arg-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O HQTKVSCNCDLXSX-BQBZGAKWSA-N 0.000 description 2
- OBXVZEAMXFSGPU-FXQIFTODSA-N Ser-Asn-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)CN=C(N)N OBXVZEAMXFSGPU-FXQIFTODSA-N 0.000 description 2
- FIDMVVBUOCMMJG-CIUDSAMLSA-N Ser-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CO FIDMVVBUOCMMJG-CIUDSAMLSA-N 0.000 description 2
- RDFQNDHEHVSONI-ZLUOBGJFSA-N Ser-Asn-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O RDFQNDHEHVSONI-ZLUOBGJFSA-N 0.000 description 2
- KNZQGAUEYZJUSQ-ZLUOBGJFSA-N Ser-Asp-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)N KNZQGAUEYZJUSQ-ZLUOBGJFSA-N 0.000 description 2
- CRZRTKAVUUGKEQ-ACZMJKKPSA-N Ser-Gln-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O CRZRTKAVUUGKEQ-ACZMJKKPSA-N 0.000 description 2
- OJPHFSOMBZKQKQ-GUBZILKMSA-N Ser-Gln-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CO OJPHFSOMBZKQKQ-GUBZILKMSA-N 0.000 description 2
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 2
- AEGUWTFAQQWVLC-BQBZGAKWSA-N Ser-Gly-Arg Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O AEGUWTFAQQWVLC-BQBZGAKWSA-N 0.000 description 2
- SNVIOQXAHVORQM-WDSKDSINSA-N Ser-Gly-Gln Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O SNVIOQXAHVORQM-WDSKDSINSA-N 0.000 description 2
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 2
- OQPNSDWGAMFJNU-QWRGUYRKSA-N Ser-Gly-Tyr Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 OQPNSDWGAMFJNU-QWRGUYRKSA-N 0.000 description 2
- CICQXRWZNVXFCU-SRVKXCTJSA-N Ser-His-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(O)=O CICQXRWZNVXFCU-SRVKXCTJSA-N 0.000 description 2
- CAOYHZOWXFFAIR-CIUDSAMLSA-N Ser-His-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O CAOYHZOWXFFAIR-CIUDSAMLSA-N 0.000 description 2
- SFTZTYBXIXLRGQ-JBDRJPRFSA-N Ser-Ile-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O SFTZTYBXIXLRGQ-JBDRJPRFSA-N 0.000 description 2
- BKZYBLLIBOBOOW-GHCJXIJMSA-N Ser-Ile-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O BKZYBLLIBOBOOW-GHCJXIJMSA-N 0.000 description 2
- JIPVNVNKXJLFJF-BJDJZHNGSA-N Ser-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N JIPVNVNKXJLFJF-BJDJZHNGSA-N 0.000 description 2
- XNCUYZKGQOCOQH-YUMQZZPRSA-N Ser-Leu-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O XNCUYZKGQOCOQH-YUMQZZPRSA-N 0.000 description 2
- VMLONWHIORGALA-SRVKXCTJSA-N Ser-Leu-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CO VMLONWHIORGALA-SRVKXCTJSA-N 0.000 description 2
- XUDRHBPSPAPDJP-SRVKXCTJSA-N Ser-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO XUDRHBPSPAPDJP-SRVKXCTJSA-N 0.000 description 2
- FZEUTKVQGMVGHW-AVGNSLFASA-N Ser-Phe-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O FZEUTKVQGMVGHW-AVGNSLFASA-N 0.000 description 2
- FKYWFUYPVKLJLP-DCAQKATOSA-N Ser-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO FKYWFUYPVKLJLP-DCAQKATOSA-N 0.000 description 2
- JCLAFVNDBJMLBC-JBDRJPRFSA-N Ser-Ser-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JCLAFVNDBJMLBC-JBDRJPRFSA-N 0.000 description 2
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 2
- CUXJENOFJXOSOZ-BIIVOSGPSA-N Ser-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CO)N)C(=O)O CUXJENOFJXOSOZ-BIIVOSGPSA-N 0.000 description 2
- OQSQCUWQOIHECT-YJRXYDGGSA-N Ser-Tyr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OQSQCUWQOIHECT-YJRXYDGGSA-N 0.000 description 2
- IAOHCSQDQDWRQU-GUBZILKMSA-N Ser-Val-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O IAOHCSQDQDWRQU-GUBZILKMSA-N 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- CTONFVDJYCAMQM-IUKAMOBKSA-N Thr-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H]([C@@H](C)O)N CTONFVDJYCAMQM-IUKAMOBKSA-N 0.000 description 2
- XDARBNMYXKUFOJ-GSSVUCPTSA-N Thr-Asp-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XDARBNMYXKUFOJ-GSSVUCPTSA-N 0.000 description 2
- OQCXTUQTKQFDCX-HTUGSXCWSA-N Thr-Glu-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O OQCXTUQTKQFDCX-HTUGSXCWSA-N 0.000 description 2
- MECLEFZMPPOEAC-VOAKCMCISA-N Thr-Leu-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MECLEFZMPPOEAC-VOAKCMCISA-N 0.000 description 2
- XSEPSRUDSPHMPX-KATARQTJSA-N Thr-Lys-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O XSEPSRUDSPHMPX-KATARQTJSA-N 0.000 description 2
- KPNSNVTUVKSBFL-ZJDVBMNYSA-N Thr-Met-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N)O KPNSNVTUVKSBFL-ZJDVBMNYSA-N 0.000 description 2
- ABWNZPOIUJMNKT-IXOXFDKPSA-N Thr-Phe-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O ABWNZPOIUJMNKT-IXOXFDKPSA-N 0.000 description 2
- NDXSOKGYKCGYKT-VEVYYDQMSA-N Thr-Pro-Asp Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O NDXSOKGYKCGYKT-VEVYYDQMSA-N 0.000 description 2
- BDENGIGFTNYZSJ-RCWTZXSCSA-N Thr-Pro-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(O)=O BDENGIGFTNYZSJ-RCWTZXSCSA-N 0.000 description 2
- IQPWNQRRAJHOKV-KATARQTJSA-N Thr-Ser-Lys Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN IQPWNQRRAJHOKV-KATARQTJSA-N 0.000 description 2
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- CZWIHKFGHICAJX-BPUTZDHNSA-N Trp-Glu-Glu Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O)=CNC2=C1 CZWIHKFGHICAJX-BPUTZDHNSA-N 0.000 description 2
- UIRPULWLRODAEQ-QEJZJMRPSA-N Trp-Ser-Glu Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O)=CNC2=C1 UIRPULWLRODAEQ-QEJZJMRPSA-N 0.000 description 2
- PALLCTDPFINNMM-JQHSSLGASA-N Trp-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)N PALLCTDPFINNMM-JQHSSLGASA-N 0.000 description 2
- IELISNUVHBKYBX-XDTLVQLUSA-N Tyr-Ala-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 IELISNUVHBKYBX-XDTLVQLUSA-N 0.000 description 2
- KSVMDJJCYKIXTK-IGNZVWTISA-N Tyr-Ala-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 KSVMDJJCYKIXTK-IGNZVWTISA-N 0.000 description 2
- QUILOGWWLXMSAT-IHRRRGAJSA-N Tyr-Gln-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O QUILOGWWLXMSAT-IHRRRGAJSA-N 0.000 description 2
- RYSNTWVRSLCAJZ-RYUDHWBXSA-N Tyr-Gln-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RYSNTWVRSLCAJZ-RYUDHWBXSA-N 0.000 description 2
- WZQZUVWEPMGIMM-JYJNAYRXSA-N Tyr-Gln-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N)O WZQZUVWEPMGIMM-JYJNAYRXSA-N 0.000 description 2
- FXYOYUMPUJONGW-FHWLQOOXSA-N Tyr-Gln-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 FXYOYUMPUJONGW-FHWLQOOXSA-N 0.000 description 2
- ZOBLBMGJKVJVEV-BZSNNMDCSA-N Tyr-Lys-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)N)O ZOBLBMGJKVJVEV-BZSNNMDCSA-N 0.000 description 2
- GZOCMHSZGGJBCX-ULQDDVLXSA-N Tyr-Lys-Met Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(O)=O GZOCMHSZGGJBCX-ULQDDVLXSA-N 0.000 description 2
- YYLHVUCSTXXKBS-IHRRRGAJSA-N Tyr-Pro-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O YYLHVUCSTXXKBS-IHRRRGAJSA-N 0.000 description 2
- QFXVAFIHVWXXBJ-AVGNSLFASA-N Tyr-Ser-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O QFXVAFIHVWXXBJ-AVGNSLFASA-N 0.000 description 2
- RGJZPXFZIUUQDN-BPNCWPANSA-N Tyr-Val-Ala Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O RGJZPXFZIUUQDN-BPNCWPANSA-N 0.000 description 2
- GOPQNCQSXBJAII-ULQDDVLXSA-N Tyr-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N GOPQNCQSXBJAII-ULQDDVLXSA-N 0.000 description 2
- PGAVKCOVUIYSFO-XVFCMESISA-N UTP Chemical compound O[C@@H]1[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O[C@H]1N1C(=O)NC(=O)C=C1 PGAVKCOVUIYSFO-XVFCMESISA-N 0.000 description 2
- IVXJODPZRWHCCR-JYJNAYRXSA-N Val-Arg-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N IVXJODPZRWHCCR-JYJNAYRXSA-N 0.000 description 2
- AUMNPAUHKUNHHN-BYULHYEWSA-N Val-Asn-Asp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N AUMNPAUHKUNHHN-BYULHYEWSA-N 0.000 description 2
- OVLIFGQSBSNGHY-KKHAAJSZSA-N Val-Asp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C(C)C)N)O OVLIFGQSBSNGHY-KKHAAJSZSA-N 0.000 description 2
- SCBITHMBEJNRHC-LSJOCFKGSA-N Val-Asp-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)O)N SCBITHMBEJNRHC-LSJOCFKGSA-N 0.000 description 2
- FRUYSSRPJXNRRB-GUBZILKMSA-N Val-Cys-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N FRUYSSRPJXNRRB-GUBZILKMSA-N 0.000 description 2
- CVIXTAITYJQMPE-LAEOZQHASA-N Val-Glu-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O CVIXTAITYJQMPE-LAEOZQHASA-N 0.000 description 2
- GBESYURLQOYWLU-LAEOZQHASA-N Val-Glu-Asp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N GBESYURLQOYWLU-LAEOZQHASA-N 0.000 description 2
- XWYUBUYQMOUFRQ-IFFSRLJSSA-N Val-Glu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C(C)C)N)O XWYUBUYQMOUFRQ-IFFSRLJSSA-N 0.000 description 2
- ZTKGDWOUYRRAOQ-ULQDDVLXSA-N Val-His-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)O)N ZTKGDWOUYRRAOQ-ULQDDVLXSA-N 0.000 description 2
- VXDSPJJQUQDCKH-UKJIMTQDSA-N Val-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](C(C)C)N VXDSPJJQUQDCKH-UKJIMTQDSA-N 0.000 description 2
- BTWMICVCQLKKNR-DCAQKATOSA-N Val-Leu-Ser Chemical compound CC(C)[C@H]([NH3+])C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C([O-])=O BTWMICVCQLKKNR-DCAQKATOSA-N 0.000 description 2
- MBGFDZDWMDLXHQ-GUBZILKMSA-N Val-Met-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](C(C)C)N MBGFDZDWMDLXHQ-GUBZILKMSA-N 0.000 description 2
- SSYBNWFXCFNRFN-GUBZILKMSA-N Val-Pro-Ser Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O SSYBNWFXCFNRFN-GUBZILKMSA-N 0.000 description 2
- QTPQHINADBYBNA-DCAQKATOSA-N Val-Ser-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN QTPQHINADBYBNA-DCAQKATOSA-N 0.000 description 2
- GBIUHAYJGWVNLN-AEJSXWLSSA-N Val-Ser-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N GBIUHAYJGWVNLN-AEJSXWLSSA-N 0.000 description 2
- CEKSLIVSNNGOKH-KZVJFYERSA-N Val-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](C(C)C)N)O CEKSLIVSNNGOKH-KZVJFYERSA-N 0.000 description 2
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 2
- AEFJNECXZCODJM-UWVGGRQHSA-N Val-Val-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)N[C@@H](C(C)C)C(=O)NCC([O-])=O AEFJNECXZCODJM-UWVGGRQHSA-N 0.000 description 2
- AOILQMZPNLUXCM-AVGNSLFASA-N Val-Val-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN AOILQMZPNLUXCM-AVGNSLFASA-N 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 230000006154 adenylylation Effects 0.000 description 2
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 2
- 108010070944 alanylhistidine Proteins 0.000 description 2
- 238000004873 anchoring Methods 0.000 description 2
- 108010013835 arginine glutamate Proteins 0.000 description 2
- 108010008355 arginyl-glutamine Proteins 0.000 description 2
- 108010009111 arginyl-glycyl-glutamic acid Proteins 0.000 description 2
- 108010068380 arginylarginine Proteins 0.000 description 2
- 108010060035 arginylproline Proteins 0.000 description 2
- 108010077245 asparaginyl-proline Proteins 0.000 description 2
- 108010093581 aspartyl-proline Proteins 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 210000004671 cell-free system Anatomy 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000009025 developmental regulation Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 230000037149 energy metabolism Effects 0.000 description 2
- 108091006047 fluorescent proteins Proteins 0.000 description 2
- 102000034287 fluorescent proteins Human genes 0.000 description 2
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 2
- 238000003209 gene knockout Methods 0.000 description 2
- 230000004110 gluconeogenesis Effects 0.000 description 2
- 108010042598 glutamyl-aspartyl-glycine Proteins 0.000 description 2
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 2
- 108010077435 glycyl-phenylalanyl-glycine Proteins 0.000 description 2
- 108010089804 glycyl-threonine Proteins 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 108010018006 histidylserine Proteins 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 230000003301 hydrolyzing effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 108010031424 isoleucyl-prolyl-proline Proteins 0.000 description 2
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 2
- 108010053037 kyotorphin Proteins 0.000 description 2
- 108010073472 leucyl-prolyl-proline Proteins 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 108010034507 methionyltryptophan Proteins 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 108091027963 non-coding RNA Proteins 0.000 description 2
- 102000042567 non-coding RNA Human genes 0.000 description 2
- 108010089198 phenylalanyl-prolyl-arginine Proteins 0.000 description 2
- 108010073025 phenylalanylphenylalanine Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000029553 photosynthesis Effects 0.000 description 2
- 238000010672 photosynthesis Methods 0.000 description 2
- 229960004109 potassium acetate Drugs 0.000 description 2
- 108010014614 prolyl-glycyl-proline Proteins 0.000 description 2
- 108700042769 prolyl-leucyl-glycine Proteins 0.000 description 2
- 108010004914 prolylarginine Proteins 0.000 description 2
- 108010070643 prolylglutamic acid Proteins 0.000 description 2
- 108010015796 prolylisoleucine Proteins 0.000 description 2
- 230000012846 protein folding Effects 0.000 description 2
- 230000035484 reaction time Effects 0.000 description 2
- 230000008844 regulatory mechanism Effects 0.000 description 2
- 229920002477 rna polymer Polymers 0.000 description 2
- 101150050176 rnp1 gene Proteins 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 108010048397 seryl-lysyl-leucine Proteins 0.000 description 2
- 230000035939 shock Effects 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 108091035539 telomere Proteins 0.000 description 2
- 102000055501 telomere Human genes 0.000 description 2
- 210000003411 telomere Anatomy 0.000 description 2
- 238000010257 thawing Methods 0.000 description 2
- 108010033670 threonyl-aspartyl-tyrosine Proteins 0.000 description 2
- 108010031491 threonyl-lysyl-glutamic acid Proteins 0.000 description 2
- 108010071097 threonyl-lysyl-proline Proteins 0.000 description 2
- 108010072986 threonyl-seryl-lysine Proteins 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 108700004896 tripeptide FEG Proteins 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 229950010342 uridine triphosphate Drugs 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- AXFMEGAFCUULFV-BLFANLJRSA-N (2s)-2-[[(2s)-1-[(2s,3r)-2-amino-3-methylpentanoyl]pyrrolidine-2-carbonyl]amino]pentanedioic acid Chemical compound CC[C@@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AXFMEGAFCUULFV-BLFANLJRSA-N 0.000 description 1
- QMOQBVOBWVNSNO-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(O)=O QMOQBVOBWVNSNO-UHFFFAOYSA-N 0.000 description 1
- 101150014847 APL2 gene Proteins 0.000 description 1
- 102100036601 Aggrecan core protein Human genes 0.000 description 1
- AAQGRPOPTAUUBM-ZLUOBGJFSA-N Ala-Ala-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O AAQGRPOPTAUUBM-ZLUOBGJFSA-N 0.000 description 1
- YWWATNIVMOCSAV-UBHSHLNASA-N Ala-Arg-Phe Chemical compound NC(=N)NCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 YWWATNIVMOCSAV-UBHSHLNASA-N 0.000 description 1
- YAXNATKKPOWVCP-ZLUOBGJFSA-N Ala-Asn-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(O)=O YAXNATKKPOWVCP-ZLUOBGJFSA-N 0.000 description 1
- CVGNCMIULZNYES-WHFBIAKZSA-N Ala-Asn-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O CVGNCMIULZNYES-WHFBIAKZSA-N 0.000 description 1
- JYEBJTDTPNKQJG-FXQIFTODSA-N Ala-Asn-Met Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCSC)C(=O)O)N JYEBJTDTPNKQJG-FXQIFTODSA-N 0.000 description 1
- MKZCBYZBCINNJN-DLOVCJGASA-N Ala-Asp-Phe Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MKZCBYZBCINNJN-DLOVCJGASA-N 0.000 description 1
- IKKVASZHTMKJIR-ZKWXMUAHSA-N Ala-Asp-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O IKKVASZHTMKJIR-ZKWXMUAHSA-N 0.000 description 1
- ZODMADSIQZZBSQ-FXQIFTODSA-N Ala-Gln-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZODMADSIQZZBSQ-FXQIFTODSA-N 0.000 description 1
- KXEVYGKATAMXJJ-ACZMJKKPSA-N Ala-Glu-Asp Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O KXEVYGKATAMXJJ-ACZMJKKPSA-N 0.000 description 1
- HMRWQTHUDVXMGH-GUBZILKMSA-N Ala-Glu-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN HMRWQTHUDVXMGH-GUBZILKMSA-N 0.000 description 1
- VBRDBGCROKWTPV-XHNCKOQMSA-N Ala-Glu-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N VBRDBGCROKWTPV-XHNCKOQMSA-N 0.000 description 1
- ROLXPVQSRCPVGK-XDTLVQLUSA-N Ala-Glu-Tyr Chemical compound N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O ROLXPVQSRCPVGK-XDTLVQLUSA-N 0.000 description 1
- CBCCCLMNOBLBSC-XVYDVKMFSA-N Ala-His-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O CBCCCLMNOBLBSC-XVYDVKMFSA-N 0.000 description 1
- NYDBKUNVSALYPX-NAKRPEOUSA-N Ala-Ile-Arg Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CCCN=C(N)N NYDBKUNVSALYPX-NAKRPEOUSA-N 0.000 description 1
- LXAARTARZJJCMB-CIQUZCHMSA-N Ala-Ile-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LXAARTARZJJCMB-CIQUZCHMSA-N 0.000 description 1
- PMQXMXAASGFUDX-SRVKXCTJSA-N Ala-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CCCCN PMQXMXAASGFUDX-SRVKXCTJSA-N 0.000 description 1
- VCSABYLVNWQYQE-SRVKXCTJSA-N Ala-Lys-Lys Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CCCCN)C(O)=O VCSABYLVNWQYQE-SRVKXCTJSA-N 0.000 description 1
- OSRZOHXQCUFIQG-FPMFFAJLSA-N Ala-Phe-Pro Chemical compound C([C@H](NC(=O)[C@@H]([NH3+])C)C(=O)N1[C@H](CCC1)C([O-])=O)C1=CC=CC=C1 OSRZOHXQCUFIQG-FPMFFAJLSA-N 0.000 description 1
- CWRBRVZBMVJENN-UVBJJODRSA-N Ala-Trp-Met Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CCSC)C(=O)O)N CWRBRVZBMVJENN-UVBJJODRSA-N 0.000 description 1
- YJHKTAMKPGFJCT-NRPADANISA-N Ala-Val-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O YJHKTAMKPGFJCT-NRPADANISA-N 0.000 description 1
- 101100343585 Arabidopsis thaliana LNG1 gene Proteins 0.000 description 1
- 101100302211 Arabidopsis thaliana RNR2A gene Proteins 0.000 description 1
- PVSNBTCXCQIXSE-JYJNAYRXSA-N Arg-Arg-Phe Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PVSNBTCXCQIXSE-JYJNAYRXSA-N 0.000 description 1
- KMSHNDWHPWXPEC-BQBZGAKWSA-N Arg-Asp-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O KMSHNDWHPWXPEC-BQBZGAKWSA-N 0.000 description 1
- PNQWAUXQDBIJDY-GUBZILKMSA-N Arg-Glu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PNQWAUXQDBIJDY-GUBZILKMSA-N 0.000 description 1
- PZVMBNFTBWQWQL-DCAQKATOSA-N Arg-His-Cys Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N PZVMBNFTBWQWQL-DCAQKATOSA-N 0.000 description 1
- MSILNNHVVMMTHZ-UWVGGRQHSA-N Arg-His-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CN=CN1 MSILNNHVVMMTHZ-UWVGGRQHSA-N 0.000 description 1
- FLYANDHDFRGGTM-PYJNHQTQSA-N Arg-Ile-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N FLYANDHDFRGGTM-PYJNHQTQSA-N 0.000 description 1
- UZGFHWIJWPUPOH-IHRRRGAJSA-N Arg-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N UZGFHWIJWPUPOH-IHRRRGAJSA-N 0.000 description 1
- MJINRRBEMOLJAK-DCAQKATOSA-N Arg-Lys-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCN=C(N)N MJINRRBEMOLJAK-DCAQKATOSA-N 0.000 description 1
- PAPSMOYMQDWIOR-AVGNSLFASA-N Arg-Lys-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O PAPSMOYMQDWIOR-AVGNSLFASA-N 0.000 description 1
- VIINVRPKMUZYOI-DCAQKATOSA-N Arg-Met-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(O)=O VIINVRPKMUZYOI-DCAQKATOSA-N 0.000 description 1
- ASQKVGRCKOFKIU-KZVJFYERSA-N Arg-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)O ASQKVGRCKOFKIU-KZVJFYERSA-N 0.000 description 1
- AIFHRTPABBBHKU-RCWTZXSCSA-N Arg-Thr-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O AIFHRTPABBBHKU-RCWTZXSCSA-N 0.000 description 1
- PYDIIVKGTBRIEL-SZMVWBNQSA-N Arg-Trp-Pro Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N1CCC[C@H]1C(O)=O PYDIIVKGTBRIEL-SZMVWBNQSA-N 0.000 description 1
- JWCCFNZJIRZUCL-AVGNSLFASA-N Arg-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCN=C(N)N JWCCFNZJIRZUCL-AVGNSLFASA-N 0.000 description 1
- LEFKSBYHUGUWLP-ACZMJKKPSA-N Asn-Ala-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O LEFKSBYHUGUWLP-ACZMJKKPSA-N 0.000 description 1
- DQTIWTULBGLJBL-DCAQKATOSA-N Asn-Arg-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(=O)N)N DQTIWTULBGLJBL-DCAQKATOSA-N 0.000 description 1
- PCKRJVZAQZWNKM-WHFBIAKZSA-N Asn-Asn-Gly Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O PCKRJVZAQZWNKM-WHFBIAKZSA-N 0.000 description 1
- XQQVCUIBGYFKDC-OLHMAJIHSA-N Asn-Asp-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XQQVCUIBGYFKDC-OLHMAJIHSA-N 0.000 description 1
- QRHYAUYXBVVDSB-LKXGYXEUSA-N Asn-Cys-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QRHYAUYXBVVDSB-LKXGYXEUSA-N 0.000 description 1
- BXUHCIXDSWRSBS-CIUDSAMLSA-N Asn-Leu-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BXUHCIXDSWRSBS-CIUDSAMLSA-N 0.000 description 1
- JLNFZLNDHONLND-GARJFASQSA-N Asn-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)N)N JLNFZLNDHONLND-GARJFASQSA-N 0.000 description 1
- ORJQQZIXTOYGGH-SRVKXCTJSA-N Asn-Lys-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O ORJQQZIXTOYGGH-SRVKXCTJSA-N 0.000 description 1
- RAUPFUCUDBQYHE-AVGNSLFASA-N Asn-Phe-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O RAUPFUCUDBQYHE-AVGNSLFASA-N 0.000 description 1
- FTNRWCPWDWRPAV-BZSNNMDCSA-N Asn-Phe-Phe Chemical compound C([C@H](NC(=O)[C@H](CC(N)=O)N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 FTNRWCPWDWRPAV-BZSNNMDCSA-N 0.000 description 1
- SVFOIXMRMLROHO-SRVKXCTJSA-N Asp-Asp-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SVFOIXMRMLROHO-SRVKXCTJSA-N 0.000 description 1
- YDJVIBMKAMQPPP-LAEOZQHASA-N Asp-Glu-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O YDJVIBMKAMQPPP-LAEOZQHASA-N 0.000 description 1
- PZXPWHFYZXTFBI-YUMQZZPRSA-N Asp-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(O)=O PZXPWHFYZXTFBI-YUMQZZPRSA-N 0.000 description 1
- KHGPWGKPYHPOIK-QWRGUYRKSA-N Asp-Gly-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O KHGPWGKPYHPOIK-QWRGUYRKSA-N 0.000 description 1
- PGUYEUCYVNZGGV-QWRGUYRKSA-N Asp-Gly-Tyr Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 PGUYEUCYVNZGGV-QWRGUYRKSA-N 0.000 description 1
- WYOSXGYAKZQPGF-SRVKXCTJSA-N Asp-His-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CC(=O)O)N WYOSXGYAKZQPGF-SRVKXCTJSA-N 0.000 description 1
- AYFVRYXNDHBECD-YUMQZZPRSA-N Asp-Leu-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O AYFVRYXNDHBECD-YUMQZZPRSA-N 0.000 description 1
- OEDJQRXNDRUGEU-SRVKXCTJSA-N Asp-Leu-His Chemical compound N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)O OEDJQRXNDRUGEU-SRVKXCTJSA-N 0.000 description 1
- GWIJZUVQVDJHDI-AVGNSLFASA-N Asp-Phe-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O GWIJZUVQVDJHDI-AVGNSLFASA-N 0.000 description 1
- XXAMCEGRCZQGEM-ZLUOBGJFSA-N Asp-Ser-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O XXAMCEGRCZQGEM-ZLUOBGJFSA-N 0.000 description 1
- DRCOAZZDQRCGGP-GHCJXIJMSA-N Asp-Ser-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O DRCOAZZDQRCGGP-GHCJXIJMSA-N 0.000 description 1
- NJLLRXWFPQQPHV-SRVKXCTJSA-N Asp-Tyr-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O NJLLRXWFPQQPHV-SRVKXCTJSA-N 0.000 description 1
- OTKUAVXGMREHRX-CFMVVWHZSA-N Asp-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 OTKUAVXGMREHRX-CFMVVWHZSA-N 0.000 description 1
- XMKXONRMGJXCJV-LAEOZQHASA-N Asp-Val-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O XMKXONRMGJXCJV-LAEOZQHASA-N 0.000 description 1
- 108020004513 Bacterial RNA Proteins 0.000 description 1
- 239000002028 Biomass Substances 0.000 description 1
- 102100026346 Brain-specific angiogenesis inhibitor 1-associated protein 2 Human genes 0.000 description 1
- 101100310593 Candida albicans (strain SC5314 / ATCC MYA-2876) SOD4 gene Proteins 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 102100024829 DNA polymerase delta catalytic subunit Human genes 0.000 description 1
- 102100039301 DNA-directed RNA polymerase II subunit RPB3 Human genes 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 208000031448 Genomic Instability Diseases 0.000 description 1
- RGXXLQWXBFNXTG-CIUDSAMLSA-N Gln-Arg-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O RGXXLQWXBFNXTG-CIUDSAMLSA-N 0.000 description 1
- RMOCFPBLHAOTDU-ACZMJKKPSA-N Gln-Asn-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O RMOCFPBLHAOTDU-ACZMJKKPSA-N 0.000 description 1
- KVXVVDFOZNYYKZ-DCAQKATOSA-N Gln-Gln-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O KVXVVDFOZNYYKZ-DCAQKATOSA-N 0.000 description 1
- DRDSQGHKTLSNEA-GLLZPBPUSA-N Gln-Glu-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DRDSQGHKTLSNEA-GLLZPBPUSA-N 0.000 description 1
- GNMQDOGFWYWPNM-LAEOZQHASA-N Gln-Gly-Ile Chemical compound CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](N)CCC(N)=O)C(O)=O GNMQDOGFWYWPNM-LAEOZQHASA-N 0.000 description 1
- XSBGUANSZDGULP-IUCAKERBSA-N Gln-Gly-Lys Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCCCN)C(O)=O XSBGUANSZDGULP-IUCAKERBSA-N 0.000 description 1
- NSORZJXKUQFEKL-JGVFFNPUSA-N Gln-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CCC(=O)N)N)C(=O)O NSORZJXKUQFEKL-JGVFFNPUSA-N 0.000 description 1
- GLAPJAHOPFSLKL-SRVKXCTJSA-N Gln-His-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCC(=O)N)N GLAPJAHOPFSLKL-SRVKXCTJSA-N 0.000 description 1
- MTCXQQINVAFZKW-MNXVOIDGSA-N Gln-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)N)N MTCXQQINVAFZKW-MNXVOIDGSA-N 0.000 description 1
- IHSGESFHTMFHRB-GUBZILKMSA-N Gln-Lys-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(N)=O IHSGESFHTMFHRB-GUBZILKMSA-N 0.000 description 1
- CGYDXNKRIMJMLV-GUBZILKMSA-N Glu-Arg-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O CGYDXNKRIMJMLV-GUBZILKMSA-N 0.000 description 1
- OJGLIOXAKGFFDW-SRVKXCTJSA-N Glu-Arg-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(=O)O)N OJGLIOXAKGFFDW-SRVKXCTJSA-N 0.000 description 1
- LTUVYLVIZHJCOQ-KKUMJFAQSA-N Glu-Arg-Phe Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O LTUVYLVIZHJCOQ-KKUMJFAQSA-N 0.000 description 1
- AFODTOLGSZQDSL-PEFMBERDSA-N Glu-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)O)N AFODTOLGSZQDSL-PEFMBERDSA-N 0.000 description 1
- LGYZYFFDELZWRS-DCAQKATOSA-N Glu-Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O LGYZYFFDELZWRS-DCAQKATOSA-N 0.000 description 1
- ZSWGJYOZWBHROQ-RWRJDSDZSA-N Glu-Ile-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZSWGJYOZWBHROQ-RWRJDSDZSA-N 0.000 description 1
- IOUQWHIEQYQVFD-JYJNAYRXSA-N Glu-Leu-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O IOUQWHIEQYQVFD-JYJNAYRXSA-N 0.000 description 1
- OQXDUSZKISQQSS-GUBZILKMSA-N Glu-Lys-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OQXDUSZKISQQSS-GUBZILKMSA-N 0.000 description 1
- OCJRHJZKGGSPRW-IUCAKERBSA-N Glu-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O OCJRHJZKGGSPRW-IUCAKERBSA-N 0.000 description 1
- MCGNJCNXIMQCMN-DCAQKATOSA-N Glu-Met-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CCC(O)=O MCGNJCNXIMQCMN-DCAQKATOSA-N 0.000 description 1
- CHDWDBPJOZVZSE-KKUMJFAQSA-N Glu-Phe-Met Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(O)=O CHDWDBPJOZVZSE-KKUMJFAQSA-N 0.000 description 1
- DAHLWSFUXOHMIA-FXQIFTODSA-N Glu-Ser-Gln Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O DAHLWSFUXOHMIA-FXQIFTODSA-N 0.000 description 1
- TWYSSILQABLLME-HJGDQZAQSA-N Glu-Thr-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O TWYSSILQABLLME-HJGDQZAQSA-N 0.000 description 1
- MWTGQXBHVRTCOR-GLLZPBPUSA-N Glu-Thr-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MWTGQXBHVRTCOR-GLLZPBPUSA-N 0.000 description 1
- RGJKYNUINKGPJN-RWRJDSDZSA-N Glu-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(=O)O)N RGJKYNUINKGPJN-RWRJDSDZSA-N 0.000 description 1
- UCZXXMREFIETQW-AVGNSLFASA-N Glu-Tyr-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O UCZXXMREFIETQW-AVGNSLFASA-N 0.000 description 1
- UUTGYDAKPISJAO-JYJNAYRXSA-N Glu-Tyr-Leu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 UUTGYDAKPISJAO-JYJNAYRXSA-N 0.000 description 1
- VIPDPMHGICREIS-GVXVVHGQSA-N Glu-Val-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O VIPDPMHGICREIS-GVXVVHGQSA-N 0.000 description 1
- DWUKOTKSTDWGAE-BQBZGAKWSA-N Gly-Asn-Arg Chemical compound NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DWUKOTKSTDWGAE-BQBZGAKWSA-N 0.000 description 1
- AIJAPFVDBFYNKN-WHFBIAKZSA-N Gly-Asn-Asp Chemical compound C([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)CN)C(=O)N AIJAPFVDBFYNKN-WHFBIAKZSA-N 0.000 description 1
- QSTLUOIOYLYLLF-WDSKDSINSA-N Gly-Asp-Glu Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QSTLUOIOYLYLLF-WDSKDSINSA-N 0.000 description 1
- JUBDONGMHASUCN-IUCAKERBSA-N Gly-Glu-His Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O JUBDONGMHASUCN-IUCAKERBSA-N 0.000 description 1
- BEQGFMIBZFNROK-JGVFFNPUSA-N Gly-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)CN)C(=O)O BEQGFMIBZFNROK-JGVFFNPUSA-N 0.000 description 1
- ORXZVPZCPMKHNR-IUCAKERBSA-N Gly-His-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CNC=N1 ORXZVPZCPMKHNR-IUCAKERBSA-N 0.000 description 1
- CLNSYANKYVMZNM-UWVGGRQHSA-N Gly-Lys-Arg Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CCCN=C(N)N CLNSYANKYVMZNM-UWVGGRQHSA-N 0.000 description 1
- PTIIBFKSLCYQBO-NHCYSSNCSA-N Gly-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CN PTIIBFKSLCYQBO-NHCYSSNCSA-N 0.000 description 1
- JJGBXTYGTKWGAT-YUMQZZPRSA-N Gly-Pro-Glu Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O JJGBXTYGTKWGAT-YUMQZZPRSA-N 0.000 description 1
- CSMYMGFCEJWALV-WDSKDSINSA-N Gly-Ser-Gln Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(N)=O CSMYMGFCEJWALV-WDSKDSINSA-N 0.000 description 1
- WNGHUXFWEWTKAO-YUMQZZPRSA-N Gly-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)CN WNGHUXFWEWTKAO-YUMQZZPRSA-N 0.000 description 1
- GWCJMBNBFYBQCV-XPUUQOCRSA-N Gly-Val-Ala Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O GWCJMBNBFYBQCV-XPUUQOCRSA-N 0.000 description 1
- DCRODRAURLJOFY-XPUUQOCRSA-N His-Ala-Gly Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)NCC(O)=O DCRODRAURLJOFY-XPUUQOCRSA-N 0.000 description 1
- HIAHVKLTHNOENC-HGNGGELXSA-N His-Glu-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O HIAHVKLTHNOENC-HGNGGELXSA-N 0.000 description 1
- OEROYDLRVAYIMQ-YUMQZZPRSA-N His-Gly-Asp Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O OEROYDLRVAYIMQ-YUMQZZPRSA-N 0.000 description 1
- FYTCLUIYTYFGPT-YUMQZZPRSA-N His-Gly-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CO)C(O)=O FYTCLUIYTYFGPT-YUMQZZPRSA-N 0.000 description 1
- XIGFLVCAVQQGNS-IHRRRGAJSA-N His-Pro-His Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 XIGFLVCAVQQGNS-IHRRRGAJSA-N 0.000 description 1
- 101000766212 Homo sapiens Brain-specific angiogenesis inhibitor 1-associated protein 2 Proteins 0.000 description 1
- 101000868333 Homo sapiens Cyclin-dependent kinase 1 Proteins 0.000 description 1
- 101000909198 Homo sapiens DNA polymerase delta catalytic subunit Proteins 0.000 description 1
- 101000669859 Homo sapiens DNA-directed RNA polymerase II subunit RPB3 Proteins 0.000 description 1
- 101000579123 Homo sapiens Phosphoglycerate kinase 1 Proteins 0.000 description 1
- 101001124945 Homo sapiens Pre-mRNA-splicing factor 38A Proteins 0.000 description 1
- 101000836268 Homo sapiens U4/U6.U5 tri-snRNP-associated protein 1 Proteins 0.000 description 1
- 101000649937 Homo sapiens Vacuolar protein sorting-associated protein 28 homolog Proteins 0.000 description 1
- 101000803685 Homo sapiens Vacuolar protein sorting-associated protein 4A Proteins 0.000 description 1
- LQSBBHNVAVNZSX-GHCJXIJMSA-N Ile-Ala-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)N)C(=O)O)N LQSBBHNVAVNZSX-GHCJXIJMSA-N 0.000 description 1
- SCHZQZPYHBWYEQ-PEFMBERDSA-N Ile-Asn-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N SCHZQZPYHBWYEQ-PEFMBERDSA-N 0.000 description 1
- XENGULNPUDGALZ-ZPFDUUQYSA-N Ile-Asn-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)O)N XENGULNPUDGALZ-ZPFDUUQYSA-N 0.000 description 1
- JQLFYZMEXFNRFS-DJFWLOJKSA-N Ile-Asp-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N JQLFYZMEXFNRFS-DJFWLOJKSA-N 0.000 description 1
- KMBPQYKVZBMRMH-PEFMBERDSA-N Ile-Gln-Asn Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O KMBPQYKVZBMRMH-PEFMBERDSA-N 0.000 description 1
- BEWFWZRGBDVXRP-PEFMBERDSA-N Ile-Glu-Asn Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O BEWFWZRGBDVXRP-PEFMBERDSA-N 0.000 description 1
- NZOCIWKZUVUNDW-ZKWXMUAHSA-N Ile-Gly-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O NZOCIWKZUVUNDW-ZKWXMUAHSA-N 0.000 description 1
- UQXADIGYEYBJEI-DJFWLOJKSA-N Ile-His-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC(=O)O)C(=O)O)N UQXADIGYEYBJEI-DJFWLOJKSA-N 0.000 description 1
- WIZPFZKOFZXDQG-HTFCKZLJSA-N Ile-Ile-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O WIZPFZKOFZXDQG-HTFCKZLJSA-N 0.000 description 1
- DBXXASNNDTXOLU-MXAVVETBSA-N Ile-Leu-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N DBXXASNNDTXOLU-MXAVVETBSA-N 0.000 description 1
- OVDKXUDMKXAZIV-ZPFDUUQYSA-N Ile-Lys-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)O)N OVDKXUDMKXAZIV-ZPFDUUQYSA-N 0.000 description 1
- GLYJPWIRLBAIJH-UHFFFAOYSA-N Ile-Lys-Pro Natural products CCC(C)C(N)C(=O)NC(CCCCN)C(=O)N1CCCC1C(O)=O GLYJPWIRLBAIJH-UHFFFAOYSA-N 0.000 description 1
- FHPZJWJWTWZKNA-LLLHUVSDSA-N Ile-Phe-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@@H]2C(=O)O)N FHPZJWJWTWZKNA-LLLHUVSDSA-N 0.000 description 1
- FGBRXCZYVRFNKQ-MXAVVETBSA-N Ile-Phe-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)O)N FGBRXCZYVRFNKQ-MXAVVETBSA-N 0.000 description 1
- XQLGNKLSPYCRMZ-HJWJTTGWSA-N Ile-Phe-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)O)N XQLGNKLSPYCRMZ-HJWJTTGWSA-N 0.000 description 1
- XMYURPUVJSKTMC-KBIXCLLPSA-N Ile-Ser-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N XMYURPUVJSKTMC-KBIXCLLPSA-N 0.000 description 1
- ZNOBVZFCHNHKHA-KBIXCLLPSA-N Ile-Ser-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N ZNOBVZFCHNHKHA-KBIXCLLPSA-N 0.000 description 1
- SAEWJTCJQVZQNZ-IUKAMOBKSA-N Ile-Thr-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SAEWJTCJQVZQNZ-IUKAMOBKSA-N 0.000 description 1
- YCKPUHHMCFSUMD-IUKAMOBKSA-N Ile-Thr-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N YCKPUHHMCFSUMD-IUKAMOBKSA-N 0.000 description 1
- RTSQPLLOYSGMKM-DSYPUSFNSA-N Ile-Trp-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC(C)C)C(=O)O)N RTSQPLLOYSGMKM-DSYPUSFNSA-N 0.000 description 1
- PRTZQMBYUZFSFA-XEGUGMAKSA-N Ile-Tyr-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)NCC(=O)O)N PRTZQMBYUZFSFA-XEGUGMAKSA-N 0.000 description 1
- ZGKVPOSSTGHJAF-HJPIBITLSA-N Ile-Tyr-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CO)C(=O)O)N ZGKVPOSSTGHJAF-HJPIBITLSA-N 0.000 description 1
- 241000500435 Kluyveromyces dobzhanskii Species 0.000 description 1
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- 101000874268 Latilactobacillus curvatus Bioactive peptide 2 Proteins 0.000 description 1
- HASRFYOMVPJRPU-SRVKXCTJSA-N Leu-Arg-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O HASRFYOMVPJRPU-SRVKXCTJSA-N 0.000 description 1
- BPANDPNDMJHFEV-CIUDSAMLSA-N Leu-Asp-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O BPANDPNDMJHFEV-CIUDSAMLSA-N 0.000 description 1
- ZYLJULGXQDNXDK-GUBZILKMSA-N Leu-Gln-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ZYLJULGXQDNXDK-GUBZILKMSA-N 0.000 description 1
- HFBCHNRFRYLZNV-GUBZILKMSA-N Leu-Glu-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HFBCHNRFRYLZNV-GUBZILKMSA-N 0.000 description 1
- NEEOBPIXKWSBRF-IUCAKERBSA-N Leu-Glu-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O NEEOBPIXKWSBRF-IUCAKERBSA-N 0.000 description 1
- ZFNLIDNJUWNIJL-WDCWCFNPSA-N Leu-Glu-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZFNLIDNJUWNIJL-WDCWCFNPSA-N 0.000 description 1
- HMDDEJADNKQTBR-BZSNNMDCSA-N Leu-His-Tyr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O HMDDEJADNKQTBR-BZSNNMDCSA-N 0.000 description 1
- KOSWSHVQIVTVQF-ZPFDUUQYSA-N Leu-Ile-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O KOSWSHVQIVTVQF-ZPFDUUQYSA-N 0.000 description 1
- SEMUSFOBZGKBGW-YTFOTSKYSA-N Leu-Ile-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O SEMUSFOBZGKBGW-YTFOTSKYSA-N 0.000 description 1
- KUIDCYNIEJBZBU-AJNGGQMLSA-N Leu-Ile-Leu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O KUIDCYNIEJBZBU-AJNGGQMLSA-N 0.000 description 1
- JNDYEOUZBLOVOF-AVGNSLFASA-N Leu-Leu-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O JNDYEOUZBLOVOF-AVGNSLFASA-N 0.000 description 1
- KYIIALJHAOIAHF-KKUMJFAQSA-N Leu-Leu-His Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 KYIIALJHAOIAHF-KKUMJFAQSA-N 0.000 description 1
- KPYAOIVPJKPIOU-KKUMJFAQSA-N Leu-Lys-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O KPYAOIVPJKPIOU-KKUMJFAQSA-N 0.000 description 1
- WXZOHBVPVKABQN-DCAQKATOSA-N Leu-Met-Asp Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)O)N WXZOHBVPVKABQN-DCAQKATOSA-N 0.000 description 1
- KTOIECMYZZGVSI-BZSNNMDCSA-N Leu-Phe-His Chemical compound C([C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CC=CC=C1 KTOIECMYZZGVSI-BZSNNMDCSA-N 0.000 description 1
- YWKNKRAKOCLOLH-OEAJRASXSA-N Leu-Phe-Thr Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)O)C(O)=O)CC1=CC=CC=C1 YWKNKRAKOCLOLH-OEAJRASXSA-N 0.000 description 1
- YRRCOJOXAJNSAX-IHRRRGAJSA-N Leu-Pro-Lys Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)O)N YRRCOJOXAJNSAX-IHRRRGAJSA-N 0.000 description 1
- JIHDFWWRYHSAQB-GUBZILKMSA-N Leu-Ser-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O JIHDFWWRYHSAQB-GUBZILKMSA-N 0.000 description 1
- MVHXGBZUJLWZOH-BJDJZHNGSA-N Leu-Ser-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O MVHXGBZUJLWZOH-BJDJZHNGSA-N 0.000 description 1
- ILDSIMPXNFWKLH-KATARQTJSA-N Leu-Thr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ILDSIMPXNFWKLH-KATARQTJSA-N 0.000 description 1
- RIHIGSWBLHSGLV-CQDKDKBSSA-N Leu-Tyr-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O RIHIGSWBLHSGLV-CQDKDKBSSA-N 0.000 description 1
- ISSAURVGLGAPDK-KKUMJFAQSA-N Leu-Tyr-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O ISSAURVGLGAPDK-KKUMJFAQSA-N 0.000 description 1
- YIRIDPUGZKHMHT-ACRUOGEOSA-N Leu-Tyr-Tyr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O YIRIDPUGZKHMHT-ACRUOGEOSA-N 0.000 description 1
- FBNPMTNBFFAMMH-UHFFFAOYSA-N Leu-Val-Arg Natural products CC(C)CC(N)C(=O)NC(C(C)C)C(=O)NC(C(O)=O)CCCN=C(N)N FBNPMTNBFFAMMH-UHFFFAOYSA-N 0.000 description 1
- IRNSXVOWSXSULE-DCAQKATOSA-N Lys-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN IRNSXVOWSXSULE-DCAQKATOSA-N 0.000 description 1
- 108010062166 Lys-Asn-Asp Proteins 0.000 description 1
- ZQCVMVCVPFYXHZ-SRVKXCTJSA-N Lys-Asn-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCCN ZQCVMVCVPFYXHZ-SRVKXCTJSA-N 0.000 description 1
- QUCDKEKDPYISNX-HJGDQZAQSA-N Lys-Asn-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QUCDKEKDPYISNX-HJGDQZAQSA-N 0.000 description 1
- WGCKDDHUFPQSMZ-ZPFDUUQYSA-N Lys-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCCCN WGCKDDHUFPQSMZ-ZPFDUUQYSA-N 0.000 description 1
- MRWXLRGAFDOILG-DCAQKATOSA-N Lys-Gln-Gln Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MRWXLRGAFDOILG-DCAQKATOSA-N 0.000 description 1
- DCRWPTBMWMGADO-AVGNSLFASA-N Lys-Glu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O DCRWPTBMWMGADO-AVGNSLFASA-N 0.000 description 1
- VEGLGAOVLFODGC-GUBZILKMSA-N Lys-Glu-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O VEGLGAOVLFODGC-GUBZILKMSA-N 0.000 description 1
- SLQJJFAVWSZLBL-BJDJZHNGSA-N Lys-Ile-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN SLQJJFAVWSZLBL-BJDJZHNGSA-N 0.000 description 1
- CBNMHRCLYBJIIZ-XUXIUFHCSA-N Lys-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CCCCN)N CBNMHRCLYBJIIZ-XUXIUFHCSA-N 0.000 description 1
- NCZIQZYZPUPMKY-PPCPHDFISA-N Lys-Ile-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NCZIQZYZPUPMKY-PPCPHDFISA-N 0.000 description 1
- WVJNGSFKBKOKRV-AJNGGQMLSA-N Lys-Leu-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WVJNGSFKBKOKRV-AJNGGQMLSA-N 0.000 description 1
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 1
- OIQSIMFSVLLWBX-VOAKCMCISA-N Lys-Leu-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OIQSIMFSVLLWBX-VOAKCMCISA-N 0.000 description 1
- UQRZFMQQXXJTTF-AVGNSLFASA-N Lys-Lys-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O UQRZFMQQXXJTTF-AVGNSLFASA-N 0.000 description 1
- HVAUKHLDSDDROB-KKUMJFAQSA-N Lys-Lys-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HVAUKHLDSDDROB-KKUMJFAQSA-N 0.000 description 1
- WBSCNDJQPKSPII-KKUMJFAQSA-N Lys-Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O WBSCNDJQPKSPII-KKUMJFAQSA-N 0.000 description 1
- YDDDRTIPNTWGIG-SRVKXCTJSA-N Lys-Lys-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O YDDDRTIPNTWGIG-SRVKXCTJSA-N 0.000 description 1
- GOVDTWNJCBRRBJ-DCAQKATOSA-N Lys-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N GOVDTWNJCBRRBJ-DCAQKATOSA-N 0.000 description 1
- CNGOEHJCLVCJHN-SRVKXCTJSA-N Lys-Pro-Glu Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O CNGOEHJCLVCJHN-SRVKXCTJSA-N 0.000 description 1
- PDIDTSZKKFEDMB-UWVGGRQHSA-N Lys-Pro-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O PDIDTSZKKFEDMB-UWVGGRQHSA-N 0.000 description 1
- MGKFCQFVPKOWOL-CIUDSAMLSA-N Lys-Ser-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)N MGKFCQFVPKOWOL-CIUDSAMLSA-N 0.000 description 1
- ZUGVARDEGWMMLK-SRVKXCTJSA-N Lys-Ser-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN ZUGVARDEGWMMLK-SRVKXCTJSA-N 0.000 description 1
- MIFFFXHMAHFACR-KATARQTJSA-N Lys-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN MIFFFXHMAHFACR-KATARQTJSA-N 0.000 description 1
- XYLSGAWRCZECIQ-JYJNAYRXSA-N Lys-Tyr-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(O)=O)CC1=CC=C(O)C=C1 XYLSGAWRCZECIQ-JYJNAYRXSA-N 0.000 description 1
- MIMXMVDLMDMOJD-BZSNNMDCSA-N Lys-Tyr-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O MIMXMVDLMDMOJD-BZSNNMDCSA-N 0.000 description 1
- LMMBAXJRYSXCOQ-ACRUOGEOSA-N Lys-Tyr-Phe Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(O)=O LMMBAXJRYSXCOQ-ACRUOGEOSA-N 0.000 description 1
- UGCIQUYEJIEHKX-GVXVVHGQSA-N Lys-Val-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O UGCIQUYEJIEHKX-GVXVVHGQSA-N 0.000 description 1
- 101150052216 MET8 gene Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- UZVWDRPUTHXQAM-FXQIFTODSA-N Met-Asp-Ala Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O UZVWDRPUTHXQAM-FXQIFTODSA-N 0.000 description 1
- YCUSPBPZVJDMII-YUMQZZPRSA-N Met-Gly-Glu Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O YCUSPBPZVJDMII-YUMQZZPRSA-N 0.000 description 1
- SLQDSYZHHOKQSR-QXEWZRGKSA-N Met-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCSC SLQDSYZHHOKQSR-QXEWZRGKSA-N 0.000 description 1
- JACAKCWAOHKQBV-UWVGGRQHSA-N Met-Gly-Lys Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN JACAKCWAOHKQBV-UWVGGRQHSA-N 0.000 description 1
- XOFDBXYPKZUAAM-GUBZILKMSA-N Met-Met-Ser Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)O)N XOFDBXYPKZUAAM-GUBZILKMSA-N 0.000 description 1
- 102000005431 Molecular Chaperones Human genes 0.000 description 1
- 108010006519 Molecular Chaperones Proteins 0.000 description 1
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 102000011931 Nucleoproteins Human genes 0.000 description 1
- 108010061100 Nucleoproteins Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101100175606 Oryza sativa subsp. japonica AGPL2 gene Proteins 0.000 description 1
- 101700056750 PAK1 Proteins 0.000 description 1
- KJWZYMMLVHIVSU-IYCNHOCDSA-N PGK1 Chemical compound CCCCC[C@H](O)\C=C\[C@@H]1[C@@H](CCCCCCC(O)=O)C(=O)CC1=O KJWZYMMLVHIVSU-IYCNHOCDSA-N 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- LBSARGIQACMGDF-WBAXXEDZSA-N Phe-Ala-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 LBSARGIQACMGDF-WBAXXEDZSA-N 0.000 description 1
- LDSOBEJVGGVWGD-DLOVCJGASA-N Phe-Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 LDSOBEJVGGVWGD-DLOVCJGASA-N 0.000 description 1
- WMGVYPPIMZPWPN-SRVKXCTJSA-N Phe-Asp-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N WMGVYPPIMZPWPN-SRVKXCTJSA-N 0.000 description 1
- LXUJDHOKVUYHRC-KKUMJFAQSA-N Phe-Cys-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC1=CC=CC=C1)N LXUJDHOKVUYHRC-KKUMJFAQSA-N 0.000 description 1
- KYYMILWEGJYPQZ-IHRRRGAJSA-N Phe-Glu-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 KYYMILWEGJYPQZ-IHRRRGAJSA-N 0.000 description 1
- UAMFZRNCIFFMLE-FHWLQOOXSA-N Phe-Glu-Tyr Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N UAMFZRNCIFFMLE-FHWLQOOXSA-N 0.000 description 1
- FINLZXKJWTYYLC-ACRUOGEOSA-N Phe-His-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 FINLZXKJWTYYLC-ACRUOGEOSA-N 0.000 description 1
- OSBADCBXAMSPQD-YESZJQIVSA-N Phe-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N OSBADCBXAMSPQD-YESZJQIVSA-N 0.000 description 1
- XNMYNGDKJNOKHH-BZSNNMDCSA-N Phe-Ser-Tyr Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O XNMYNGDKJNOKHH-BZSNNMDCSA-N 0.000 description 1
- ZTVSVSFBHUVYIN-UFYCRDLUSA-N Phe-Tyr-Met Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC=CC=1)C1=CC=C(O)C=C1 ZTVSVSFBHUVYIN-UFYCRDLUSA-N 0.000 description 1
- 102100028251 Phosphoglycerate kinase 1 Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 229920000604 Polyethylene Glycol 200 Polymers 0.000 description 1
- 102100029435 Pre-mRNA-splicing factor 38A Human genes 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- APKRGYLBSCWJJP-FXQIFTODSA-N Pro-Ala-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O APKRGYLBSCWJJP-FXQIFTODSA-N 0.000 description 1
- ONPFOYPPPOHMNH-UVBJJODRSA-N Pro-Ala-Trp Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@@H]3CCCN3 ONPFOYPPPOHMNH-UVBJJODRSA-N 0.000 description 1
- LCRSGSIRKLXZMZ-BPNCWPANSA-N Pro-Ala-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LCRSGSIRKLXZMZ-BPNCWPANSA-N 0.000 description 1
- NHDVNAKDACFHPX-GUBZILKMSA-N Pro-Arg-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O NHDVNAKDACFHPX-GUBZILKMSA-N 0.000 description 1
- SMCHPSMKAFIERP-FXQIFTODSA-N Pro-Asn-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]1CCCN1 SMCHPSMKAFIERP-FXQIFTODSA-N 0.000 description 1
- SWXSLPHTJVAWDF-VEVYYDQMSA-N Pro-Asn-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SWXSLPHTJVAWDF-VEVYYDQMSA-N 0.000 description 1
- HXOLCSYHGRNXJJ-IHRRRGAJSA-N Pro-Asp-Phe Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O HXOLCSYHGRNXJJ-IHRRRGAJSA-N 0.000 description 1
- DXTOOBDIIAJZBJ-BQBZGAKWSA-N Pro-Gly-Ser Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(O)=O DXTOOBDIIAJZBJ-BQBZGAKWSA-N 0.000 description 1
- AFXCXDQNRXTSBD-FJXKBIBVSA-N Pro-Gly-Thr Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O AFXCXDQNRXTSBD-FJXKBIBVSA-N 0.000 description 1
- BODDREDDDRZUCF-QTKMDUPCSA-N Pro-His-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@@H]2CCCN2)O BODDREDDDRZUCF-QTKMDUPCSA-N 0.000 description 1
- VTFXTWDFPTWNJY-RHYQMDGZSA-N Pro-Leu-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VTFXTWDFPTWNJY-RHYQMDGZSA-N 0.000 description 1
- INDVYIOKMXFQFM-SRVKXCTJSA-N Pro-Lys-Gln Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)N)C(=O)O INDVYIOKMXFQFM-SRVKXCTJSA-N 0.000 description 1
- XQPHBAKJJJZOBX-SRVKXCTJSA-N Pro-Lys-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O XQPHBAKJJJZOBX-SRVKXCTJSA-N 0.000 description 1
- SMFQZMGHCODUPQ-ULQDDVLXSA-N Pro-Lys-Phe Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SMFQZMGHCODUPQ-ULQDDVLXSA-N 0.000 description 1
- ULWBBFKQBDNGOY-RWMBFGLXSA-N Pro-Lys-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCCCN)C(=O)N2CCC[C@@H]2C(=O)O ULWBBFKQBDNGOY-RWMBFGLXSA-N 0.000 description 1
- GFHOSBYCLACKEK-GUBZILKMSA-N Pro-Pro-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O GFHOSBYCLACKEK-GUBZILKMSA-N 0.000 description 1
- KBUAPZAZPWNYSW-SRVKXCTJSA-N Pro-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 KBUAPZAZPWNYSW-SRVKXCTJSA-N 0.000 description 1
- OOZJHTXCLJUODH-QXEWZRGKSA-N Pro-Val-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 OOZJHTXCLJUODH-QXEWZRGKSA-N 0.000 description 1
- FHJQROWZEJFZPO-SRVKXCTJSA-N Pro-Val-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 FHJQROWZEJFZPO-SRVKXCTJSA-N 0.000 description 1
- MYHXHCUNDDAEOZ-UHFFFAOYSA-N Prostaglandin A&2% Natural products CCCCCC(O)C=CC1C=CC(=O)C1CC=CCCCC(O)=O MYHXHCUNDDAEOZ-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 1
- 101150002896 RNR2 gene Proteins 0.000 description 1
- 102100022851 Rab5 GDP/GTP exchange factor Human genes 0.000 description 1
- 101710203837 Replication-associated protein Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 108091006419 SLC25A12 Proteins 0.000 description 1
- 101100010928 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) tuf gene Proteins 0.000 description 1
- 101100010514 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) DUG3 gene Proteins 0.000 description 1
- 101100232474 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) IES1 gene Proteins 0.000 description 1
- 101100190148 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PGA2 gene Proteins 0.000 description 1
- 101100101631 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) UGA2 gene Proteins 0.000 description 1
- 241000235346 Schizosaccharomyces Species 0.000 description 1
- QFBNNYNWKYKVJO-DCAQKATOSA-N Ser-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CCCN=C(N)N QFBNNYNWKYKVJO-DCAQKATOSA-N 0.000 description 1
- FTVRVZNYIYWJGB-ACZMJKKPSA-N Ser-Asp-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O FTVRVZNYIYWJGB-ACZMJKKPSA-N 0.000 description 1
- OLIJLNWFEQEFDM-SRVKXCTJSA-N Ser-Asp-Phe Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 OLIJLNWFEQEFDM-SRVKXCTJSA-N 0.000 description 1
- VQBCMLMPEWPUTB-ACZMJKKPSA-N Ser-Glu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O VQBCMLMPEWPUTB-ACZMJKKPSA-N 0.000 description 1
- OHKFXGKHSJKKAL-NRPADANISA-N Ser-Glu-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O OHKFXGKHSJKKAL-NRPADANISA-N 0.000 description 1
- LQESNKGTTNHZPZ-GHCJXIJMSA-N Ser-Ile-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O LQESNKGTTNHZPZ-GHCJXIJMSA-N 0.000 description 1
- HDBOEVPDIDDEPC-CIUDSAMLSA-N Ser-Lys-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O HDBOEVPDIDDEPC-CIUDSAMLSA-N 0.000 description 1
- PPNPDKGQRFSCAC-CIUDSAMLSA-N Ser-Lys-Asp Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(O)=O)C(O)=O PPNPDKGQRFSCAC-CIUDSAMLSA-N 0.000 description 1
- OCWWJBZQXGYQCA-DCAQKATOSA-N Ser-Lys-Met Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(O)=O OCWWJBZQXGYQCA-DCAQKATOSA-N 0.000 description 1
- AXOHAHIUJHCLQR-IHRRRGAJSA-N Ser-Met-Tyr Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CO)N AXOHAHIUJHCLQR-IHRRRGAJSA-N 0.000 description 1
- CKDXFSPMIDSMGV-GUBZILKMSA-N Ser-Pro-Val Chemical compound [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O CKDXFSPMIDSMGV-GUBZILKMSA-N 0.000 description 1
- KQNDIKOYWZTZIX-FXQIFTODSA-N Ser-Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCNC(N)=N KQNDIKOYWZTZIX-FXQIFTODSA-N 0.000 description 1
- AABIBDJHSKIMJK-FXQIFTODSA-N Ser-Ser-Met Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(O)=O AABIBDJHSKIMJK-FXQIFTODSA-N 0.000 description 1
- VGQVAVQWKJLIRM-FXQIFTODSA-N Ser-Ser-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O VGQVAVQWKJLIRM-FXQIFTODSA-N 0.000 description 1
- SZRNDHWMVSFPSP-XKBZYTNZSA-N Ser-Thr-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CO)N)O SZRNDHWMVSFPSP-XKBZYTNZSA-N 0.000 description 1
- QNBVFKZSSRYNFX-CUJWVEQBSA-N Ser-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CO)N)O QNBVFKZSSRYNFX-CUJWVEQBSA-N 0.000 description 1
- LLSLRQOEAFCZLW-NRPADANISA-N Ser-Val-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O LLSLRQOEAFCZLW-NRPADANISA-N 0.000 description 1
- 102100031206 Serine/threonine-protein kinase N1 Human genes 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 101150001810 TEAD1 gene Proteins 0.000 description 1
- 101150074253 TEF1 gene Proteins 0.000 description 1
- 101150110861 TRM2 gene Proteins 0.000 description 1
- DCCGCVLVVSAJFK-NUMRIWBASA-N Thr-Asp-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N)O DCCGCVLVVSAJFK-NUMRIWBASA-N 0.000 description 1
- BNGDYRRHRGOPHX-IFFSRLJSSA-N Thr-Glu-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O BNGDYRRHRGOPHX-IFFSRLJSSA-N 0.000 description 1
- MSIYNSBKKVMGFO-BHNWBGBOSA-N Thr-Gly-Pro Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)N1CCC[C@@H]1C(=O)O)N)O MSIYNSBKKVMGFO-BHNWBGBOSA-N 0.000 description 1
- AHOLTQCAVBSUDP-PPCPHDFISA-N Thr-Ile-Lys Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O AHOLTQCAVBSUDP-PPCPHDFISA-N 0.000 description 1
- FLPZMPOZGYPBEN-PPCPHDFISA-N Thr-Leu-Ile Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FLPZMPOZGYPBEN-PPCPHDFISA-N 0.000 description 1
- VGYVVSQFSSKZRJ-OEAJRASXSA-N Thr-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@H](O)C)CC1=CC=CC=C1 VGYVVSQFSSKZRJ-OEAJRASXSA-N 0.000 description 1
- PRTHQBSMXILLPC-XGEHTFHBSA-N Thr-Ser-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O PRTHQBSMXILLPC-XGEHTFHBSA-N 0.000 description 1
- XHWCDRUPDNSDAZ-XKBZYTNZSA-N Thr-Ser-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O XHWCDRUPDNSDAZ-XKBZYTNZSA-N 0.000 description 1
- QGVBFDIREUUSHX-IFFSRLJSSA-N Thr-Val-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O QGVBFDIREUUSHX-IFFSRLJSSA-N 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102100029898 Transcriptional enhancer factor TEF-1 Human genes 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- SSNGFWKILJLTQM-QEJZJMRPSA-N Trp-Gln-Asn Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SSNGFWKILJLTQM-QEJZJMRPSA-N 0.000 description 1
- CCZXBOFIBYQLEV-IHPCNDPISA-N Trp-Leu-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(O)=O CCZXBOFIBYQLEV-IHPCNDPISA-N 0.000 description 1
- LFMLXCJYCFZBKE-IHPCNDPISA-N Trp-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)N LFMLXCJYCFZBKE-IHPCNDPISA-N 0.000 description 1
- DDHFMBDACJYSKW-AQZXSJQPSA-N Trp-Thr-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N)O DDHFMBDACJYSKW-AQZXSJQPSA-N 0.000 description 1
- VCXWRWYFJLXITF-AUTRQRHGSA-N Tyr-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 VCXWRWYFJLXITF-AUTRQRHGSA-N 0.000 description 1
- BSCBBPKDVOZICB-KKUMJFAQSA-N Tyr-Leu-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BSCBBPKDVOZICB-KKUMJFAQSA-N 0.000 description 1
- NHOVZGFNTGMYMI-KKUMJFAQSA-N Tyr-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NHOVZGFNTGMYMI-KKUMJFAQSA-N 0.000 description 1
- 102100027244 U4/U6.U5 tri-snRNP-associated protein 1 Human genes 0.000 description 1
- 102000003436 UBA3 Human genes 0.000 description 1
- 108060008744 UBA3 Proteins 0.000 description 1
- 102100028227 Vacuolar protein sorting-associated protein 28 homolog Human genes 0.000 description 1
- 102100035085 Vacuolar protein sorting-associated protein 4A Human genes 0.000 description 1
- ZLFHAAGHGQBQQN-GUBZILKMSA-N Val-Ala-Pro Natural products CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O ZLFHAAGHGQBQQN-GUBZILKMSA-N 0.000 description 1
- VDPRBUOZLIFUIM-GUBZILKMSA-N Val-Arg-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](C(C)C)N VDPRBUOZLIFUIM-GUBZILKMSA-N 0.000 description 1
- QHFQQRKNGCXTHL-AUTRQRHGSA-N Val-Gln-Glu Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QHFQQRKNGCXTHL-AUTRQRHGSA-N 0.000 description 1
- RKIGNDAHUOOIMJ-BQFCYCMXSA-N Val-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)C(C)C)C(O)=O)=CNC2=C1 RKIGNDAHUOOIMJ-BQFCYCMXSA-N 0.000 description 1
- UEHRGZCNLSWGHK-DLOVCJGASA-N Val-Glu-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UEHRGZCNLSWGHK-DLOVCJGASA-N 0.000 description 1
- PIFJAFRUVWZRKR-QMMMGPOBSA-N Val-Gly-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O PIFJAFRUVWZRKR-QMMMGPOBSA-N 0.000 description 1
- LAYSXAOGWHKNED-XPUUQOCRSA-N Val-Gly-Ser Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O LAYSXAOGWHKNED-XPUUQOCRSA-N 0.000 description 1
- WNZSAUMKZQXHNC-UKJIMTQDSA-N Val-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N WNZSAUMKZQXHNC-UKJIMTQDSA-N 0.000 description 1
- XTDDIVQWDXMRJL-IHRRRGAJSA-N Val-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N XTDDIVQWDXMRJL-IHRRRGAJSA-N 0.000 description 1
- XXWBHOWRARMUOC-NHCYSSNCSA-N Val-Lys-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)O)N XXWBHOWRARMUOC-NHCYSSNCSA-N 0.000 description 1
- CXWJFWAZIVWBOS-XQQFMLRXSA-N Val-Lys-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)O)N CXWJFWAZIVWBOS-XQQFMLRXSA-N 0.000 description 1
- XPKCFQZDQGVJCX-RHYQMDGZSA-N Val-Lys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C(C)C)N)O XPKCFQZDQGVJCX-RHYQMDGZSA-N 0.000 description 1
- VPGCVZRRBYOGCD-AVGNSLFASA-N Val-Lys-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O VPGCVZRRBYOGCD-AVGNSLFASA-N 0.000 description 1
- SJRUJQFQVLMZFW-WPRPVWTQSA-N Val-Pro-Gly Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O SJRUJQFQVLMZFW-WPRPVWTQSA-N 0.000 description 1
- PDDJTOSAVNRJRH-UNQGMJICSA-N Val-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](C(C)C)N)O PDDJTOSAVNRJRH-UNQGMJICSA-N 0.000 description 1
- VVIZITNVZUAEMI-DLOVCJGASA-N Val-Val-Gln Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCC(N)=O VVIZITNVZUAEMI-DLOVCJGASA-N 0.000 description 1
- LLJLBRRXKZTTRD-GUBZILKMSA-N Val-Val-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)O)N LLJLBRRXKZTTRD-GUBZILKMSA-N 0.000 description 1
- CUJRVFIICFDLGR-UHFFFAOYSA-N acetylacetonate Chemical compound CC(=O)[CH-]C(C)=O CUJRVFIICFDLGR-UHFFFAOYSA-N 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 1
- 108010008685 alanyl-glutamyl-aspartic acid Proteins 0.000 description 1
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000006286 aqueous extract Substances 0.000 description 1
- OIRDTQYFTABQOQ-UHFFFAOYSA-N ara-adenosine Natural products Nc1ncnc2n(cnc12)C1OC(CO)C(O)C1O OIRDTQYFTABQOQ-UHFFFAOYSA-N 0.000 description 1
- 108010018691 arginyl-threonyl-arginine Proteins 0.000 description 1
- 238000005842 biochemical reaction Methods 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 238000011072 cell harvest Methods 0.000 description 1
- 230000006790 cellular biosynthetic process Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical group [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- WDRWZVWLVBXVOI-QTNFYWBSSA-L dipotassium;(2s)-2-aminopentanedioate Chemical compound [K+].[K+].[O-]C(=O)[C@@H](N)CCC([O-])=O WDRWZVWLVBXVOI-QTNFYWBSSA-L 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 150000004662 dithiols Chemical class 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000006355 external stress Effects 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000034659 glycolysis Effects 0.000 description 1
- 108010027668 glycyl-alanyl-valine Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 1
- 108010033706 glycylserine Proteins 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000005184 irreversible process Methods 0.000 description 1
- 108010047926 leucyl-lysyl-tyrosine Proteins 0.000 description 1
- 108010003700 lysyl aspartic acid Proteins 0.000 description 1
- 108010025153 lysyl-alanyl-alanine Proteins 0.000 description 1
- 108010057952 lysyl-phenylalanyl-lysine Proteins 0.000 description 1
- 108010009298 lysylglutamic acid Proteins 0.000 description 1
- 108010038320 lysylphenylalanine Proteins 0.000 description 1
- 235000013918 magnesium diglutamate Nutrition 0.000 description 1
- 229940063886 magnesium glutamate Drugs 0.000 description 1
- MYUGVHJLXONYNC-QHTZZOMLSA-J magnesium;(2s)-2-aminopentanedioate Chemical compound [Mg+2].[O-]C(=O)[C@@H](N)CCC([O-])=O.[O-]C(=O)[C@@H](N)CCC([O-])=O MYUGVHJLXONYNC-QHTZZOMLSA-J 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 235000013919 monopotassium glutamate Nutrition 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 108010012581 phenylalanylglutamate Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- MYHXHCUNDDAEOZ-FOSBLDSVSA-N prostaglandin A2 Chemical compound CCCCC[C@H](O)\C=C\[C@H]1C=CC(=O)[C@@H]1C\C=C/CCCC(O)=O MYHXHCUNDDAEOZ-FOSBLDSVSA-N 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000014424 regulation of RNA biosynthetic process Effects 0.000 description 1
- 230000009712 regulation of translation Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 210000001995 reticulocyte Anatomy 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000013515 script Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 102000023888 sequence-specific DNA binding proteins Human genes 0.000 description 1
- 108091008420 sequence-specific DNA binding proteins Proteins 0.000 description 1
- 108010069117 seryl-lysyl-aspartic acid Proteins 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 108010078580 tyrosylleucine Proteins 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
- C12N15/815—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts for yeasts other than Saccharomyces
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/67—General methods for enhancing the expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Mycology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention provides a method for improving the efficiency of in vitro protein synthesis, in particular to a genetic engineering strain for in vitro cell-free protein synthesis, wherein a first exogenous gene expression cassette for expressing a first nucleic acid construct of a first fusion protein is integrated in the genome of the genetic engineering strain, and the expression or activity of KlEXN53 gene (nuclease gene) is reduced in the genetic engineering strain. The cell extract (such as yeast cell extract) derived from the engineering strain can obviously improve the stability of nucleic acid, does not need additional manual addition of T7RNA polymerase, and obviously improves the efficiency of producing protein by an in vitro protein synthesis system.
Description
The scheme is a divisional application proposed by the invention and creation of a Chinese patent application entitled "a method for improving protein synthesis efficiency in cells" based on application date 2018, 1, 31 and application number 201810093624.0.
Technical Field
The invention relates to the technical field of biology, in particular to a method for improving in-vitro protein synthesis efficiency in cells.
Background
Proteins are important molecules in cells, and are involved in performing almost all functions of cells. The difference in the sequence and structure of the protein determines the difference in its function. In cells, proteins can catalyze various biochemical reactions as enzymes, can coordinate various activities of organisms as signaling molecules, can support biological morphology, store energy, transport molecules, and move organisms. In the biomedical field, protein antibodies are important means for treating diseases such as cancer as targeted drugs[1-2]。
In cells, the production of proteins involves both gene transcription and mRNA translation.
Gene transcription refers to a process of synthesizing one RNA by using one strand of DNA as a template and 4 NTPs (ATP, CTP, GTP and UTP) as raw materials under the catalytic action of DNA-dependent RNA polymerase (RNP or RNAP) according to the base complementary pairing principle. For some RNA viruses, RNA may also direct the synthesis of RNA.
The translation of mRNA into protein refers to a process of assembling activated amino acids into protein polypeptide chains on ribosomes (also called nucleoproteins) by using mRNA as a template and tRNA as a carrier under the action of enzymes and cofactors.
Regulation of protein synthesis plays an important role in many processes, including transcriptional and translational regulation, such as responding to external stresses such as nutrient deprivation, and cell development and differentiation.
Transcriptional regulation refers to the regulation of RNA synthesis using DNA as a template, and all cells have a large number of sequence-specific DNA binding proteins (trans-acting factors) that can accurately recognize and bind to specific DNA sequences (cis-acting elements), and act as switches at the transcriptional level. Transcriptional level regulation is an important link in eukaryotic gene expression regulation. Depending on whether eukaryotic gene expression is affected by the environment, one can classify the expression into: developmental regulation and transient regulation. Wherein, the development regulation refers to the regulation and control of the eukaryotic organism to ensure the self growth, development, differentiation and the like of the eukaryotic organism to the gene expression according to the procedures of 'reservation' and 'order', and is an irreversible process; transient regulation refers to adaptive transcriptional regulation by eukaryotes under stimulation of internal and external environments, and is a reversible process.
Four processes of translational regulation include translation initiation, translation elongation, translation termination, and ribosome recirculation, where translation initiation is the most regulated one[3]. During the translation initiation phase, the ribosomal small subunit (40S) binds (tRNA)i MetAnd recognizes the 5' end of mRNA by the action of a translation initiation factor. The small subunit moves downstream and binds to the ribosomal large subunit (60S) at the initiation codon (AUG) to form an intact ribosome, and enters the translation elongation stage[4]。
The biosynthesis systems currently in use are in vivo biosynthesis systems and in vitro biosynthesis systems. The in vivo biosynthesis system refers to a general term for the process of synthesizing various compounds catalyzed by enzymes in an in vivo system, i.e., assimilation reaction in vivo, and includes photosynthesis, gluconeogenesis, and biosynthesis of nucleotides, nucleic acids, and proteins. Protein synthesis is quantitatively the most important in cellular biosynthesis. Protein biosynthesis is also known as translation, the process by which the sequence of bases in an mRNA molecule is converted into the sequence of amino acids in a protein or polypeptide chain. Protein biosynthesis is divided into five stages, activation of amino acids, initiation of polypeptide chain synthesis, extension of peptide chains, termination and release of peptide chains, and processing modification after protein synthesis.
An in vitro biosynthesis system refers to the efficient in vitro synthesis of specific chemical molecules or biological macromolecules (DNA, RNA, proteins) in a lysis system of bacteria, fungi, plant cells or animal cells by adding exogenously encoded nucleic acid DNA, RNA, substrates and energy sources. A common in vitro biosynthesis system is an in vitro protein synthesis system (cell-free protein synthesis system), which uses exogenous mRNA or DNA template and cell lysate to complete the rapid and efficient translation of exogenous recombinant protein[5]。
The cell-free system can be traced to the earliestBuchner in 1897 suggested that biosynthesis could be performed in vitro, and that it demonstrated bioethanol production by a yeast cell-free system. However, due to Adenosine Triphosphate (ATP) imbalance, this system is not suitable for large-scale application[6]. Welch and Scopes solved the above problem in 1985 by various explorations, obtaining high yields of ethanol, but this system also has two major drawbacks: requires additional addition of costly enzymes and is not tolerant to temperature changes[7]. However, there are some inherent problematic issues with this technology: such as reversibility, instability, leakage, inactivation, recycling of enzymes, lack of stable enzymes, enzyme complexes and cofactors.
A commercially common in vitro protein synthesis system is an in vitro transcription-translation coupling system (IVTT), which transcribes an mRNA intermediate by RNA polymerase through a DNA template, and then completes one-step efficient translation of a foreign protein by using amino acids, ATP, and other components. Currently, common commercial in vitro protein expression systems include Escherichia Coli Extract (ECE) system, Rabbit ReticuLocyte (RRL) system, Wheat Germ (WGE) system, Insect Cell Extract (ICE) system, and human-derived system.
High versatility in the inheritance of endogenous regulatory mechanisms is required when cell-free expression systems are used for in vitro protein synthesis. Currently available regulatory mechanisms are limited by the physiological background of biomass at the time of cell harvest (rapid growth). For example, only one sigma factor is present in cell-free extracts, and transcriptional modularity is still poor.
Therefore, there is an urgent need in the art to develop a novel in vitro translation system that can regulate both transcription and translation, thereby improving stability and resistance, reducing production costs, and increasing the yield of protein synthesis.
Disclosure of Invention
The invention aims to provide a novel in vitro translation system which regulates and controls the aspects of transcription and translation, thereby improving the stability and resistance, reducing the production cost and improving the yield of protein synthesis.
Another objective of the invention is to provide a method for realizing stable and efficient expression of foreign proteins by creating a novel in vitro translation system through various types of genome modification and artificial modification of cells integrating endogenous gene expression, protein translation and nucleic acid stability control.
In a first aspect, the invention provides a genetically engineered strain for in vitro cell-free protein synthesis, the genetically engineered strain having integrated into its genome a first exogenous gene expression cassette expressing a first nucleic acid construct of a first fusion protein; the first fusion protein has the structure of formula Ia or formula Ib:
S-A-B-C (Ia)
S-C-B-A (Ib);
in the formula (I), the compound is shown in the specification,
a is a PabI element;
b is nothing or a connecting peptide;
c is an eIF4G element;
s is an optional signal peptide, wherein each "-" is a peptide bond;
and, in the genetically engineered strain, expression or activity of KlEXN53 gene (a nuclease gene) is reduced.
In another preferred embodiment, the genome of said genetically engineered strain further integrates into it a second exogenous gene expression cassette expressing a second nucleic acid construct having a structure of formula II from 5 'to 3':
Z1-Z2 (II)
in the formula (I), the compound is shown in the specification,
z1 and Z2 are elements for constituting the construct respectively;
each "-" is independently a bond or a nucleotide linking sequence;
z1 is a promoter element selected from the group consisting of: RNR2, PRP38, TEF1, PGK1, AGC1, IES1, MET8, PAK1, UBA3, VPS4, CDC2, UGA2, DUG3, VPS28, APL2, RAP1, TRM2, RPB3, PGA2, BAP2, ARA1, or a combination thereof;
z2 is the coding sequence of RNP protein.
In another preferred embodiment, the expression "reduced" means that the expression level of the EXN53 gene is 10% or less, preferably 5% or less, more preferably 2% or less.
In another preferred embodiment, the expression "decrease" means that the expression or activity of the EXN53 gene is decreased to satisfy the following condition:
the ratio of A1/A0 is less than or equal to 30%, preferably less than or equal to 10%, more preferably less than or equal to 5%, still more preferably less than or equal to 2%, most preferably 0-2%;
wherein, A1 is the expression or activity of EXN53 gene; a0 is the expression or activity of the wild-type EXN53 gene.
In another preferred example, the expression or activity of the EXN53 gene (nuclease gene) in the strain is reduced by a means selected from the group consisting of: gene mutation, gene knockout, gene disruption, RNA interference techniques, criprpr techniques, or a combination thereof.
In another preferred embodiment, the formula Ia or Ib is a structure from N-terminus to C-terminus.
In another preferred embodiment, said element a comprises the wildtype and mutant PabI sequences.
In another preferred embodiment, the PabI is PabI from a cell (e.g., yeast).
In another preferred embodiment, element A has the sequence shown in SEQ ID NO.1 or an active fragment thereof or a polypeptide which has a homology of > 85% (preferably > 90% homology; etc. preferably > 95% homology; most preferably > 97% homology, e.g. 98% or more, 99% or more) with the amino acid sequence shown in SEQ ID NO.1 and which has the same activity as the sequence shown in SEQ ID NO. 1.
In another preferred embodiment, the element C includes wild-type and mutant eIF4G sequences.
In another preferred embodiment, eIF4G is eIF4G from a cell (e.g., yeast).
In another preferred embodiment, element C has the sequence shown in SEQ ID NO.2 or an active fragment thereof or a polypeptide which has a homology of > 85% (preferably > 90% homology; etc. preferably > 95% homology; most preferably > 97% homology, e.g. 98% or more, 99% or more) with the amino acid sequence shown in SEQ ID NO.2 and which has the same activity as the sequence shown in SEQ ID NO. 2.
In another preferred embodiment, the first fusion protein is a recombinant protein, preferably a recombinant protein expressed by cells, including prokaryotic and eukaryotic cells.
In another preferred embodiment, the cell is selected from the group consisting of: e.coli, bacteria, mammalian cells (e.g., HF9, Hela, CHO, HEK293), plant cells, yeast cells, insect cells, or combinations thereof.
In another preferred embodiment, the cell is selected from the group consisting of: hela, CHO, HF9, E μ Myc, HEK293, BY-2, yeast, or combinations thereof.
In another preferred embodiment, the first fusion protein is a recombinant protein expressed by yeast.
In another preferred embodiment, said element A is derived from the PabI protein of a cell, such as a yeast.
In another preferred embodiment, element C is derived from the eIF4G protein of a cell (e.g., yeast).
In another preferred embodiment, the first fusion protein is selected from the group consisting of:
(A) a polypeptide having an amino acid sequence shown in SEQ ID NO. 3; (B) a polypeptide having homology of not less than 80% (preferably, not less than 90% homology; etc., preferably, not less than 95% homology; most preferably, not less than 97% homology, such as 98% or more, 99% or more) with the amino acid sequence shown in SEQ ID NO.3, and having a function or activity of improving the expression efficiency of a foreign protein;
(C) 3 by substitution, deletion or addition of 1-15 (preferably, 2-10, more preferably, 3-8) amino acid residues, and has the function or activity of improving the expression efficiency of the foreign protein.
In another preferred embodiment, the amino acid sequence of the first fusion protein is shown in SEQ ID NO. 3.
In another preferred embodiment, the first fusion protein has one or more properties selected from the group consisting of:
(a) the expression efficiency of the foreign protein is improved;
(b) improving the in vitro translation efficiency.
In another preferred embodiment, the foreign protein is selected from the group consisting of: luciferin protein, luciferase (e.g., firefly luciferase), green fluorescent protein, yellow fluorescent protein, aminoacyl tRNA synthetase, glyceraldehyde-3-phosphate dehydrogenase, catalase, actin, variable region of an antibody, luciferase mutation, alpha-amylase, enteromycin A, hepatitis C virus E2 glycoprotein, insulin precursor, interferon alpha A, interleukin-1 beta, lysozyme, serum albumin, single chain antibody fragment (scFV), transthyretin, tyrosinase, xylanase, or a combination thereof.
In another preferred embodiment, the Z1, Z2 is derived from a cell (e.g., yeast).
In another preferred embodiment, the promoter element is selected from the group consisting of: ScRNR2, ScADH1, ScGAPDH, ScTEF1, ScPGK1, ScSED1, KlRNR2, KlADH1, KlGAPDH, KlTEF1, KlPGK1, KlSED1, ies1, KlMET8, KlPAK1, KlSOK1, KlUBA3, KlVPS4, KlAGC1, KlCDC2, KlDUG3, klprprp 38, KlUGA2, KlVPS28, ScAPL2, ScARA1, ScBAP2, ScPGA2, ScRAP1, ScRPB3, ScTRM2, or a combination thereof.
In another preferred embodiment, the promoter element has an intensity of + -20% - + -50% of the promoter ScRNR2, based on the promoter ScRNR 2.
In another preferred embodiment, the strength of the promoter ScRNR2 is based on the number of transcripts.
In another preferred embodiment, the promoter strength refers to the ability of a promoter to regulate the transcription expression level of a downstream coding gene, wherein an increase in promoter strength increases the transcription expression level of the downstream coding gene, and a decrease in promoter strength decreases the transcription expression level of the downstream coding gene.
In another preferred embodiment, the RNP protein is selected from the group consisting of: a T7RNAP protein, a T3RNAP, a T4RNAP, a T5RNAP, a SP6 RNAP, a SP3, or a combination thereof.
In another preferred embodiment, the peptide linker is 0-50 amino acids, preferably 10-40 amino acids, more preferably 15-25 amino acids in length. In SEQ ID NO.3, the peptide linker has a length of 30 amino acids corresponding to position 593-622 of SEQ ID NO.3 and has an amino acid sequence of Gly Gly Gly Gly Ser Gly Gly Gly Gly SerThr Gln Asp Glu Val Gln Gly Pro His Ala Gly Lys Ser Thr Val Gly Gly Gly GlySer.
In another preferred embodiment, the yeast is selected from the group consisting of: saccharomyces cerevisiae, Kluyveromyces yeast, or a combination thereof.
In another preferred embodiment, the yeast of the genus kluyveromyces is selected from the group consisting of: kluyveromyces lactis, Kluyveromyces marxianus, Kluyveromyces polybranhanskii (Kluyveromyces dobzhanskii), or a combination thereof.
In another preferred embodiment, the sequence of the second nucleic acid construct is as shown in SEQ ID NO. 4.
In another preferred example, the EXN53 gene is derived from yeast from one or more sources selected from the group consisting of: pichia pastoris, Kluyveromyces, preferably from Kluyveromyces.
In another preferred example, the kluyveromyces includes kluyveromyces marxianus, and/or kluyveromyces lactis.
In another preferred embodiment, the nucleotide sequence of EXN53 is shown in SEQ ID NO. 5.
In another preferred embodiment, the protein sequence of EXN53 is shown in SEQ ID NO. 6.
In another preferred embodiment, the strain is selected from the group consisting of: a kluyveromyces strain, a pichia strain, a saccharomyces cerevisiae strain, a schizosaccharomyces strain, or a combination thereof.
In a second aspect, the invention provides a use of the genetically engineered strain of the first aspect of the invention to improve the efficiency of in vitro protein synthesis.
In a third aspect, the present invention provides a cell-free cell extract derived from the genetically engineered strain of the first aspect of the present invention.
In another preferred embodiment, the cell extract is a soluble cell extract.
In another preferred embodiment, the cell extract is derived from one or more cells selected from the group consisting of: e.coli, bacteria, mammalian cells (e.g., HF9, Hela, CHO, HEK293), plant cells, yeast cells, insect cells, or combinations thereof.
In another preferred embodiment, the cell extract is derived from one or more cells selected from the group consisting of: hela, CHO, HF9, E μ Myc, HEK293, BY-2, yeast, or combinations thereof.
In another preferred embodiment, the cell extract comprises a yeast cell extract.
In another preferred embodiment, the yeast cell is a yeast from one or more sources selected from the group consisting of: pichia pastoris, Kluyveromyces, or combinations thereof; preferably, the yeast cell comprises: kluyveromyces, more preferably Kluyveromyces marxianus and/or Kluyveromyces lactis.
In another preferred embodiment, the yeast cell extract is an aqueous extract of yeast cells.
In another preferred embodiment, the yeast cell extract does not contain long-chain nucleic acid molecules endogenous to yeast.
In another preferred embodiment, the yeast cell extract is prepared by a method comprising the steps of:
(i) providing a yeast cell;
(ii) washing the yeast cells to obtain washed yeast cells;
(iii) performing cell breaking treatment on the washed yeast cells to obtain a yeast crude extract; and
(iv) and carrying out solid-liquid separation on the yeast crude extract to obtain a liquid part, namely the yeast cell extract.
In another preferred embodiment, the solid-liquid separation comprises centrifugation.
In another preferred embodiment, the centrifugation is carried out in the liquid state.
In another preferred embodiment, the centrifugation condition is 5000-.
In another preferred embodiment, the centrifugation time is 0.5min to 2h, preferably 20 to 50 min.
In another preferred embodiment, the centrifugation is carried out at 1-10 ℃, preferably at 2-6 ℃.
In another preferred embodiment, the washing treatment is carried out using a washing solution at a pH of 7 to 8 (preferably, 7.4).
In another preferred embodiment, the washing solution is selected from the group consisting of: potassium 4-hydroxyethylpiperazine ethanesulfonate, potassium acetate, magnesium acetate, or a combination thereof.
In another preferred example, the cell disruption treatment comprises high-pressure disruption, freeze-thawing (such as liquid nitrogen low temperature) disruption.
In a fourth aspect, the invention provides an in vitro cell-free protein synthesis system comprising a cell extract according to the third aspect of the invention.
In another preferred embodiment, the protein synthesis system consists of or consists essentially of a cell extract according to the third aspect of the invention.
In another preferred embodiment, the cell-free protein synthesis system does not additionally add RNP protein.
In another preferred embodiment, the RNP protein is selected from the group consisting of: a T7RNAP protein, a T3RNAP, a T4RNAP, a T5RNAP, a SP6 RNAP, a SP3, or a combination thereof.
In another preferred embodiment, the cell-free protein synthesis system further comprises one or more components selected from the group consisting of:
(b) polyethylene glycol;
(c) optionally exogenous sucrose; and
(d) optionally a solvent, which is water or an aqueous solvent.
In another preferred embodiment, the cell-free protein synthesis system further comprises one or more components selected from the group consisting of:
(e1) a substrate for RNA synthesis;
(e2) a substrate for synthesizing a protein;
(e3) magnesium ions;
(e4) potassium ions;
(e5) a buffering agent;
(e6) an RNA polymerase;
(e7) an energy regeneration system.
In another preferred embodiment, the cell-free protein synthesis system further comprises one or more components selected from the group consisting of:
(e8) heme;
(e9) spermidine.
In another preferred embodiment, the substrate for synthesizing RNA comprises: nucleoside monophosphates, nucleoside triphosphates, or combinations thereof.
In another preferred embodiment, the substrate of the synthetic protein comprises: 1-20 kinds of natural amino acids and non-natural amino acids.
In another preferred embodiment, the magnesium ion is derived from a magnesium ion source selected from the group consisting of: magnesium acetate, magnesium glutamate, or a combination thereof.
In another preferred embodiment, the potassium ion is derived from a potassium ion source selected from the group consisting of: potassium acetate, potassium glutamate, or a combination thereof.
In another preferred embodiment, the energy regeneration system is selected from the group consisting of: a phosphocreatine/phosphocreatine enzyme system, a glycolytic pathway and its intermediate energy system, or a combination thereof.
In another preferred embodiment, the cell-free protein synthesis system further comprises (f1) an artificially synthesized tRNA.
In another preferred embodiment, the buffer is selected from the group consisting of: 4-hydroxyethylpiperazine ethanesulfonic acid, tris, or a combination thereof.
In another preferred embodiment, the cell-free protein synthesis system further comprises (g1) an exogenous DNA molecule for directing protein synthesis.
In another preferred embodiment, the DNA molecule is linear.
In another preferred embodiment, the DNA molecule is circular.
In another preferred embodiment, the DNA molecule comprises a sequence encoding a foreign protein.
In another preferred embodiment, the sequence encoding the foreign protein includes a genomic sequence and a cDNA sequence.
In another preferred embodiment, the sequence encoding the foreign protein further comprises a promoter sequence, a 5 'untranslated sequence, and a 3' untranslated sequence.
In another preferred embodiment, the cell-free protein synthesis system comprises a component selected from the group consisting of: 4-hydroxyethylpiperazine ethanesulfonic acid, potassium acetate, magnesium acetate, nucleoside triphosphates, amino acids, phosphocreatine, Dithiothreitol (DTT), phosphocreatine kinase, RNA polymerase, or a combination thereof.
In another preferred embodiment, the polyethylene glycol is selected from the group consisting of: PEG3000, PEG8000, PEG6000, PEG3350, or combinations thereof.
In another preferred embodiment, the polyethylene glycol comprises polyethylene glycol with molecular weight (Da) of 200-.
In another preferred embodiment, the concentration (w/v, e.g., g/ml) of component (b) in the protein synthesis system is 0.1-8%, preferably 0.5-4%, more preferably 1-2%.
In another preferred embodiment, the concentration of component (c) in the protein synthesis system is 0.03 to 40 wt%, preferably 0.08 to 10 wt%, more preferably 0.1 to 5 wt%, based on the total weight of the protein synthesis system.
In another preferred embodiment, the concentration of component (c) in the protein synthesis system is 0.2 to 4%, preferably 0.5 to 4%, more preferably 0.5 to 1%, based on the total volume of the protein synthesis system.
In another preferred embodiment, the nucleoside triphosphate is selected from the group consisting of: adenosine triphosphate, guanosine triphosphate, cytosine nucleoside triphosphate, uracil nucleoside triphosphate, or combinations thereof.
In another preferred embodiment, the concentration of component (e1) in the protein synthesis system is 0.1-5mM, preferably 0.5-3 mM, more preferably 1-1.5 mM.
In another preferred embodiment, the amino acid is selected from the group consisting of: glycine, alanine, valine, leucine, isoleucine, phenylalanine, proline, tryptophan, serine, tyrosine, cysteine, methionine, asparagine, glutamine, threonine, aspartic acid, glutamic acid, lysine, arginine, histidine, or combinations thereof.
In another preferred embodiment, the amino acids include D-form amino acids and/or L-form amino acids.
In another preferred embodiment, the concentration of said component (e2) in said protein synthesis system is 0.01-0.48mM, preferably 0.04-0.24mM, more preferably 0.04-0.2mM, most preferably 0.08 mM.
In another preferred embodiment, the concentration of said component (e3) in said protein synthesis system is 1-10mM, preferably 1-5mM, more preferably 2-4 mM.
In another preferred embodiment, the concentration of said component (e4) in said protein synthesis system is 30-210mM, preferably 30-150mM, more preferably 30-60 mM.
In another preferred embodiment, the concentration of the component (e6) in the protein synthesis system is 0.01-0.3mg/mL, preferably 0.02-0.1mg/mL, more preferably 0.027-0.054 mg/mL.
In another preferred embodiment, the concentration of 4-hydroxyethylpiperazine ethanesulfonic acid in the protein synthesis system is 5-50mM, preferably 10-50mM, preferably 15-30mM, more preferably 20-25 mM.
In another preferred embodiment, the concentration of potassium acetate in the protein synthesis system is 20-210mM, preferably 30-150mM, more preferably 30-60 mM.
In another preferred embodiment, the concentration of magnesium acetate in the protein synthesis system is 1-10mM, preferably 1-5mM, more preferably 2-4 mM.
In another preferred embodiment, the concentration of said creatine phosphate in said protein synthesis system is 10-50mM, preferably 20-30mM, more preferably 25 mM.
In another preferred embodiment, the concentration of heme in said protein synthesis system is in the range of 0.01 to 0.1mM, preferably 0.02 to 0.08mM, more preferably 0.03 to 0.05mM, most preferably 0.04 mM.
In another preferred embodiment, the concentration of spermidine in the protein synthesis system is 0.05 to 1mM, preferably 0.1 to 0.8mM, more preferably 0.2 to 0.5mM, more preferably 0.3 to 0.4mM, most preferably 0.4 mM.
In another preferred embodiment, the concentration of Dithiothreitol (DTT) in the protein synthesis system is 0.2-15mM, preferably 0.2-7mM, more preferably 1-2 mM.
In another preferred embodiment, the concentration of phosphocreatine kinase in the protein synthesis system is 0.1-1mg/mL, preferably 0.2-0.5mg/mL, more preferably 0.27 mg/mL.
In another preferred embodiment, the RNA polymerase is T7RNA polymerase.
In another preferred embodiment, the concentration of the T7RNA polymerase in the protein synthesis system is 0.01-0.3mg/mL, preferably 0.02-0.1mg/mL, more preferably 0.027-0.054 mg/mL.
In another preferred embodiment, the cell-free in vitro synthesis system has the following properties:
in the synthesis system, the total protein synthesis amount reaches 200 mug protein/mL system.
In another preferred embodiment, the cell-free protein synthesis system comprises:
in another preferred embodiment, the composition of the cell-free protein synthesis system further comprises:
general scope preferred scope
Spermidine, 0.2-0.4mM 0.3-0.4 mM;
heme 0.01-0.04mM 0.03-0.04 mM.
In another preferred embodiment, the PEG is selected from PEG3350, PEG3000, and/or PEG 8000.
In a fifth aspect, the present invention provides a method for in vitro protein synthesis, comprising the steps of:
(i) providing an in vitro cell-free protein synthesis system according to the fourth aspect of the invention, and adding exogenous DNA molecules for directing protein synthesis;
(ii) (ii) incubating the protein synthesis system of step (i) under suitable conditions for a period of time T1, thereby synthesizing the protein encoded by the exogenous DNA.
In another preferred example, the method further comprises: (iii) optionally isolating or detecting said protein encoded by the foreign DNA from said protein synthesis system.
In another preferred embodiment, the exogenous DNA is from a prokaryote or a eukaryote.
In another preferred embodiment, the exogenous DNA is from an animal, plant, pathogen.
In another preferred embodiment, the exogenous DNA is from a mammal, preferably a primate, a rodent, including a human, a mouse, a rat.
In another preferred embodiment, the coding sequence of the foreign protein encodes a foreign protein selected from the group consisting of: luciferin protein, luciferase (e.g., firefly luciferase), green fluorescent protein, yellow fluorescent protein, aminoacyl tRNA synthetase, glyceraldehyde-3-phosphate dehydrogenase, catalase, actin, variable region of an antibody, luciferase mutant, alpha-amylase, enteromycin A, hepatitis C virus E2 glycoprotein, insulin precursor, interferon alpha A, interleukin-1 beta, lysozyme, serum albumin, single chain antibody fragment (scFV), transthyretin, tyrosinase, xylanase, or a combination thereof.
In another preferred embodiment, the foreign protein is selected from the group consisting of: luciferin protein, luciferase (e.g., firefly luciferase), green fluorescent protein, yellow fluorescent protein, aminoacyl tRNA synthetase, glyceraldehyde-3-phosphate dehydrogenase, catalase, actin, variable region of an antibody, luciferase mutation, alpha-amylase, enteromycin A, hepatitis C virus E2 glycoprotein, insulin precursor, interferon alpha A, interleukin-1 beta, lysozyme, serum albumin, single chain antibody fragment (scFV), transthyretin, tyrosinase, xylanase, or a combination thereof.
In another preferred embodiment, the exogenous DNA encodes an exogenous protein selected from the group consisting of: luciferin protein, luciferase (e.g., firefly luciferase), green fluorescent protein, yellow fluorescent protein, aminoacyl tRNA synthetase, glyceraldehyde-3-phosphate dehydrogenase, catalase, actin, variable region of an antibody, luciferase mutant, alpha-amylase, enteromycin A, hepatitis C virus E2 glycoprotein, insulin precursor, interferon alpha A, interleukin-1 beta, lysozyme, serum albumin, single chain antibody fragment (scFV), transthyretin, tyrosinase, xylanase, or a combination thereof.
In another preferred embodiment, the exogenous DNA encodes a protein selected from the group consisting of: luciferin protein, luciferase (e.g., firefly luciferase), green fluorescent protein, yellow fluorescent protein, aminoacyl tRNA synthetase, glyceraldehyde-3-phosphate dehydrogenase, catalase, actin, variable region of an antibody, luciferase mutation, alpha-amylase, enteromycin A, hepatitis C virus E2 glycoprotein, insulin precursor, interferon alpha A, interleukin-1 beta, lysozyme, serum albumin, single chain antibody fragment (scFV), transthyretin, tyrosinase, xylanase, or a combination thereof.
In another preferred embodiment, in the step (ii), the reaction temperature is 20 to 37 ℃, preferably 20 to 25 ℃.
In another preferred embodiment, in the step (ii), the reaction time is 1 to 6 hours, preferably 2 to 4 hours.
It is to be understood that within the scope of the present invention, the above-described features of the present invention and those specifically described below (e.g., in the examples) may be combined with each other to form new or preferred embodiments. Not to be reiterated herein, but to the extent of space.
Drawings
FIG. 1 shows a schematic representation of the regulation of biosynthetic responses by controlling gene transcription, translation, and nucleic acid stability.
FIG. 2 shows a schematic of a design of artificially engineered cells integrating endogenous gene expression, protein translation, and nucleic acid stability control. Fig. 2A is a diagram of a genetically engineered CRISPR system in the k.lactis genome forming the fusion protein PabI-eIF4G, and fig. 2B is a diagram of a genetically engineered CRISPR system in the k.lactis genome with the nuclease KlEXN53 knockout, endogenously expressing a RNA polymerase with the specific strength promoter pScRNR 2-T7.
FIG. 3 shows a pHoCas9_ SE _ tRNA _ ScRNR2_ KlPAB1-gRNA1 plasmid map. The gRNA1 of KlPAB1 is 1 gRNA in the ORF of KlPAB1 gene, and has tRNA-Tyr promoter and SNR52 terminator, and the plasmid has kana selection marker.
FIG. 4 shows a map of the KlPAB1-30Linker-KleIF4G-DD1-pMD18 plasmid. HR1 and HR2 are the gene sequences of about 1000bp upstream and downstream of ORF of KlPAB1 gene, and the plasmid has Amp screening marker.
FIG. 5 shows a pHoCas9_ SE _ Kana _ tRNA _ ScRNR2_ KlEXN53-gRNA1&3 plasmid map. The gRNA1 and the gRNA3 of KlEXN53 are two gRNAs at the 5 'end and the 3' end of an ORF of KlEXN53 gene respectively, and are provided with a tRNA-Tyr promoter and an SNR52 terminator, and plasmids are provided with kana selection markers.
FIG. 6 shows a map of the KlEXN53-pScRNR2-T7 RNP-DD1-pMD18 plasmid. HR1 and HR2 are the gene sequences of about 1000bp upstream and downstream of ORF of KlEXN53 gene, and the plasmid has Amp screening marker.
FIG. 7 shows a graph of in vitro translational activity assay data for engineered strains. The fluorescent intensity of the firefly fluorescent protein (Fluc) is used to indicate the synthesis capacity of the recombinant protein of the in vitro biosynthesis system. Wherein wt represents wild type Kluyveromyces and 3in1 represents Klexn53 delta-pScRNR 2-T7RNP & KlPAB1-KleIF4G yeast strain, i.e., a yeast strain in which KlexN53 gene is knocked out and replaced with pScRNR2-T7RNP having a promoter of specific strength, while KlPAB1 and KleIF4G form a fusion protein.
FIG. 8 shows data obtained from in vitro translation activity assay of the engineered 3in1 strain with or without the addition of T7 RNP. The fluorescent intensity of the firefly fluorescent protein (Fluc) is used to indicate the synthesis capacity of the recombinant protein of the in vitro biosynthesis system.
FIG. 9 summarizes the regulation of in vitro synthesis by transcription, translation regulation and nuclease stabilization to achieve stable, efficient and rapid expression of foreign proteins.
Detailed Description
The present inventors have made extensive and intensive studies to construct, through extensive screening and investigation, a genetically engineered strain particularly suitable for in vitro protein synthesis, having incorporated into its genome (i) a first exogenous gene expression cassette expressing a first nucleic acid construct of a first fusion protein, such as a fusion protein formed by KlPAB1 and KleIF 4G; and simultaneously reduces the expression or activity of nuclease (such as KlEXN53) in the engineering strain of the invention. Experiments show that the cell-free extract based on the engineering strain unexpectedly synergistically and remarkably improves the protein synthesis efficiency of an in vitro cell-free protein synthesis system. Preferably, the engineered strain of the invention may incorporate a second exogenous gene expression cassette expressing a second nucleic acid construct (e.g., promoter pScRNR2-T7RNP), and a cell extract (e.g., yeast cell extract) derived from the engineered strain of the invention may significantly improve the stability of the nucleic acid without the need for additional manual addition of T7RNP and significantly improve the efficiency of protein production in an in vitro protein synthesis system. On this basis, the present inventors have completed the present invention.
Experiments show that the luciferase activity of the strain in IVTT is more than or equal to 5 times that of a wild type strain when the T7RNP is not required to be added additionally.
Term(s) for
As used herein, the terms "engineered strain" and "genetically engineered strain" are used interchangeably and refer to the engineered strain of the invention for use in increasing the efficiency of in vitro protein synthesis, i.e., the strain of the first aspect of the invention.
eIF4F element
In eukaryotes, a variety of translation initiation factors are involved in the protein translation initiation process (Table 1). Among them, eIF4F is responsible for recognition of "cap structures" and recruitment of downstream translation initiation factors and ribosomes. eIF4F is composed of three protein subunits: eIF4E, eIF4G, and eIF 4A. eIF4E specifically binds to a "cap structure" anchoring eIF4F in the 5' untranslated region of mRNA; eIF4A is an RNA helicase; eIF4G is a scaffold protein for almost the entire translation initiation process, and it interacts with multiple translation initiation factors and plays an important role in the recruitment of downstream factors.
TABLE 1 translation initiation factor in Yeast
In the present invention, the in vitro protein synthesis capacity is enhanced by inserting a constitutive or inducible promoter (e.g., pScTEF1, pScPGK1, pKlTEF1, pkltgk 1, pscaldh 1, pScTPI1, pScTDH3, pklaladh 1, pKlTPI1, pKlTDH3, etc.) of yeast origin (e.g., saccharomyces cerevisiae, kluyveromyces, etc.) before eIF 4G.
In a preferred embodiment, the nucleotide sequence of eIF4G is set forth in SEQ ID No. 7; the protein sequence of the eIF4G is shown in SEQ ID NO. 2.
ATGGGCGAACCTACATCCGATCAGCAACCAGCTGTTGAAGCTCCAGTTGTGCAGGA GGAGACAACCAGTTCTCCGCAAAAAAACAGTGGATATGTCAAGAATACTGCTGGA AGCGGTGCTCCTAGAAATGGGAAATATGATGGTAACAGGAAGAACTCTAGGCCTT ATAACCAAAGAGGTAACAACAACAATAATAATGGTTCTTCCTCGAATAAGCACTAT CAAAAGTATAACCAACCAGCGTACGGTGTTTCTGCGGGATACATTCCGAACTACGG CGTATCGGCAGAGTACAACCCTCTGTACTATAACCAGTACCAACAGCAGCAACAGCTGTACGCTGCTGCTTACCAGACTCCAATGAGCGGACAAGGTTATGTCCCCCCAGTA GTGTCTCCAGCTGCTGTTTCAGCTAAACCAGCGAAGGTTGAGATTACTAACAAGTC TGGTGAACACATAGATATTGCTTCCATTGCTCATCCACATACTCATTCTCATTCTCA ATCTCATTCGCGTGCAGTTCCAGTAGTGTCGCCTCCAGCTAACGTTACCGTCGCTGC TGCTGTATCATCCTCTGTGTCTCCATCAGCTTCTCCAGCTGTCAAAGTACAGAGCCC TGCTGCTAATGGTAAGGAACAATCTCCAGCTAAGCCTGAAGAACCAAAGAAGGAC ACTTTAATTGTGAACGATTTCTTGGAACAAGTTAAAAGACGCAAGGCTGCTTTAGC TGCTAAGAAGGCTGTCGAAGAGAAGGGTCCTGAGGAACCGAAGGAATCTGTCGTT GGAACTGACACTGATGCAAGCGTTGATACTAAGACAGGGCCTACAGCCACTGAAT CTGCCAAGTCTGAAGAAGCTCAATCAGAATCACAAGAAAAGACTAAGGAAGAGGC TCCAGCTGAGCCAAAACCATTGACTTTGGCCGAAAAATTGAGACTTAAGAGGATGG AAGCTGCAAAGCAAGCTTCTGCTAAGACCGAGGAACTAAAGACTGAAGAATCTAA GCCTGAAGAAACAAAGACCGAGGAGCTAAAGACTGAAGAATCTAAGCCTGAAGAA ACAAAGACCGAGGAGCTAAAGACTGAAGAAACAAAGTCCGAGGAACTAAAGACTGAAGAACCTAAGGCGGAAGAATCAAAGGCGGAAGAACCAAAGCCTGAAGAACCA AAGACCGAGGAACCGACGACTGAACAACCAAAGTCAGATGAACCAAAGTCGGAA GAATCAAAAACTGAAGAGCCAAAAACCGAGGTATTAAAGACTGAAGAACCAAAAT CGGAAGAATCAAAGCCTGCAGAACCAAAGACTGAAGAAACAGCAACTGAAGAAA CAGCAACTGAAGCAAACGCCGAAGAAGGTGAACCGGCTCCTGCTGGTCCCGTTGA AACTCCTGCTGATGTTGAAACAAAACCTCGAGAAGAGGCTGAAGTTGAAGACGAT GGAAAGATTACCATGACCGATTTCCTACAGAAGTTGAAAGAGGTTTCTCCAGTTGA TGATATTTATTCCTTCCAATACCCAAGTGACATTACGCCTCCAAATGATAGATATAA AAAGACAAGCATTAAATATGCATACGGACCTGATTTCTTGTATCAGTTCAAAGAAA AGGTCGATGTTAAATACGATCCAGCGTGGATGGCTGAAATGACGAGTAAAATTGTC ATCCCTCCTAAGAAGCCTGGTTCAAGCGGAAGAGGCGAAGATAGATTTAGTAAGG GTAAGGTTGGATCTCTAAGAAGTGAAGGCAGATCGGGTTCCAGGTCCAACTCGAA GAAGAAGTCAAAGAGGGATGATAGAAAATCTAATAGATCATACACTTCCAGAAAG GACCGTGAAAGATTCAGAGAGGAAGAAGTCGAAGAGCCAAAGGTTGAGGTTGCCC CATTGGTCCCAAGTGCTAATAGATGGGTTCCTAAATCTAAGATGAAGAAAACAGAA GTCAAGTTAGCTCCAGACGGAACAGAACTTTACGACGCGGAAGAAGCATCAAGAA AGATGAAGTCATTGCTGAATAAATTGACATTAGAAATGTTCGAACCTATTTCTGAT GATATCATGAAGATCGCTAACCAATCTAGATGGGAAGAAAAGGGTGAGACTTTGA AGATTGTCATCCAACAAATTTTCAATAAGGCCTGCGATGAACCTCATTGGTCATCA ATGTACGCGCAATTATGTGGTAAGGTCGTTAAAGACTTAGATGATAGCATTAAAGA CTCAGAAACCCCAGATAAGACTGGTTCTCACTTGGTTTTGCATTACTTAGTCCAAAG ATGTCAAACTGAATTCCAAACAGGATGGACTGATCAACTACCTACAAACGAAGAC GGTACTCCTCTACAACCTGAAATGATGTCCGATGAATACTATAAGATGGCTGCCGC TAAGAGAAGAGGTTTGGGTTTGGTTCGTTTCATTGGTTTCTTGTACCGTTCGAACTT ATTGACTTCCAGAATGGTCTTCTTCTGTTTCAAGAGACTAATGAAGGATATTCAAA ACTCTCCTACTGAAGATACTCTAGAGTCTGTATGTGAACTTTTGGAAACAATTGGTG AACAGTTCGAAGGTGCTCGTATTCAAGTTACTGCAGAAGCTGTCATTGAGGGTTCA AGCTTGCTAGACACACTATTCGACCAAATAAAGAACGTGATCGAAAATGGTGACAT CTCCAGCAGAATCAAGTTTAAGTTGATCGACATTGTCGAACTAAGAGAAAAGAGG AACTGGAATAGTAAAAATAAGAACGATGGTCCAAAGACCATTGCTCAAATTCACG AAGAAGAAGCCTTGAAGAGGGCTTTGGAGGAAAGAGAAAGAGAAAGAGATCGCC ATGGGTCCAGAGGTGGTTCCAGACGTATGAATAGCGAGAGAAACTCTTCTAGAAG AGATTTCTCCTCTCATTCTCACAGTCACAATCAAAATAGAGACGGTTTCACTACTAC CAGATCGTCATCAGTGAGATATTCTGAGCCAAAGAAGGAAGAACAAGCTCCAACT CCAACTAAATCTTCTGGTGGCGCTGCCAACATGTTTGATGCATTGATGGATGCCGAAGATGATTAA(SEQ ID NO.7)
MGEPTSDQQPAVEAPVVQEETTSSPQKNSGYVKNTAGSGAPRNGKYDGNRK NSRPYNQRGNNNNNNGSSSNKHYQKYNQPAYGVSAGYIPNYGVSAEYNPLYYNQ YQQQQQLYAAAYQTPMSGQGYVPPVVSPAAVSAKPAKVEITNKSGEHIDIASIAHP HTHSHSQSHSRAVPVVSPPANVTVAAAVSSSVSPSASPAVKVQSPAANGKEQSPAKPEEPKKDTLIVNDFLEQVKRRKAALAAKKAVEEKGPEEPKESVVGTDTDASVDTKT GPTATESAKSEEAQSESQEKTKEEAPAEPKPLTLAEKLRLKRMEAAKQASAKTEEL KTEESKPEETKTEELKTEESKPEETKTEELKTEETKSEELKTEEPKAEESKAEEPKPE EPKTEEPTTEQPKSDEPKSEESKTEEPKTEVLKTEEPKSEESKPAEPKTEETATEETAT EANAEEGEPAPAGPVETPADVETKPREEAEVEDDGKITMTDFLQKLKEVSPVDDIY SFQYPSDITPPNDRYKKTSIKYAYGPDFLYQFKEKVDVKYDPAWMAEMTSKIVIPP KKPGSSGRGEDRFSKGKVGSLRSEGRSGSRSNSKKKSKRDDRKSNRSYTSRKDRER FREEEVEEPKVEVAPLVPSANRWVPKSKMKKTEVKLAPDGTELYDAEEASRKMKS LLNKLTLEMFEPISDDIMKIANQSRWEEKGETLKIVIQQIFNKACDEPHWSSMYAQL CGKVVKDLDDSIKDSETPDKTGSHLVLHYLVQRCQTEFQTGWTDQLPTNEDGTPL QPEMMSDEYYKMAAAKRRGLGLVRFIGFLYRSNLLTSRMVFFCFKRLMKDIQNSP TEDTLESVCELLETIGEQFEGARIQVTAEAVIEGSSLLDTLFDQIKNVIENGDISSRIKF KLIDIVELREKRNWNSKNKNDGPKTIAQIHEEEALKRALEERERERDRHGSRGGSRR MNSERNSSRRDFSSHSHSHNQNRDGFTTTRSSSVRYSEPKKEEQAPTPTKSSGGAAN MFDALMDAEDD(SEQ ID NO.2)
Pab1 element (Pab1 protein or PabI protein)
Pab1 is a 71kDa RNA-binding protein consisting of 4 RRM (RNA recognition motif 1-4) domains and 1 MLLE domain. Each RRM domain contains 2 conserved RNP structures (RNP1/2) responsible for binding to RNA.
In a preferred embodiment, the nucleotide sequence of Pab1 is set forth in SEQ ID NO. 8; the protein sequence of Pab1 is shown in SEQ ID NO. 1.
ATGTCTGATATTACTGAAAAAACTGCTGAGCAATTGGAAAACTTGCAGATCA ACGATGATCAGCAACCAGCTCAATCTGCCAGTGCTCCATCCACTTCTGCTTCTGAA AGCGAAGCTTCTTCTGTTTCTAAGGTTGAAAACAACAACGCTTCATTGTACGTTGGT GAATTGGATCCAAACATTACTGAAGCATTGTTGTACGATGTGTTTTCACCATTGGGT CCAATTTCCTCGATCCGTGTTTGTCGTGATGCCGTCACCAAGGCTTCGTTAGGTTAC GCTTACGTTAACTATACTGATTACGAAGCTGGTAAGAAAGCTATTCAAGAATTGAA CTATGCTGAAATCAACGGTAGACCATGTAGAATTATGTGGTCCGAACGTGACCCAG CTATCAGAAAGAAGGGTTCTGGTAACATTTTCATCAAGAACTTGCACCCAGCCATT GACAACAAGGCTTTGCATGAAACTTTCTCCACTTTCGGTGAAGTCTTGTCTTGTAAA GTTGCTTTAGATGAGAATGGAAACTCTAGAGGCTTCGGTTTCGTTCATTTCAAGGA AGAATCCGATGCTAAGGATGCTATTGAAGCCGTCAACGGTATGTTGATGAACGGTT TGGAAGTTTACGTTGCCATGCACGTTCCAAAGAAGGACCGTATCTCCAAGTTGGAA GAAGCCAAGGCTAACTTCACCAACATTTACGTCAAGAACATTGACGTTGAAACCAC TGACGAAGAGTTCGAACAGTTGTTCTCCCAATACGGTGAAATTGTCTCTGCTGCTTT GGAAAAGGATGCTGAGGGTAAGCCAAAGGGTTTCGGTTTCGTTAACTTTGTTGACC ACAACGCCGCTGCCAAGGCCGTTGAAGAGTTGAACGGTAAGGAATTCAAGTCTCA AGCTTTGTACGTTGGCAGAGCTCAAAAGAAGTACGAACGTGCTGAAGAATTGAAG AAACAATACGAACAATACCGTTTGGAAAAATTGGCTAAGTTCCAAGGTGTTAACTT GTTCATCAAGAACTTGGACGATTCCATCGATGACGAAAAATTGAAGGAAGAATTCG CCCCATACGGTACCATCACCTCTGCTAGAGTCATGAGAGACCAAGAGGGTAACTCT AAGGGTTTCGGTTTCGTTTGTTTCTCTTCTCCAGAAGAAGCTACCAAGGCTATGACC GAAAAGAACCAACAAATTGTTGCCGGTAAGCCATTGTACGTTGCCATTGCTCAAAG AAAGGATGTCAGAAGATCCCAATTGGCTCAACAAATTCAAGCCAGAAACCAAATC AGATTCCAACAACAGCAACAACAACAAGCTGCTGCCGCTGCTGCTGGTATGCCAGG CCAATACATGCCACAAATGTTCTATGGTGTTATGGCCCCAAGAGGTTTCCCAGGTC CAAACCCAGGTATGAACGGCCCAATGGGTGCCGGTATTCCAAAGAACGGTATGGT CCCACCACCACAACAATTTGCTGGTAGACCAAACGGTCCAATGTACCAAGGTATGC CACCTCAAAACCAATTCCCAAGACACCAACAACAACACTACATCCAACAACAAAA GCAAAGACAAGCCTTGGGTGAACAATTGTACAAGAAGGTCAGTGCCAAGATTGAC GACGAAAACGCCGCTGGTAAGATCACCGGTATGATCTTGGATCTACCACCACAGCA AGTCATCCAATTGTTGGACAACGACGAACAATTTGAACAGCAATTCCAAGAAGCCT TAGCTGCTTACGAAAACTTCAAGAAGGAACAAGAAGCTCAAGCTTAA(SEQ IDNO.8)
MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLY VGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE LNYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCK VALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISK LEEAKANFTNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFV DHNAAAKAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQG VNLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKA MTEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQIRFQQQQQQQAAAAAAG MPGQYMPQMFYGVMAPRGFPGPNPGMNGPMGAGIPKNGMVPPPQQFAGRPNGP MYQGMPPQNQFPRHQQQHYIQQQKQRQALGEQLYKKVSAKIDDENAAGKITGMIL DLPPQQVIQLLDNDEQFEQQFQEALAAYENFKKEQEAQA(SEQ ID NO.1)
First fusion protein
As used herein, the terms "fusion protein of the invention", "PabI-eIF 4G fusion protein of the invention", "first fusion protein", and "PabI-eIF 4G fusion protein" are used interchangeably to refer to a fusion protein formed by the fusion of a PabI element and an eIF4G element. In the fusion proteins of the present invention, the PabI element may or may not contain a linker peptide or flexible linker to the eIF4G element. Furthermore, the fusion protein may or may not contain the starting Met; may or may not contain a signal peptide; and with or without a tag sequence (e.g., 6His, etc.).
In a preferred embodiment, the fusion protein of the invention has the structure of formula Ia or Ib as described above. Preferably, the amino acid sequence of the fusion protein of the invention is shown in SEQ ID NO. 3.
MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLY VGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE LNYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCK VALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISK LEEAKANFTNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFV DHNAAAKAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQG VNLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKA MTEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQIRFQQQQQQQAAAAAAG MPGQYMPQMFYGVMAPRGFPGPNPGMNGPMGAGIPKNGMVPPPQQFAGRPNGP MYQGMPPQNQFPRHQQQHYIQQQKQRQALGEQLYKKVSAKIDDENAAGKITGMIL DLPPQQVIQLLDNDEQFEQQFQEALAAYENFKKEQEAQAGGGGSGGGGSTQDEVQ GPHAGKSTVGGGGSGEPTSDQQPAVEAPVVQEETTSSPQKNSGYVKNTAGSGAPR NGKYDGNRKNSRPYNQRGNNNNNNGSSSNKHYQKYNQPAYGVSAGYIPNYGVSA EYNPLYYNQYQQQQQLYAAAYQTPMSGQGYVPPVVSPAAVSAKPAKVEITNKSGE HIDIASIAHPHTHSHSQSHSRAVPVVSPPANVTVAAAVSSSVSPSASPAVKVQSPAA NGKEQSPAKPEEPKKDTLIVNDFLEQVKRRKAALAAKKAVEEKGPEEPKESVVGTD TDASVDTKTGPTATESAKSEEAQSESQEKTKEEAPAEPKPLTLAEKLRLKRMEAAK QASAKTEELKTEESKPEETKTEELKTEESKPEETKTEELKTEETKSEELKTEEPKAEE SKAEEPKPEEPKTEEPTTEQPKSDEPKSEESKTEEPKTEVLKTEEPKSEESKPAEPKTE ETATEETATEANAEEGEPAPAGPVETPADVETKPREEAEVEDDGKITMTDFLQKLKEVSPVDDIYSFQYPSDITPPNDRYKKTSIKYAYGPDFLYQFKEKVDVKYDPAWMAE MTSKIVIPPKKPGSSGRGEDRFSKGKVGSLRSEGRSGSRSNSKKKSKRDDRKSNRSY TSRKDRERFREEEVEEPKVEVAPLVPSANRWVPKSKMKKTEVKLAPDGTELYDAE EASRKMKSLLNKLTLEMFEPISDDIMKIANQSRWEEKGETLKIVIQQIFNKACDEPHWSSMYAQLCGKVVKDLDDSIKDSETPDKTGSHLVLHYLVQRCQTEFQTGWTDQLP TNEDGTPLQPEMMSDEYYKMAAAKRRGLGLVRFIGFLYRSNLLTSRMVFFCFKRL MKDIQNSPTEDTLESVCELLETIGEQFEGARIQVTAEAVIEGSSLLDTLFDQIKNVIEN GDISSRIKFKLIDIVELREKRNWNSKNKNDGPKTIAQIHEEEALKRALEERERERDRH GSRGGSRRMNSERNSSRRDFSSHSHSHNQNRDGFTTTRSSSVRYSEPKKEEQAPTPTKSSGGAANMFDALMDAEDD(SEQ ID NO.3)
In the present invention, the fusion protein of the present invention can significantly improve the in vitro protein synthesis capacity of cell-free, in vitro protein synthesis systems, particularly yeast in vitro protein synthesis systems.
Exogenous gene expression cassette
As used herein, the term "exogenous gene expression cassette" refers to a first exogenous gene expression cassette with a first nucleic acid construct that expresses a first fusion protein (e.g., a PabI-eIF4G fusion protein), and optionally a second exogenous gene expression cassette that expresses a second nucleic acid construct (e.g., an exogenous gene with a ScRNR2 promoter (T7RNAP protein)).
The engineering strain is obtained by protoplast fusion of a recombinant strain integrating a first exogenous gene expression cassette and a recombinant strain integrating a second exogenous gene expression cassette. The engineering strain is simultaneously integrated with a first exogenous gene expression cassette and a second exogenous gene expression cassette.
Design and analysis method for enhancing biosynthesis
A. Analysis of Effect of transcriptional control on Activity during in vivo biosynthesis
T7RNA polymerase (T7RNAP or T7RNP) is an RNA polymerase from T7 phage, recognizes a conserved promoter sequence of 23nt (pT7) and provides strong transcriptional activity. T7RNA polymerase relies on the pT7 promoter to specifically catalyze the RNA formation process in the 5 'to 3' direction; has high specificity and only transcribes DNA located downstream of the T7 promoter in the T7 phage; and have longer transcription scripts than the multimeric bacterial RNA polymerase.
B. Analysis of the Effect of translational Regulation on Activity during in vivo biosynthesis
eIF4F element
In organisms, various translation initiation factors are involved in the protein translation initiation process, and the translation initiation factors in eukaryotic cells and human cells are shown in tables 1 and 2, respectively. Among them, eIF4F is responsible for recognition of "cap structures" and recruitment of downstream translation initiation factors and ribosomes in eukaryotic cells. eIF4F is composed of three protein subunits: eIF4E, eIF4G, and eIF 4A. eIF4E specifically binds to a "cap structure" anchoring eIF4F in the 5' untranslated region of mRNA; eIF4A is an RNA helicase; eIF4G is a scaffold protein for almost the entire translation initiation process, and it interacts with multiple translation initiation factors and plays an important role in the recruitment of downstream factors.
TABLE 1 translation initiation factor in eukaryotic cells
TABLE 2 translation initiation factor in human cells
Pab1 element (Pab1 protein)
Pab1 is located on chromosome C and is a 71kDa RNA binding protein consisting of 4 RRM (RNA recognitionmotif 1-4) domains and 1 MLLE domain. Each RRM domain contains 2 conserved RNP structures (RNP1/2) responsible for binding to RNA.
At the 3' end of the mRNA, the polyA sequence is recognized and bound by the Pab1 protein. Pab1 can interact with eIF4G to link both ends of mRNA while binding polyA[30]. Thus, eIF4G in cooperation with Pab1 allows a number of regulatory elements present at the 3' end of mRNA to regulate protein translation initiation in cells, while the circular structure of mRNA formed by the interaction of eIF4G with Pab1 is suspected to promote translation initiation via rapid initiation of protein synthesis factors.
C. Analysis of influence of nuclease stability on Activity during in vivo biosynthesis
Nucleases (also known as nuclear polymerases or polynucleotides) are enzymes that are capable of hydrolysing phosphodiester bonds between nucleotides in the first step of nucleic acid cleavage. Nucleases can be classified into exonucleases (exonuclease) and endonucleases (endonuclease) according to the position of action of the nuclease. Exonuclease hydrolyzes nucleotides one by one starting from the 3 'end, called 3' to 5 'exonuclease, exonuclease hydrolyzes nucleotides one by one starting from the 5' end, called 5 'to 3' exonuclease, and endonuclease catalyzes hydrolysis of phosphodiester bonds inside polynucleotide. Nucleases are further classified into deoxyribonuclease (DNase) which acts on DNA and ribonuclease (RNase) which acts on RNA. The stability of the coding substrates in vitro synthesis systems for nucleic acid RNA and DNA proteins influences the yield of the protein. In the eukaryotic translation process, the 5 'end of RNA can complete the processing of cap structure instantly, and the 5' cap structure of RNA plays a key role in the stability of RNA and the efficiency of translation.
In eukaryotes, there are mechanisms of RNA degradation dependent on deadenylation and independent of deadenylation, in which the mature cap structure or the immature cap structure at the 5 ' end of RNA can be removed by recruiting a decapping complex, and the RNA is also degraded 5 ' to 3 ' by nuclease[32]. In the adenylation-independent mRNA degradation mechanism, under the action of an endonuclease, a strand break is generated in the middle of a nucleic acid molecule, and an exonuclease degrades RNA from 3 'to 5'.
In the k.lactis in vitro protein synthesis system, mRNA with polyA 3 'terminal tail is transcribed using exogenous linear or circular DNA as template, possibly with or without 5' terminal mature cap structure depending on the difference of promoter (promoter) and RNA transcriptase. Therefore, DNase, RNase, exonuclease and endonuclease all affect the stability of the template in the in vitro protein synthesis system, and modification of these enzymes may have an enhancing effect on the improvement of in vitro biosynthesis activity.
Among them, the lifespan of mRNA is one of the major factors that restrict protein synthesis in vitro due to the special instability of mRNA and the high activity of RNase enzyme in vivo.
The analysis and specific modification of each gene are shown in FIG. 1.
In a preferred embodiment, the design and analysis methods of the invention for enhancing in vitro synthesis are as follows:
I. the in vitro synthesis is enhanced by regulating and controlling translation, namely an artificial fusion protein is designed, and the in vitro translation efficiency is improved.
By combining the analysis of the influence of the in vivo translation regulation and control of the eukaryotic cells on the activity, the invention constructs a fusion protein and improves the in vitro protein synthesis efficiency. In the fusion proteins of the present invention, the PabI element may or may not contain a linker peptide or flexible linker to the eIF4G element. Furthermore, the fusion protein may or may not contain the starting Met; may or may not contain a signal peptide; and with or without a tag sequence (e.g., 6His, etc.).
Enhancing in vitro synthesis by regulating transcription, i.e., reducing nucleases in the in vitro synthesis system to increase nucleic acid stability, and introducing a gene for endogenous expression to facilitate transcription.
By combining the transcriptional regulation and the analysis of the influence of nuclease on the activity, T7RNP can provide stronger transcriptional activity, and the stability of nuclease directly influences the synthesis efficiency of in vitro protein, so that the invention improves the stability of nucleic acid by modifying or knocking out nuclease, introduces a gene to make the endogenous expression of the gene strengthen transcription, and improves the synthesis activity of in vitro protein.
And III, selecting and modifying the genes by using a CRISPR-Cas9 gene editing system, wherein the system modification design is shown in FIG. 2.
Of course, the present invention is still applicable to the engineering of other eukaryotes to enhance protein synthesis activity in vitro.
The method of the present invention is also suitable for highly expressed proteins in cells.
In vitro expression system
Yeast (yeast) combines the advantages of simple culture, efficient protein folding, and post-translational modification. Wherein, the Saccharomyces cerevisiae (Saccharomyces cerevisiae) and the Pichia pastoris (Pichia pastoris) are model organisms for expressing complex eukaryotic proteins and membrane proteins, and the yeast can also be used as a raw material for preparing an in vitro translation system.
Kluyveromyces (Kluyveromyces) is a species of ascosporogenous yeast, of which Kluyveromyces marxianus and Kluyveromyces lactis (Kluyveromyces lactis) are industrially widely used. In comparison with other yeasts, kluyveromyces lactis has many advantages such as superior secretion ability, better large-scale fermentation characteristics, a level of food safety, and the ability to modify proteins post-translationally.
In the present invention, the yeast in vitro expression system is not particularly limited, and a preferred yeast in vitro expression system is a Kluyveromyces expression system (more preferably, a Kluyveromyces lactis expression system).
Protein synthesis system
The invention provides an in vitro cell-free protein synthesis system, which comprises:
(a) a cell extract (e.g., a yeast cell extract) derived from the genetically engineered bacterium of the first aspect of the invention.
In a preferred embodiment, the synthesis system further comprises:
(b) polyethylene glycol;
(c) optionally exogenous sucrose; and
(d) optionally a solvent, which is water or an aqueous solvent.
In a particularly preferred embodiment, the in vitro protein synthesis system provided by the present invention comprises: yeast cell extract, 4-hydroxyethylpiperazine ethanesulfonic acid, potassium acetate, magnesium acetate, adenine nucleoside triphosphate (ATP), guanine nucleoside triphosphate (GTP), cytosine nucleoside triphosphate (CTP), uracil nucleoside triphosphate (UTP), amino acid mixture, phosphocreatine, Dithiothreitol (DTT), phosphocreatine kinase, rnase inhibitor, luciferin, luciferase DNA, RNA polymerase.
In the present invention, the RNA polymerase is not particularly limited and may be selected from one or more RNA polymerases, and a typical RNA polymerase is T7RNA polymerase.
In the present invention, the proportion of the yeast cell extract in the in vitro protein synthesis system is not particularly limited, and usually the yeast cell extract occupies 20 to 70%, preferably 30 to 60%, more preferably 40 to 50% of the volume in the in vitro protein synthesis system.
In the present invention, the yeast cell extract does not contain intact cells, and typical yeast cell extracts include ribosomes for protein translation, transfer RNAs, aminoacyl tRNA synthetases, initiation and elongation factors required for protein synthesis, and termination and release factors. In addition, the yeast extract also contains some other proteins, especially soluble proteins, which originate in the cytoplasm of the yeast cell.
In the present invention, the yeast cell extract contains 20-100mg/mL of protein, preferably 50-100 mg/mL. The method for determining the protein content is a Coomassie brilliant blue determination method.
In the present invention, the preparation method of the yeast cell extract is not limited, and a preferred preparation method comprises the steps of:
(i) providing a yeast cell;
(ii) washing the yeast cells to obtain washed yeast cells;
(iii) performing cell breaking treatment on the washed yeast cells to obtain a yeast crude extract;
(iv) and carrying out solid-liquid separation on the yeast crude extract to obtain a liquid part, namely the yeast cell extract.
In the present invention, the solid-liquid separation method is not particularly limited, and a preferable method is centrifugation.
In a preferred embodiment, the centrifugation is carried out in the liquid state.
In the present invention, the centrifugation conditions are not particularly limited, and one preferable centrifugation condition is 5000-.
In the present invention, the centrifugation time is not particularly limited, and a preferable centrifugation time is 0.5min to 2h, preferably 20 to 50 min.
In the present invention, the temperature of the centrifugation is not particularly limited, and it is preferable that the centrifugation is performed at1 to 10 ℃, preferably, 2 to 6 ℃.
In the present invention, the washing treatment is not particularly limited, and a preferable washing treatment is a treatment with a washing solution at a pH of 7 to 8 (preferably, 7.4), the washing solution is not particularly limited, and typically the washing solution is selected from the group consisting of: potassium 4-hydroxyethylpiperazine ethanesulfonate, potassium acetate, magnesium acetate, or a combination thereof.
In the present invention, the manner of the cell disruption treatment is not particularly limited, and a preferable cell disruption treatment includes high-pressure disruption, freeze-thawing (e.g., liquid nitrogen low-temperature disruption).
The nucleoside triphosphate mixture in the in vitro protein synthesis system is adenosine triphosphate, guanosine triphosphate, cytosine nucleoside triphosphate and uracil nucleoside triphosphate. In the present invention, the concentration of each mononucleotide is not particularly limited, and usually the concentration of each mononucleotide is 0.5 to 5mM, preferably 1.0 to 2.0 mM.
The amino acid mixture in the in vitro protein synthesis system may comprise natural or unnatural amino acids, and may comprise D-or L-amino acids. Representative amino acids include (but are not limited to) the 20 natural amino acids: glycine, alanine, valine, leucine, isoleucine, phenylalanine, proline, tryptophan, serine, tyrosine, cysteine, methionine, asparagine, glutamine, threonine, aspartic acid, glutamic acid, lysine, arginine, and histidine. The concentration of each amino acid is usually 0.01-0.5mM, preferably 0.02-0.2mM, such as 0.05, 0.06, 0.07, 0.08 mM.
In a preferred embodiment, the in vitro protein synthesis system further comprises polyethylene glycol or an analog thereof. The concentration of polyethylene glycol or an analog thereof is not particularly limited, and usually, the concentration (w/v) of polyethylene glycol or an analog thereof is 0.1 to 8%, preferably 0.5 to 4%, more preferably 1 to 2%, based on the total weight of the protein synthesis system. Representative PEG examples include (but are not limited to): PEG3000, PEG8000, PEG6000 and PEG 3350. It is understood that the systems of the present invention may also include other polyethylene glycols of various molecular weights (e.g., PEG200, 400, 1500, 2000, 4000, 6000, 8000, 10000, etc.).
In a preferred embodiment, the in vitro protein synthesis system further comprises sucrose. The concentration of sucrose is not particularly limited, and generally, the concentration of sucrose is 0.03 to 40 wt%, preferably 0.08 to 10 wt%, more preferably 0.1 to 5 wt%, based on the total weight of the protein synthesis system.
A particularly preferred in vitro protein synthesis system comprises, in addition to yeast extract, the following components: 22mM of 4-hydroxyethyl piperazine ethanesulfonic acid with the pH value of 7.4, 30-150mM of potassium acetate, 1.0-5.0mM of magnesium acetate, 1.5-4mM of nucleoside triphosphate mixture, 0.08-0.24mM of amino acid mixture, 25mM of creatine phosphate, 1.7mM of dithiothreitol, 0.27mg/mL of phosphocreatine kinase, 1% -4% of polyethylene glycol, 0.5% -2% of sucrose, 8-20 ng/mu L of DNA of firefly luciferase and 0.027-0.054mg/mL of T7RNA polymerase.
The main advantages of the invention include:
(i) the invention constructs a novel genetically engineered bacterium for the first time, the genome of which integrates (i) a first exogenous gene expression cassette expressing a first nucleic acid construct of a first fusion protein (such as a fusion protein formed by KlPAB1 and KleIF4G), and simultaneously reduces the expression or activity of a nuclease (such as KlEXN53) in the engineered strain of the invention, and optionally integrates a second exogenous gene expression cassette expressing a second nucleic acid construct (such as a promoter pScRNR2-T7 RNP).
(ii) The invention discovers for the first time that the cell extract (such as yeast cell extract) derived from the engineering strain can obviously improve the stability of nucleic acid, does not need additional manual addition of T7RNP, and obviously improves the efficiency of protein production of an in vitro protein synthesis system.
(iii) The invention discovers for the first time that the luciferase activity of the strain in IVTT is more than or equal to 5 times of that of a wild type strain when T7RNP is not required to be added additionally.
(iv) The invention discovers for the first time that the luciferase activity in IVTT of the strain of the invention is significantly higher than that of the first fusion protein of the invention (wherein the luciferase activity in IVTT of the first fusion protein of the invention is 2.6 times higher than that of wild type).
(v) The invention discovers for the first time that the luciferase activity in IVTT of the strain of the invention is significantly higher than the luciferase activity in IVTT of the strain which reduces the expression or activity of nuclease (such as KlEXN53) (wherein the luciferase activity in IVTT of the strain which reduces the expression or activity of nuclease (such as KlEXN53) is 1.46 times higher than the wild-type luciferase activity).
(vi) When the engineering strain of the invention has the following characteristics: (a) a first exogenous gene expression cassette integrated with a first nucleic acid construct expressing a first fusion protein (e.g., a fusion protein formed by KlPAB1 and KleIF4G), (b) reducing the expression or activity of a nuclease (e.g., kleln 53) in an engineered strain of the invention, and a cell-free in vitro protein synthesis system (IVTT) based on the engineered strain, can efficiently and synergistically produce exogenous proteins (e.g., luciferase).
(vii) The invention realizes the stable existence of T7RNAP in a yeast cell genome and the continuous expression of T7RNAP protein for the first time, and does not need to add T7RNAP manually when detecting IVTT in a cell-free synthesis system, thereby saving time and cost.
The invention will be further illustrated with reference to the following specific examples. It should be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the present invention. Experimental procedures without specific conditions noted in the following examples, generally followed by conventional conditions, such as Sambrook et al, molecular cloning: the conditions described in the laboratory Manual (New York: Cold Spring harbor laboratory Press,1989), or according to the manufacturer's recommendations. Unless otherwise indicated, percentages and parts are percentages and parts by weight.
Unless otherwise specified, the materials and reagents used in the examples of the present invention are commercially available products.
Example 1 construction of a novel fusion protein to substantially increase in vitro translation efficiency
1.1 through CRISPR-Cas9 gene editing technology, translation initiation factors eIF4G and Pab1 in K.lactis are optimized, and KleIF4G is fused with interaction protein thereof, so that the efficiency of a cell-free in-vitro translation system is improved.
1.1.1 KlPab1 sequence search and CRISPR gRNA sequence determination
The invention fuses KlPab1 and KleIF4G by a CRISPR-Cas9 gene editing technology, promotes the interaction of the two and improves the in vitro translation efficiency.
Based on the Pab1 sequence, the KlPab1 gene sequence in kluyveromyces lactis (1553322.. 1555100 located on chromosome C) was obtained. PAM sequence (NGG) is searched near the stop codon of KlPab1 gene, and gRNA sequence is determined. The principle of gRNA selection is: the GC content is moderate, and the standard of the invention is that the GC content is 40-60%; avoiding the presence of poly T structures. Finally, the KlPab1 gRNA sequence identified in the present invention was TGCTTACGAAAACTTCAAGA, located at position 1555058.. 1555077 of chromosome C.
1.1.2 CRISPR-Cas 9-mediated integration of KleIF4G into KlPab1 site plasmid construction
CRISPR plasmid construction
Using primers PF 16: TGCTTACGAAAACTTCAAGAGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCG (SEQ ID NO.9), PR 16: GCTCTAAAACTCTT GAAGTTTTCGTAAGCAAAAGTCCCATTCGCCACCCG (SEQ ID NO.10), and PCR was performed using the pC AS plasmid AS a template. mu.L of the amplification product was mixed and 1. mu.L of DpnI, 2. mu.L of 10 Xdigestion buffer was added and incubated at 37 ℃ for 3 hours. Adding 10. mu.L of the product after the DpnI treatment into 100. mu.L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid medium, carrying out shake culture at 37 ℃ for 1h, coating on Kan-resistant LB solid culture medium, and carrying out inversion culture at 37 ℃ until single clones grow out. 5 single clones were picked and cultured in LB liquid medium with shaking, PCR-detected positive and sequencing-confirmed, and the plasmids were extracted and stored, named as pH as 9-SE-tRNA-ScRNR 2-KlPAB 1-gRNA1 (FIG. 3).
KlPab1-KleIF4G Donor DNA plasmid construction and amplification
To facilitate the storage and amplification of linear donor DNA, the donor DNA was first inserted into the pMD18 plasmid and then amplified by PCR to give a linear donor DNA sequence.
Taking Kluyveromyces lactis genome DNA as a template, and taking a primer PF 17: GAGCTCGGTACCCGGG GATCCTCTAGAGATCCGGTAAGCCATTGTACGTTGCCAT (SEQ ID NO.11) and P R17: GCCAAGCTTGCATGCCTGCAGGTCGACGATCAGTATACCGTCCATGTTGAT GACT (SEQ ID NO.12) by PCR; taking pMD18 plasmid as a template, and taking primers pMD 18-F: ATCGTCGACCTGCAGGCATG (SEQ ID NO.13) and pMD 18-R: ATCTCTAGAGGATCCCCGGG (SEQ ID NO.14) were subjected to PCR amplification. mu.L of each of the two amplification products was mixed, and 1. mu.L of DpnI and 2. mu.L of 10 Xdigestion buffer were added thereto, and incubated at 37 ℃ for 3 hours. Adding 10 mu L of the product after the DpnI treatment into 100 mu L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating the product on Amp resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 single clones are picked and cultured in LB liquid culture medium by shaking, after PCR detection is positive and sequencing is confirmed, plasmids are extracted and stored, and the plasmid is named as pKM-KlPab 1-DD.
Carrying out amplification by using pKM-KlPab1-DD as a template and primers PF18: GATGCATTGATGGATGCCGAAGA TGATTAAACTTGATTTTTTGACCTTGATCTTCATCTTGTC (SEQ ID NO.15) and P R18: CTTGAACTTCATCTTGAGTTGAACCTCCACCTCCAGATCCACCTCCACCAGC TTGAGCTTCTTGTTCTTTTTTAAAATTCTCGTAAGCAGCTAAGGCTTC (SEQ ID NO. 16); kluyveromyces lactis DNA was used as a template, and amplification was carried out with primers PF19: GTGGAGGTTC AACTCAAGATGAAGTTCAAGGTCCACATGCTGGTAAGTCTACTGTTGGTGGAGGTGGATCTGGCGAACCTACATCCGATCAGC (SEQ ID NO.17) and PR19: TTAATCATCTTCGGCATCCATCAATGC (SEQ ID NO. 18). mu.L of each of the two amplification products, 8.5. mu.L of each of the two amplification products, 1. mu.L of DpnI, 2. mu.L of 10 Xdigestion buffer were mixed and incubated at 37 ℃ for 3 hours. Adding 10 mu L of the product after the DpnI treatment into 100 mu L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating the product on Amp resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 single clones were picked and cultured in LB liquid medium with shaking, and after positive PCR detection and sequencing confirmation, the plasmids were extracted and stored, and named KlPAB1-30Linker-KleIF4G-DD1-pMD18 (FIG. 4).
The linear donor DNA is obtained by taking KlPAB1-30Linker-KleIF4G-DD1-pMD18 plasmid as a template and performing amplification by using primers M13-F: GTAAAACGACGGCCAGT (SEQ ID NO.19) and M13-R: CAGGAAACAGCTATGAC (SEQ ID NO. 20).
1.1.3 Kluyveromyces lactis transformation and Positive identification
I. Streaking the Kluyveromyces lactis liquid on a YPD solid culture medium, picking a single clone, carrying out shake culture in 25mL of 2 XYPD liquid culture medium overnight, and taking 2mL of the liquid to carry out shake culture in 50mL of the 2 XYPD liquid culture medium for 2-8 h. The yeast cells were collected by centrifugation at 3000g for 5min at 20 ℃ and resuspended in 500. mu.L of sterile water, and the cells were collected by centrifugation under the same conditions. A competent cell solution (5% v/v glycerol, 10% v/v DMSO) was prepared and yeast cells were dissolved in 500. mu.L of the solution. Subpackaging 50 μ L into 1.5mL centrifuge tubes, and storing at-80 deg.C.
Competent cells were thawed at 37 ℃ for 15-30s, centrifuged at 13000g for 2min and the supernatant removed. Preparing a transformation buffer solution: PEG3350 (50% (w/v)) 260. mu.L, LiAc (1.0M) 36. mu.L, carrier DNA (5.0M g/mL) 20. mu.L, Cas9& gRNA plasmid 15. mu.L, donor DNA 10. mu.L, sterile water was added to a final volume of 360. mu.L. After heat shock, 13000g were centrifuged for 30s to remove the supernatant. 1mL of YPD liquid medium was added, and the mixture was cultured for 2 to 3 hours, and 200. mu.L of the mixture was pipetted and spread on solid YPD (200. mu.g/mL G418) medium, and cultured for 2 to 3 days until single colonies appeared.
Picking 10-20 monoclonals from the plate transformed by the Kluyveromyces lactis, placing the monoclonals in 1mL YPD (200 mu G/mL G418) liquid culture medium for shaking culture overnight, taking bacterial liquid as a template, and taking a primer KlPAB1-CICF1(KlPAB1 sequence inner primer): TCTCCAGAAGAAGCTACCAAGGCTA (SEQ ID NO.21) and primer KleIF4G-CICR2(KleIF4G in-sequence primer): TTCTCTTCGACAGCCTTCTTAGCAG (SEQ ID NO.22), performing PCR detection on KlPAB1 site KleIF4G insertion, determining strains which are positive by PCR results and identified by sequencing, and naming the strains as KlPAB1-KleIF 4G.
Example 2 in order to increase the efficiency of in vitro translation, T7RNP with a specific priming strength of ScRNR2 was endogenously expressed by knock-out nuclease KlEXN53, with or without additional addition of T7RNP, to increase the efficiency of in vitro translation.
2.1 background and analysis of biosynthesis in organisms
In vivo biosynthesis refers to the process of synthesis of various compounds catalyzed by enzymes in the organism, including photosynthesis, gluconeogenesis, and biosynthesis of macromolecules such as nucleotides, nucleic acids, and proteins. Among them, the synthesis of proteins is quantitatively the most important.
The entire process of biosynthesis includes transcription, which is the transfer of genetic information from DNA to RNA, and translation. Namely, a process of synthesizing RNA under the catalysis of RNA polymerase by using 4 kinds of nucleoside triphosphates, namely Adenosine Triphosphate (ATP), Cytidine Triphosphate (CTP), Guanosine Triphosphate (GTP) and Uridine Triphosphate (UTP), as raw materials, and taking one strand of double-stranded DNA as a template. Translation is a process in which ribosomes bind to a messenger ribonucleic acid (mRNA) template with the aid of various factors, the triplet codon of the mRNA is recognized by transfer ribonucleic acid (tRNA) and the corresponding amino acid is transferred, and then protein peptide chains are successively synthesized in sequence according to the template mRNA information. The transcriptional regulation is affected by transcription factors, nucleases, RNA polymerases, etc., and the translational regulation is affected by translation initiation, translation elongation, translation termination, etc.
2.2 design principles for modulation of in vitro biosynthetic Activity by K.lactis genomic KlEXN53 engineering
2.2.1 in vitro biosynthesis System analysis
I. Compositional analysis in different in vitro biosynthetic systems
In vitro biosynthesis systems are used for the translation of foreign proteins by disrupting different cell types, including microorganisms, animals and plants, and extracting cell lysates. In vitro biosynthetic systems in order to perform transcription, translation, protein folding, and energy metabolism, cell lysates must contain elements for energy regeneration and protein synthesis, including ribosomes, aminoacyl-tRNA synthetases, translation initiation and elongation factors, ribosome release factors, nucleotide cycle enzymes, metabolic enzymes, chaperones, and folding enzymes. Substances that need to be added exogenously include amino acids, nucleotides, DNA templates, energy substrates, cofactors, salt molecules, and the like. The stability of the different components of the system has a significant influence on the duration of the reaction and ultimately the protein yield, and depletion of some substrates (e.g. ATP, cysteine, etc.) is a significant cause of the termination of the reaction.
II, analyzing the influence of the components in the in vitro biosynthesis system on the synthesized product;
in the in vitro translation system, the concentrations and pH values of components such as energy metabolism substrates (creatine phosphate, etc.), substrates involved in mRNA synthesis (NTP, etc.), substrates involved in protein synthesis (amino acids, etc.), and phosphate, etc. vary in magnitude as the reaction proceeds, eventually leading to termination of the reaction. By different technical means, corresponding components (NTP, amino acid and the like) are supplemented or corresponding conditions (pH value, phosphate concentration and the like) are stabilized, so that the reaction time of an in vitro translation system can be effectively prolonged, and the protein yield is improved.
Analyzing the influence of nucleic acid and nuclease in an in vitro protein synthesis system on protein synthesis;
as an important substrate for protein translation, the stability of the DNA template and the mRNA transcribed therefrom has a significant influence on the duration and yield of the reaction in the in vitro translation system. After the cells are broken, cell lysate is collected and used for constructing an in vitro translation system, wherein the cell lysate contains various components necessary for protein synthesis, and components unfavorable for reaction such as nuclease, protease and the like. In the system composed of various purified components, the efficiency of protein translation is remarkably improved because of no inhibitor.
Meanwhile, the stability of nucleic acid in an in vitro translation system can be effectively improved through different technical means (including nuclease gene knockout, addition of a stabilizing factor and the like), and the translation efficiency of protein is further improved. The stability of nucleic acid is improved by reducing nuclease in an in vitro biosynthesis system, and the nuclease gene in K.lactis genome is analyzed and specifically modified.
Analysis of nuclease Gene in 2.2.2 K.lactis genome
Classification and distribution of nuclease genes in the lactis genome;
nucleases (also known as nuclear polymerases or polynucleotides) are enzymes that are capable of hydrolysing phosphodiester bonds between nucleotides in the first step of nucleic acid cleavage. Nucleases can be classified into exonucleases (exonuclease) and endonucleases (endonuclease) according to the position of action of the nuclease. Exonuclease hydrolyzes nucleotides one by one starting from the 3 'end, called 3' to 5 'exonuclease, exonuclease hydrolyzes nucleotides one by one starting from the 5' end, called 5 'to 3' exonuclease, and endonuclease catalyzes hydrolysis of phosphodiester bonds inside polynucleotide. Nucleases are further classified into deoxyribonuclease (DNase) which acts on DNA and ribonuclease (RNase) which acts on RNA. Exonuclease is further classified into 5 'to 3' exonuclease and 3 'to 5' exonuclease according to the action direction of nuclease.
Through database gene function comparison analysis, the K.lactis contains 61 nucleases in total and is distributed on six chromosomes of K.lactisA-F, wherein the nucleases positioned on the chromosome A comprise: KlSEN54, KlDNA2, KlTRM2, KlFCF1, KlDOM34, KlRAD2, KlRNH70, KlDIS3, KlNPP 1; nucleases located on the B chromosome are: KlOGG 1; nucleases located on the C chromosome are: KlPOL2, KlRAD50, KlYSH1, KlRCL1, KlNGL2, KlMRE11, KlPOP3, KlMKT1, KlAPN1, KlRPP1, KlPOP 2; nucleases located on the D chromosome are: KlNUC1, KlRPP6, KlDBR1, KlRPS3, KlRPM2, KlSUV3, KlRAD1, KlIRE1, KlPOP 1; nucleases located on the E chromosome are: KlPOL3, KlDXO1, KlMUS81, KlPAN3, KlAPN2, KlRAI1, KlEXO1, KlREX4, KlPAN2, KlLCL 3; nucleases located on the F chromosome are: KlRAD17, KlPOP4, KlPOP5, KlRAD27, KlRNH201, KlVMA1, KlRAT1, KlNGL1, KlREX2, KlTRL1, KlPOL31, KlCCR4, KlTRZ1, KlSEN2, KlREX3, KlSWT1, KLEXN53, KlRNT1, KlSEN15, KlNTG1, KlNOB1, KlDDP 1. According to the functional classification, k. lactis nucleases can be divided into two classes, wherein 18 dnases, 41 rnases and 2 non-functional classes are shown in table 3. Wherein among the DNases having 3 'to 5' function is KlAPN1, and among the DNases having 5 'to 3' function is KlRAD27, KlEXO 1; among the rnases that have 3 'to 5' functionality are KlRNH70, KlDIS3, KlNGL2, KlRPP6, 5 'to 3' functionality KlDXO1, KlRAT1, KLEXN 53.
TABLE 3 nuclease distribution
Selection analysis of nuclease genes associated with in vitro protein synthesis in the lactis genome;
the stability of the coding substrates in vitro synthesis systems for nucleic acid RNA and DNA proteins influences the yield of the protein. In the eukaryotic translation process, the 5 'end of RNA can complete the processing of cap structure instantly, and the 5' cap structure of RNA plays a key role in the stability of RNA and the efficiency of translation.
In eukaryotes, there are both deadenylation-dependent and deadenylation-independent RNA degradation mechanisms in which the 5 ' mature cap structure or the immature cap structure of RNA can be removed by recruiting a decapping complex, and 5 ' to 3 ' degradation of RNA also occurs under the action of nucleases. In the adenylation-independent mRNA degradation mechanism, under the action of an endonuclease, a strand break is generated in the middle of a nucleic acid molecule, and an exonuclease degrades RNA from 3 'to 5'.
In the k.lactis in vitro protein synthesis system, mRNA with polyA 3 'terminal tail is transcribed using exogenous linear or circular DNA as template, possibly with or without 5' terminal mature cap structure depending on the difference of promoter (promoter) and RNA transcriptase. Therefore, DNase, RNase, exonuclease and endonuclease all affect the stability of the template in the in vitro protein synthesis system, and modification of these enzymes may have an enhancing effect on the improvement of in vitro biosynthesis activity.
Among these, the lifespan of mRNA is one of the major factors that restrict protein synthesis in vitro due to the specific instability of mRNA and the high activity of RNase enzyme in vivo. Therefore, modification to reduce the amount of RNase enzyme in vivo is the preferred modification. Because KlEXN53 is necessary for checkpoint activation when telomere is uncapped (single-stranded DNA generation is promoted), and is one of RNA processing proteins, telomere metabolism can be regulated, the genome stability of eukaryotes is influenced, and finally, KlEXN53 is knocked out. Of course, this patent is still applicable to the design modification of other nucleases to enhance in vitro protein synthesis activity.
2.3 selected analysis of the insertion of pScRNR2 and T7RNAP sites in the genome of cells
In order to overcome the defect that T7RNA polymerase protein needs to be added manually by external source in the existing in vitro translation system, the invention integrates T7RNAP protein into cell genome by using a gene editing technology CRISPR-Cas9 system, creates a strain capable of stably expressing a proper amount of T7RNAP protein, and further forms a simple, convenient and efficient in vitro translation system which does not need to add T7RNAP manually by external source.
In vitro translation systems have high requirements on the content of T7RNAP, and too high or too low of the T7RNAP content can affect the efficiency of the system. Therefore, the weak pScRNR2 promoter is inserted in front of T7RNAP, the structure is constructed into an episome plasmid, and the function of the T7RNAP expression cassette in an in vitro translation system is verified.
After the function verification of episome plasmids, the invention replaces a certain gene of cells by the T7RNAP expression cassette. In the present invention, KLEXN53 gene was knocked out and T7RNAP substitution was performed.
2.4 Targeted knockout of EXN53 Gene by CRISPR/Cas9 replacement with T7RNAP expression cassette
2.4.1 KLEXN53 sequence search and CRISPR gRNA sequence determination
I. Construction of a targeting knockout gene cloning vector plasmid:
the sequence of the EXN53 gene in Kluyveromyces lactis (SEQ ID NO.5) was determined by BLAST alignment analysis with the EXN53 gene in the KEGG database, which encodes KlLA0F22385g, and this gene was designated KLEXN53 (located at position 2091235.. 2095596 of chromosome F).
The PAM sequence (NGG) was searched for the start codon and stop codon of the KLEXN53 gene and the gRNA sequence was determined. The principle of gRNA selection is: the GC content is moderate, and the standard of the invention is that the GC content is 40-60%; avoiding the presence of poly T structures. Finally, the sequence of KLEXN53 gRNA-1 was determined to be AGAGTTCGACAATTTGTACT (SEQ ID NO.23) and KLEXN53 gRNA-3 was determined to be CGTCGTGGCCGTAGTAATCG (SEQ ID NO. 24).
The plasmid construction and transformation method is as follows: primers pCas9-KLEXN 53-F1: AGAGTTCGACAAT TTGTACTGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTC (SEQ ID NO.25) and pCas9-KLEXN 53-R1: GCTCTAAAACAGTACAAATTGTCGAACTCTAA AGTCCCATTCGCCACCCG (SEQ ID NO.26), pCas9-KLEXN 53-F2: CGTCGT GGCCGTAGTAATCGGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTC (SEQ ID NO.27) and pCas9-KLEXN 53-R2: GCTCTAAAACCGATTACTACGGCCACGACGAAAGTCCCATTCGCCACCCG (SEQ ID NO.28), all using pCAS plasmid as template, and PCR amplification was performed. mu.L of each amplification product was mixed, and 1. mu.L of Dpn I, 2. mu.L of 10 Xdiges station buffer was added thereto, and the mixture was incubated at 37 ℃ for 3 hours. Adding 10 μ L of the product after the Dpn I treatment into 100 μ L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating on Kan-resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 single clones are picked and cultured in LB liquid culture medium in a shaking way, after PCR detection is positive and sequencing is confirmed, plasmids are extracted and stored, and the plasmids are respectively named pHoCas9_ SE _ Kana _ tRNA _ ScRNR2_ KLEXN53-gRNA1 and pHoCas9_ S E _ Kana _ tRNA _ ScRNR2_ KLEXN53-gRNA 3. Using primers pCas9-F1, with pHoCas9_ SE _ Kana _ tRNA _ ScRNR2_ K LEXN53-gRNA1 as template: TAGGTCTAGAGATCTGTTTAGCTT GCCTCG (SEQ ID NO.29) and pCas 9-R1: TATCCACTAGACAGAAGTTTGCGTTC C (SEQ ID NO.30), using pHoCas9_ SE _ Kana _ tRNA _ ScRNR2_ KLEXN53-gRNA3 as template and primers pCas 9-F2: TATGGAACGCAAACTTCTGTCTAGTGGATAGTATATG TGTTATGTAGTATACTCTTTCTTCAACAATTAAATACTCTCGG (SEQ ID NO.31) and pCas 9-F2: CGAGGCAAGCTAAACAGATCTCTAGACCTATATCCACTAGACAGA AGTTTGCGTTCC (SEQ ID NO.32), PCR amplification was carried out, PCR amplification products of pCas9-F1/pCas9-R1 and pCas 9-F2/pCas 9-R2 were mixed at a ratio of 1:5, 1. mu.L of DpnI, 2. mu.L of 10 Xdi geoston buffer were added, and the mixture was incubated at 37 ℃ for 3 hours. Adding 10 μ L of the product after the Dpn I treatment into 100 μ L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating on Kan-resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 single clones were picked and cultured in LB liquid medium with shaking, PCR was performed to detect positive and sequencing was confirmed, and then plasmids were extracted and stored, and named pHoCas9_ SE _ Kana _ tRNA _ ScRNR2_ KLEXN53-gRNA1&3 (shown in FIG. 5), respectively.
2.4.2 Donor DNA plasmid construction and amplification
In order to facilitate the preservation and amplification of linear donor DNA, the donor DNA is firstly inserted into the pMD18 plasmid, and then a linear donor DNA sequence is obtained through PCR amplification.
Carrying out PCR amplification by using a plasmid containing a T7RNAP gene as a template and primers PF1: ATGAACACGATTAACATC GCTAAGAACG (SEQ ID NO.33) and PR1: TTACGCGAACGCGAAGTCCG (SEQ ID NO. 34); the Kluyveromyces lactis episomal plasmid was used as a template, and PCR amplification was carried out using primers PF2: ATC TTAGAGTCGGACTTCGCGTTCGCGTAAGAAGATGCTTCTGCTCATCATC (SEQ ID NO.35) and PR2: AGTCGTTCTTAGCGATGTTAATCGTGTTCATGGTAATTGGACAAATAAATACGTGT (SEQ ID NO. 36). mu.L of each of the two amplification products was mixed, and 1. mu.L of LDpnI, 2. mu.L of 10 Xdigestion buffer was added thereto, and the mixture was incubated at 37 ℃ for 3 hours. Adding 10. mu.L of the product after the DpnI treatment into 100. mu.L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid medium, carrying out shake culture at 37 ℃ for 1h, coating on Kan-resistant LB solid culture medium, and carrying out inversion culture at 37 ℃ until single clones grow out. 5 single clones are picked and cultured in LB liquid culture medium by shaking, after P CR detection is positive and sequencing is confirmed, a plasmid is extracted and stored, and the name is pKM-T7RNAP 1.
Taking Kluyveromyces lactis genomic DNA as a template, and carrying out PCR (polymerase chain reaction) on a primer KLEXN 53-F1: GTACCCGGGG ATCCTCTAGAGATCCAGTTGCAGAGCCTCCGAA (SEQ ID NO.37) and KLEXN 53-R1: CATGCCTGCAGGTCGACGATGCGAAACCTTAGCTCTTTATCGAAC (SEQ ID NO.38) was subjected to PCR amplification; taking pMD18 plasmid as a template, and taking primers pMD 18-F: ATCGTCGA CCTGCAGGCATG (SEQ ID NO.13) and pMD 18-R: ATCTCTAGAGGATCCCCGGG (SEQ ID NO.14) were subjected to PCR amplification. mu.L of each of the two amplification products was mixed, and 1. mu.L of Dp n I, 2. mu.L of 10 Xdigestion buffer was added thereto, and the mixture was incubated at 37 ℃ for 3 hours. Adding 10 μ L of the product after the Dpn I treatment into 100 μ L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating the product on Amp resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 single clones are picked and cultured in LB liquid culture medium in a shaking way, after PCR detection is positive and sequencing is confirmed, plasmids are extracted and stored, and the name is KLEXN53-pMD 18.
Using KLEXN53-pMD18 plasmid as a template, and primers KLEXN 53-F3: ATGTTGGTTTGAAT GGACTATTAACAGTAAATATTATATCACTTCGTGTTCAATTAATTACGGTTTGTG GCTTAACTAAAAAGTCGAACAAGAAGCAGGCAAAG (SEQ ID NO.39) and KLE XN 53-R2: GAAGTGATATAATATTTACTGTTAATAGTCCATTCAAACCAACATTTA TTTTAGTTAAGCCACAAACCGTAATTAATTGAACAC (SEQ ID NO.40) for PC R amplification; KLEXN53-DD-pMD18 was constructed. The method comprises the following specific steps: mu.L of each of the two PCR products were mixed, and 1. mu.L of Dpn I, 2. mu.L of 10 Xdigestion buffer were added, and the mixture was incubated at 37 ℃ for 3 hours. Adding 10 μ L of the product after the Dpn I treatment into 100 μ L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating the product on Amp resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 monoclonals are selected to be subjected to shake culture in an LB liquid culture medium, and plasmids are extracted for storage after PCR positive detection and sequencing confirmation.
Taking pKM-T7RNAP1 as a template, and taking primers pScRNR 2-F3: GTGTTCAATTAATTACGGT TTGTGGCTTAACTAAAAAGTCGAACAAGAAGCAGGCAAAG (SEQ ID NO.41) and tCYC 1-R2: GAAGTGATATAATATTTACTGTTAATAGTCCATTCAAACCAACATCT TCGAGCGTCCCAAAACCTTC (SEQ ID NO.42) by PCR; KLEXN53-D D-pMD18 was used as a template, and the primers KlEXN 53-F4: ATGTTGGTTTGAATGGACTATTAACAGTAAATATTATATCACTTC (SEQ ID NO.43) and KlEXN 53-R4: TTTTAGTTAAGCCACAAACCGTAATTAATTGAACAC (SEQ ID NO.44) was subjected to PCR amplification to construct KlEX N53-pScRNR2-T7 RNP-DD1-pMD18 plasmid (shown in FIG. 6). The method comprises the following specific steps: mu.L of each of the two PCR products were mixed, and 1. mu.L of Dpn I, 2. mu.L of 10 Xdigestion buffer was added, and the mixture was incubated at 37 ℃ for 3 hours. Adding 10 μ L of the product after the Dpn I treatment into 100 μ L of DH5 alpha competent cells, standing on ice for 30min, thermally shocking at 42 ℃ for 45s, adding 1mL of LB liquid culture medium, performing shake culture at 37 ℃ for 1h, coating the product on Amp resistant LB solid culture, and performing inversion culture at 37 ℃ until single clones grow out. 5 monoclonals are selected to be subjected to shake culture in an LB liquid culture medium, and plasmids are extracted for storage after PCR positive detection and sequencing confirmation.
2.4.3 Kluyveromyces lactis transformation and Positive identification
I Kluyveromyces lactis KlPAB1-KleIF4G strain successfully transformed in example 3 was streaked on YPD solid medium, a single clone was picked up, the single clone was cultured in 25mL of 2 XYPD liquid medium with shaking overnight, and 2mL of the strain was taken and cultured in 50mL of 2 XYPD liquid medium with shaking for 2-8 h. The yeast cells were collected by centrifugation at 3000g for 5min at 20 ℃ and resuspended in 500. mu.L of sterile water, and the cells were collected by centrifugation under the same conditions. A competent cell solution (5% v/v glycerol, 10% v/v DMSO) was prepared and yeast cells were dissolved in 500. mu.L of the solution. Subpackaging 50 μ L into 1.5mL centrifuge tubes, and storing at-80 deg.C.
ii competent cells were thawed at 37 ℃ for 15-30s, 13000g centrifuged for 2min and the supernatant removed. Preparing a transformation buffer solution: PEG3350 (50% (w/v)) 260. mu.L, LiAc (1.0M) 36. mu.L, carrier DNA (5.0 mg/mL) 20. mu.L, Cas9& gRNA plasmid 5. mu.L, donor DNA 10. mu.L, sterile water was added to a final volume of 360. mu.L. After heat shock, 13000g were centrifuged for 30s to remove the supernatant. 1mL of YPD liquid medium was added, and the mixture was cultured for 2 to 3 hours, and 200. mu.L of the mixture was pipetted and spread on solid YPD (200. mu.g/mL G418) medium, and cultured for 2 to 3 days until single colonies appeared.
iii picking 10-40 monoclonals on the plate transformed by the Kluyveromyces lactis, placing the monoclonals in 1mL YPD (200 mu G/mL G418) liquid culture medium for shaking culture overnight, taking a bacterial liquid as a template, and adding CRISPR insert Check primer KLEXN53-CICF 1: TTTGCTGGTTGCCCGTATTCCC (SEQ ID NO.45), KLEXN53-CICR 1: TAATAGCACAGGGAATGCACCTT (SEQ ID NO.46), and PCR was performed on the sample. The strain which is positive in PCR result and identified by sequencing is determined to be a positive strain and is named as klxrn1 delta-pScRNR 2-T7RNP & KlPAB1-KleIF4G or KlEXN53 delta-pScRNR 2-T7RNP & KlPAB1-KleIF4G, which is called 3in1 for short.
EXAMPLE 3 preparation of cell-free in vitro protein Synthesis System and measurement of protein Synthesis efficiency
The experimental method comprises the following steps:
I. preparing a storage solution of an in-vitro protein synthesis system: 1M 4-hydroxyethylpiperazine ethanesulfonic acid at pH 7.4, 5M potassium acetate, 250mM magnesium acetate, 25mM 4 mixture of four nucleoside triphosphates including adenosine triphosphate, guanosine triphosphate, cytosine nucleoside triphosphate and uracil nucleoside triphosphate, 1mM 2 mixture of twenty amino acids: glycine, alanine, valine, leucine, isoleucine, phenylalanine, proline, tryptophan, serine, tyrosine, cysteine, methionine, asparagine, glutamine, threonine, aspartic acid, glutamic acid, lysine, arginine and histidine, wherein the concentration of 20 amino acids is 1.0mM, 1M phosphocreatine, 1M dithiothreitol, 6.48mg/mL phosphocreatine kinase, 1.7mg/mL T7RNA polymerase 20% -50% polyethylene glycol (PEG) 3350 or (polyethylene glycol, PEG)8000, 20% -40% sucrose;
in vitro protein synthesis reaction system: 4-hydroxyethylpiperazine ethanesulfonic acid at a final concentration of 22mM, pH 7.4, 30-150mM potassium acetate, 1.0-5.0mM magnesium acetate, 1.5mM-4mM nucleoside triphosphate mixtures (adenosine triphosphate, guanosine triphosphate, cytosine nucleoside triphosphate and uracil nucleoside triphosphate), 0.08-0.24mM amino acid mixtures (glycine, alanine, valine, leucine, isoleucine, phenylalanine, proline, tryptophan, serine, tyrosine, cysteine, methionine, asparagine, glutamine, threonine, aspartic acid, glutamic acid, lysine, arginine and histidine), 25mM creatine phosphate, 1.7mM dithiol, 0.27mg/mL creatine phosphate kinase, 8-20ng/μ L firefly luciferase DNA, 0.027-0.054mg/mL T7RNA polymerase, 1% -4% polyethylene glycol, and finally adding 50% yeast cell extract by volume;
in vitro protein synthesis reaction: placing the reaction system in an environment with the temperature of 20-30 ℃, and standing for reaction for 2-6 h;
luciferase activity assay: after the reaction is finished, adding equal volume of substrate fluorescein (luciferine) into a 96-well white plate or a 384-well white plate, immediately placing the mixture in an Envision 2120 multifunctional microplate reader (Perkin Elmer), reading, detecting the activity of the firefly luciferase, and taking a relative light unit value (RLU) as an activity unit, as shown in fig. 7 and 8.
The experimental results are as follows:
the results of example 3 of the invention show that: the klxrn1 delta-pScRNR 2-T7RNP is transformed in the way&The KlPAB1-KleIF4G (3in1) strain can significantly enhance the protein production efficiency of the yeast in vitro protein synthesis system, and FIG. 7 also shows thatIt can be seen that the value of luciferase activity in IVTT of Wild Type (WT) is 2.87 × 108, klxrn1Δ-pScRNR2-T7RNP&The luciferase activity of the KlPAB1-KleIF4G (3in1) yeast strain in IVTT is 1.539 × 109The activity was about 5.36 times that of the wild type, and it can be seen from FIG. 8 that if T7RNP was manually added from an external source, the activity was rather decreased, and the RLU value was 1.148 × 109(ii) a The highest activity was shown when the concentration of the externally added T7RNAP was 0 and was within the normal range (. gtoreq.10)8) The results show that the T7RNAP in the structure can be expressed in a proper amount and can meet the requirements of an in vitro translation system, and the nucleic acid construct of the structure can remarkably enhance the protein production efficiency of a yeast in vitro protein synthesis system, and the RLU value of the nucleic acid construct is 1.539 × 109。
Example 4
The method of example 3 was repeated except that the engineered strain of the invention only integrated the first fusion protein formed by the fusion of the PabI element with the eIF4G element.
The results show that engineered strains that incorporate only the first fusion protein of the PabI element fused to the eIF4G element increased luciferase activity in IVTT 2.6-fold compared to wild type.
Example 5
The method of example 3 was repeated except that the engineered strain of the invention knockdown only KlEXN53 nuclease.
The results showed that the engineered strain of the invention, which knocks out only KlEXN53 nuclease, increased luciferase activity in IVTT by 1.46-fold compared to the wild type.
Example 6 summary of the concept of designing in vitro biosynthetic System
As described above, the present invention summarizes the design concept of regulating in vitro synthesis by transcription, translation regulation and nuclease stabilization, i.e., a method for improving in vitro biosynthesis activity by integrating the knockout of exonuclease (KlEXN53), the preparation of endogenously expressed RNA polymerase (T7 RNP) and novel fusion protein (KlPAB1-KleIF4G) in cells, thereby achieving stable, efficient and rapid in vitro protein expression, as shown in fig. 9.
Reference documents:
1.Ayyar,B.V.,S.Arora,and R.O'Kennedy,Coming-of-Age of Antibodies inCancer Therapeutics.Trends Pharmacol Sci,2016.37(12):1009-1028.
2.Scott,A.M.,J.D.Wolchok,and L.J.,Antibody therapy of cancer.NatureReviews Cancer,2012.12(4):278.
3.Sonenberg,N.and A.G.Hinnebusch,Regulation of translation initiationin eukaryotes:mechanisms and biological targets.Cell,2009.136(4):731-45.
4.M.,D.J.R.G.,Nucleic Acid.Encyclopedia of Cell Biology,Elsevier,2015.
5.Chong,S.,Overview of Cell-Free Protein Synthesis:HistoricLandmarks, Commercial Systems,and Expanding Applications.2014:John Wiley&Sons,Inc. 16.30.1-16.30.11.
6.Buchner E,Rapp R.,Alkoholischeohne hefezellen.EuropeanJournal of Inorganic Chemistry,1897.30(3):2668-2678.
7.Welch P,Scopes R K,Studies on cell-free metabolism:Ethanolproduction by a yeast glycolytic system reconstituted from purifiedenzymes.Journal of biotechnology, 1985.2(5):257-273.
all documents referred to herein are incorporated by reference into this application as if each were individually incorporated by reference. Furthermore, it should be understood that various changes and modifications of the present invention can be made by those skilled in the art after reading the above teachings of the present invention, and these equivalents also fall within the scope of the present invention as defined by the appended claims.
Sequence listing
<110> Kangma (Shanghai) Biotech Co., Ltd
<120> a method for improving in vitro protein synthesis efficiency
<130>2018100936240
<141>2020-07-14
<160>46
<170>SIPOSequenceListing 1.0
<210>1
<211>592
<212>PRT
<213> Kluyveromyces lactis (Kluyveromyces lactis)
<400>1
Met Ser Asp Ile Thr Glu Lys Thr Ala Glu Gln Leu Glu Asn Leu Gln
1 5 10 15
Ile Asn Asp Asp Gln Gln Pro Ala Gln Ser Ala Ser Ala Pro Ser Thr
20 25 30
Ser Ala Ser Glu Ser Glu Ala Ser Ser Val Ser Lys Val Glu Asn Asn
35 40 45
Asn Ala Ser Leu Tyr Val Gly Glu Leu Asp Pro Asn Ile Thr Glu Ala
50 55 60
Leu Leu Tyr Asp Val Phe Ser Pro Leu Gly Pro Ile Ser Ser Ile Arg
65 70 75 80
Val Cys Arg Asp Ala Val Thr Lys Ala Ser Leu Gly Tyr Ala Tyr Val
85 90 95
Asn Tyr Thr Asp Tyr Glu Ala Gly Lys Lys Ala Ile Gln Glu Leu Asn
100 105 110
Tyr Ala Glu Ile Asn Gly Arg Pro Cys Arg Ile Met Trp Ser Glu Arg
115 120 125
Asp Pro Ala Ile Arg Lys Lys Gly Ser Gly Asn Ile Phe Ile Lys Asn
130 135 140
Leu His Pro Ala Ile Asp Asn Lys Ala Leu His Glu Thr Phe Ser Thr
145 150 155 160
Phe Gly Glu Val Leu Ser Cys Lys Val Ala Leu Asp Glu Asn Gly Asn
165 170 175
Ser Arg Gly Phe Gly Phe Val His Phe Lys Glu Glu Ser Asp Ala Lys
180 185 190
Asp Ala Ile Glu Ala Val Asn Gly Met Leu Met Asn Gly Leu Glu Val
195 200 205
Tyr Val Ala Met His Val Pro Lys Lys Asp Arg Ile Ser Lys Leu Glu
210 215 220
Glu Ala Lys Ala Asn Phe Thr Asn Ile Tyr Val Lys Asn Ile Asp Val
225 230 235 240
Glu Thr Thr Asp Glu Glu Phe Glu Gln Leu Phe Ser Gln Tyr Gly Glu
245 250 255
Ile Val Ser Ala Ala Leu Glu Lys Asp Ala Glu Gly Lys Pro Lys Gly
260 265 270
Phe Gly Phe Val Asn Phe Val Asp His Asn Ala Ala Ala Lys Ala Val
275 280 285
Glu Glu Leu Asn Gly Lys Glu Phe Lys Ser Gln Ala Leu Tyr Val Gly
290 295 300
Arg Ala Gln Lys Lys Tyr Glu Arg Ala Glu Glu Leu Lys Lys Gln Tyr
305 310 315 320
Glu Gln Tyr Arg Leu Glu Lys Leu Ala Lys Phe Gln Gly Val Asn Leu
325 330 335
Phe Ile Lys Asn Leu Asp Asp Ser Ile Asp Asp Glu Lys Leu Lys Glu
340 345 350
Glu Phe Ala Pro Tyr Gly Thr Ile Thr Ser Ala Arg Val Met Arg Asp
355 360 365
Gln Glu Gly Asn Ser Lys Gly Phe Gly Phe Val Cys Phe Ser Ser Pro
370 375 380
Glu Glu Ala Thr Lys Ala Met Thr Glu Lys Asn Gln Gln Ile Val Ala
385 390 395 400
Gly Lys Pro Leu Tyr Val Ala Ile Ala Gln Arg Lys Asp Val Arg Arg
405 410 415
Ser Gln Leu Ala Gln Gln Ile Gln Ala Arg Asn Gln Ile Arg Phe Gln
420 425 430
Gln Gln Gln Gln Gln Gln Ala Ala Ala Ala Ala Ala Gly Met Pro Gly
435 440 445
Gln Tyr Met Pro Gln Met Phe Tyr Gly Val Met Ala Pro Arg Gly Phe
450 455 460
Pro Gly Pro Asn Pro Gly Met Asn Gly Pro Met Gly Ala Gly Ile Pro
465 470 475 480
Lys Asn Gly Met Val Pro Pro Pro Gln Gln Phe Ala Gly Arg Pro Asn
485 490 495
Gly Pro Met Tyr Gln Gly Met Pro Pro Gln Asn Gln Phe Pro Arg His
500 505 510
Gln Gln Gln His Tyr Ile Gln Gln Gln Lys Gln Arg Gln Ala Leu Gly
515 520 525
Glu Gln Leu Tyr Lys Lys Val Ser Ala Lys Ile Asp Asp Glu Asn Ala
530 535 540
Ala Gly Lys Ile Thr Gly Met Ile Leu Asp Leu Pro Pro Gln Gln Val
545 550 555 560
Ile Gln Leu Leu Asp Asn Asp Glu Gln Phe Glu Gln Gln Phe Gln Glu
565 570 575
Ala Leu Ala Ala Tyr Glu Asn Phe Lys Lys Glu Gln Glu Ala Gln Ala
580 585 590
<210>2
<211>1021
<212>PRT
<213> Kluyveromyces lactis (Kluyveromyces lactis)
<400>2
Met Gly Glu Pro Thr Ser Asp Gln Gln Pro Ala Val Glu Ala Pro Val
1 5 10 15
Val Gln Glu Glu Thr Thr Ser Ser Pro Gln Lys Asn Ser Gly Tyr Val
20 25 30
Lys Asn Thr Ala Gly Ser Gly Ala Pro Arg Asn Gly Lys Tyr Asp Gly
35 40 45
Asn Arg Lys Asn Ser Arg Pro Tyr Asn Gln Arg Gly Asn Asn Asn Asn
50 55 60
Asn Asn Gly Ser Ser Ser Asn Lys His Tyr Gln Lys Tyr Asn Gln Pro
65 70 75 80
Ala Tyr Gly Val Ser Ala Gly Tyr Ile Pro Asn Tyr Gly Val Ser Ala
85 90 95
Glu Tyr Asn Pro Leu Tyr Tyr Asn Gln Tyr Gln Gln Gln Gln Gln Leu
100 105 110
Tyr Ala Ala Ala Tyr Gln Thr Pro Met Ser Gly Gln Gly Tyr Val Pro
115 120 125
Pro Val Val Ser Pro Ala Ala Val Ser Ala Lys Pro Ala Lys Val Glu
130 135 140
Ile Thr Asn Lys Ser Gly Glu His Ile Asp Ile Ala Ser Ile Ala His
145 150 155 160
Pro His Thr His Ser His Ser Gln Ser His Ser Arg Ala Val Pro Val
165 170 175
Val Ser Pro Pro Ala Asn Val Thr Val Ala Ala Ala Val Ser Ser Ser
180 185 190
Val Ser Pro Ser Ala Ser Pro Ala Val Lys Val Gln Ser Pro Ala Ala
195 200 205
Asn Gly Lys Glu Gln Ser Pro Ala Lys Pro Glu Glu Pro Lys Lys Asp
210 215 220
Thr Leu Ile Val Asn Asp Phe Leu Glu Gln Val Lys Arg Arg Lys Ala
225 230 235 240
Ala Leu Ala Ala Lys Lys Ala Val Glu Glu Lys Gly Pro Glu Glu Pro
245 250 255
Lys Glu Ser Val Val Gly Thr Asp Thr Asp Ala Ser Val Asp Thr Lys
260 265 270
Thr Gly Pro Thr Ala Thr Glu Ser Ala Lys Ser Glu Glu Ala Gln Ser
275 280 285
Glu Ser Gln Glu Lys Thr Lys Glu Glu Ala Pro Ala Glu Pro Lys Pro
290 295 300
Leu Thr Leu Ala Glu Lys Leu Arg Leu Lys Arg Met Glu Ala Ala Lys
305 310 315 320
Gln Ala Ser Ala Lys Thr Glu Glu Leu Lys Thr Glu Glu Ser Lys Pro
325 330 335
Glu Glu Thr Lys Thr Glu Glu Leu Lys Thr Glu Glu Ser Lys Pro Glu
340 345 350
Glu Thr Lys Thr Glu Glu Leu Lys Thr Glu Glu Thr Lys Ser Glu Glu
355 360 365
Leu Lys Thr Glu Glu Pro Lys Ala Glu Glu Ser Lys Ala Glu Glu Pro
370 375 380
Lys Pro Glu Glu Pro Lys Thr Glu Glu Pro Thr Thr Glu Gln Pro Lys
385 390 395 400
Ser Asp Glu Pro Lys Ser Glu Glu Ser Lys Thr Glu Glu Pro Lys Thr
405 410 415
Glu Val Leu Lys Thr Glu Glu Pro Lys Ser Glu Glu Ser Lys Pro Ala
420 425 430
Glu Pro Lys Thr Glu Glu Thr Ala Thr Glu Glu Thr Ala Thr Glu Ala
435 440 445
Asn Ala Glu Glu Gly Glu Pro Ala Pro Ala Gly Pro Val Glu Thr Pro
450 455 460
Ala Asp Val Glu Thr Lys Pro Arg Glu Glu Ala Glu Val Glu Asp Asp
465 470 475 480
Gly Lys Ile Thr Met Thr Asp Phe Leu Gln Lys Leu Lys Glu Val Ser
485 490 495
Pro Val Asp Asp Ile Tyr Ser Phe Gln Tyr Pro Ser Asp Ile Thr Pro
500 505 510
Pro Asn Asp Arg Tyr Lys Lys Thr Ser Ile Lys Tyr Ala Tyr Gly Pro
515 520 525
Asp Phe Leu Tyr Gln Phe Lys Glu Lys Val Asp Val Lys Tyr Asp Pro
530 535 540
Ala Trp Met Ala Glu Met Thr Ser Lys Ile Val Ile Pro Pro Lys Lys
545 550 555 560
Pro Gly Ser Ser Gly Arg Gly Glu Asp Arg Phe Ser Lys Gly Lys Val
565 570 575
Gly Ser Leu Arg Ser Glu Gly Arg Ser Gly Ser Arg Ser Asn Ser Lys
580 585 590
Lys Lys Ser Lys Arg Asp Asp Arg Lys Ser Asn Arg Ser Tyr Thr Ser
595 600 605
Arg Lys Asp Arg Glu Arg Phe Arg Glu Glu Glu Val Glu Glu Pro Lys
610 615 620
Val Glu Val Ala Pro Leu Val Pro Ser Ala Asn Arg Trp Val Pro Lys
625 630 635 640
Ser Lys Met Lys Lys Thr Glu Val Lys Leu Ala Pro Asp Gly Thr Glu
645 650 655
Leu Tyr Asp Ala Glu Glu Ala Ser Arg Lys Met Lys Ser Leu Leu Asn
660 665 670
Lys Leu Thr Leu Glu Met Phe Glu Pro Ile Ser Asp Asp Ile Met Lys
675 680 685
Ile Ala Asn Gln Ser Arg Trp Glu Glu Lys Gly Glu Thr Leu Lys Ile
690 695 700
Val Ile Gln Gln Ile Phe Asn Lys Ala Cys Asp Glu Pro His Trp Ser
705 710 715 720
Ser Met Tyr Ala Gln Leu Cys Gly Lys Val Val Lys Asp Leu Asp Asp
725 730 735
Ser Ile Lys Asp Ser Glu Thr Pro Asp Lys Thr Gly Ser His Leu Val
740 745 750
Leu His Tyr Leu Val Gln Arg Cys Gln Thr Glu Phe Gln Thr Gly Trp
755 760 765
Thr Asp Gln Leu Pro Thr Asn Glu Asp Gly Thr Pro Leu Gln Pro Glu
770 775 780
Met Met Ser Asp Glu Tyr Tyr Lys Met Ala Ala Ala Lys Arg Arg Gly
785 790 795 800
Leu Gly Leu Val Arg Phe Ile Gly Phe Leu Tyr Arg Ser Asn Leu Leu
805 810 815
Thr Ser Arg Met Val Phe Phe Cys Phe Lys Arg Leu Met Lys Asp Ile
820 825 830
Gln Asn Ser Pro Thr Glu Asp Thr Leu Glu Ser Val Cys Glu Leu Leu
835 840 845
Glu Thr Ile Gly Glu Gln Phe Glu Gly Ala Arg Ile Gln Val Thr Ala
850 855 860
Glu Ala Val Ile Glu Gly Ser Ser Leu Leu Asp Thr Leu Phe Asp Gln
865 870 875 880
Ile Lys Asn Val Ile Glu Asn Gly Asp Ile Ser Ser Arg Ile Lys Phe
885 890 895
Lys Leu Ile Asp Ile Val Glu Leu Arg Glu Lys Arg Asn Trp Asn Ser
900 905 910
Lys Asn Lys Asn Asp Gly Pro Lys Thr Ile Ala Gln Ile His Glu Glu
915 920 925
Glu Ala Leu Lys Arg Ala Leu Glu Glu Arg Glu Arg Glu Arg Asp Arg
930 935 940
His Gly Ser Arg Gly Gly Ser Arg Arg Met Asn Ser Glu Arg Asn Ser
945 950 955 960
Ser Arg Arg Asp Phe Ser Ser His Ser His Ser His Asn Gln Asn Arg
965 970 975
Asp Gly Phe Thr Thr Thr Arg Ser Ser Ser Val Arg Tyr Ser Glu Pro
980 985 990
Lys Lys Glu Glu Gln Ala Pro Thr Pro Thr Lys Ser Ser Gly Gly Ala
995 1000 1005
Ala Asn Met Phe Asp Ala Leu Met Asp Ala Glu Asp Asp
1010 1015 1020
<210>3
<211>1642
<212>PRT
<213> Artificial sequence (artificial sequence)
<400>3
Met Ser Asp Ile Thr Glu Lys Thr Ala Glu Gln Leu Glu Asn Leu Gln
1 5 10 15
Ile Asn Asp Asp Gln Gln Pro Ala Gln Ser Ala Ser Ala Pro Ser Thr
20 25 30
Ser Ala Ser Glu Ser Glu Ala Ser Ser Val Ser Lys Val Glu Asn Asn
35 40 45
Asn Ala Ser Leu Tyr Val Gly Glu Leu Asp Pro Asn Ile Thr Glu Ala
50 55 60
Leu Leu Tyr Asp Val Phe Ser Pro Leu Gly Pro Ile Ser Ser Ile Arg
65 7075 80
Val Cys Arg Asp Ala Val Thr Lys Ala Ser Leu Gly Tyr Ala Tyr Val
85 90 95
Asn Tyr Thr Asp Tyr Glu Ala Gly Lys Lys Ala Ile Gln Glu Leu Asn
100 105 110
Tyr Ala Glu Ile Asn Gly Arg Pro Cys Arg Ile Met Trp Ser Glu Arg
115 120 125
Asp Pro Ala Ile Arg Lys Lys Gly Ser Gly Asn Ile Phe Ile Lys Asn
130 135 140
Leu His Pro Ala Ile Asp Asn Lys Ala Leu His Glu Thr Phe Ser Thr
145 150 155 160
Phe Gly Glu Val Leu Ser Cys Lys Val Ala Leu Asp Glu Asn Gly Asn
165 170 175
Ser Arg Gly Phe Gly Phe Val His Phe Lys Glu Glu Ser Asp Ala Lys
180 185 190
Asp Ala Ile Glu Ala Val Asn Gly Met Leu Met Asn Gly Leu Glu Val
195 200 205
Tyr Val Ala Met His Val Pro Lys Lys Asp Arg Ile Ser Lys Leu Glu
210 215 220
Glu Ala Lys Ala Asn Phe Thr Asn Ile Tyr Val Lys Asn Ile Asp Val
225 230235 240
Glu Thr Thr Asp Glu Glu Phe Glu Gln Leu Phe Ser Gln Tyr Gly Glu
245 250 255
Ile Val Ser Ala Ala Leu Glu Lys Asp Ala Glu Gly Lys Pro Lys Gly
260 265 270
Phe Gly Phe Val Asn Phe Val Asp His Asn Ala Ala Ala Lys Ala Val
275 280 285
Glu Glu Leu Asn Gly Lys Glu Phe Lys Ser Gln Ala Leu Tyr Val Gly
290 295 300
Arg Ala Gln Lys Lys Tyr Glu Arg Ala Glu Glu Leu Lys Lys Gln Tyr
305 310 315 320
Glu Gln Tyr Arg Leu Glu Lys Leu Ala Lys Phe Gln Gly Val Asn Leu
325 330 335
Phe Ile Lys Asn Leu Asp Asp Ser Ile Asp Asp Glu Lys Leu Lys Glu
340 345 350
Glu Phe Ala Pro Tyr Gly Thr Ile Thr Ser Ala Arg Val Met Arg Asp
355 360 365
Gln Glu Gly Asn Ser Lys Gly Phe Gly Phe Val Cys Phe Ser Ser Pro
370 375 380
Glu Glu Ala Thr Lys Ala Met Thr Glu Lys Asn Gln Gln Ile Val Ala
385 390 395400
Gly Lys Pro Leu Tyr Val Ala Ile Ala Gln Arg Lys Asp Val Arg Arg
405 410 415
Ser Gln Leu Ala Gln Gln Ile Gln Ala Arg Asn Gln Ile Arg Phe Gln
420 425 430
Gln Gln Gln Gln Gln Gln Ala Ala Ala Ala Ala Ala Gly Met Pro Gly
435 440 445
Gln Tyr Met Pro Gln Met Phe Tyr Gly Val Met Ala Pro Arg Gly Phe
450 455 460
Pro Gly Pro Asn Pro Gly Met Asn Gly Pro Met Gly Ala Gly Ile Pro
465 470 475 480
Lys Asn Gly Met Val Pro Pro Pro Gln Gln Phe Ala Gly Arg Pro Asn
485 490 495
Gly Pro Met Tyr Gln Gly Met Pro Pro Gln Asn Gln Phe Pro Arg His
500 505 510
Gln Gln Gln His Tyr Ile Gln Gln Gln Lys Gln Arg Gln Ala Leu Gly
515 520 525
Glu Gln Leu Tyr Lys Lys Val Ser Ala Lys Ile Asp Asp Glu Asn Ala
530 535 540
Ala Gly Lys Ile Thr Gly Met Ile Leu Asp Leu Pro Pro Gln Gln Val
545 550 555560
Ile Gln Leu Leu Asp Asn Asp Glu Gln Phe Glu Gln Gln Phe Gln Glu
565 570 575
Ala Leu Ala Ala Tyr Glu Asn Phe Lys Lys Glu Gln Glu Ala Gln Ala
580 585 590
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Thr Gln Asp Glu Val Gln
595 600 605
Gly Pro His Ala Gly Lys Ser Thr Val Gly Gly Gly Gly Ser Gly Glu
610 615 620
Pro Thr Ser Asp Gln Gln Pro Ala Val Glu Ala Pro Val Val Gln Glu
625 630 635 640
Glu Thr Thr Ser Ser Pro Gln Lys Asn Ser Gly Tyr Val Lys Asn Thr
645 650 655
Ala Gly Ser Gly Ala Pro Arg Asn Gly Lys Tyr Asp Gly Asn Arg Lys
660 665 670
Asn Ser Arg Pro Tyr Asn Gln Arg Gly Asn Asn Asn Asn Asn Asn Gly
675 680 685
Ser Ser Ser Asn Lys His Tyr Gln Lys Tyr Asn Gln Pro Ala Tyr Gly
690 695 700
Val Ser Ala Gly Tyr Ile Pro Asn Tyr Gly Val Ser Ala Glu Tyr Asn
705 710 715 720
Pro Leu Tyr Tyr Asn Gln Tyr Gln Gln Gln Gln Gln Leu Tyr Ala Ala
725 730 735
Ala Tyr Gln Thr Pro Met Ser Gly Gln Gly Tyr Val Pro Pro Val Val
740 745 750
Ser Pro Ala Ala Val Ser Ala Lys Pro Ala Lys Val Glu Ile Thr Asn
755 760 765
Lys Ser Gly Glu His Ile Asp Ile Ala Ser Ile Ala His Pro His Thr
770 775 780
His Ser His Ser Gln Ser His Ser Arg Ala Val Pro Val Val Ser Pro
785 790 795 800
Pro Ala Asn Val Thr Val Ala Ala Ala Val Ser Ser Ser Val Ser Pro
805 810 815
Ser Ala Ser Pro Ala Val Lys Val Gln Ser Pro Ala Ala Asn Gly Lys
820 825 830
Glu Gln Ser Pro Ala Lys Pro Glu Glu Pro Lys Lys Asp Thr Leu Ile
835 840 845
Val Asn Asp Phe Leu Glu Gln Val Lys Arg Arg Lys Ala Ala Leu Ala
850 855 860
Ala Lys Lys Ala Val Glu Glu Lys Gly Pro Glu Glu Pro Lys Glu Ser
865 870 875 880
Val Val Gly Thr Asp Thr Asp Ala Ser Val Asp Thr Lys Thr Gly Pro
885 890 895
Thr Ala Thr Glu Ser Ala Lys Ser Glu Glu Ala Gln Ser Glu Ser Gln
900 905 910
Glu Lys Thr Lys Glu Glu Ala Pro Ala Glu Pro Lys Pro Leu Thr Leu
915 920 925
Ala Glu Lys Leu Arg Leu Lys Arg Met Glu Ala Ala Lys Gln Ala Ser
930 935 940
Ala Lys Thr Glu Glu Leu Lys Thr Glu Glu Ser Lys Pro Glu Glu Thr
945 950 955 960
Lys Thr Glu Glu Leu Lys Thr Glu Glu Ser Lys Pro Glu Glu Thr Lys
965 970 975
Thr Glu Glu Leu Lys Thr Glu Glu Thr Lys Ser Glu Glu Leu Lys Thr
980 985 990
Glu Glu Pro Lys Ala Glu Glu Ser Lys Ala Glu Glu Pro Lys Pro Glu
995 1000 1005
Glu Pro Lys Thr Glu Glu Pro Thr Thr Glu Gln Pro Lys Ser Asp Glu
1010 1015 1020
Pro Lys Ser Glu Glu Ser Lys Thr Glu Glu Pro Lys Thr Glu Val Leu
1025 1030 1035 1040
Lys Thr Glu Glu Pro Lys Ser Glu Glu Ser Lys Pro Ala Glu Pro Lys
1045 1050 1055
Thr Glu Glu Thr Ala Thr Glu Glu Thr Ala Thr Glu Ala Asn Ala Glu
1060 1065 1070
Glu Gly Glu Pro Ala Pro Ala Gly Pro Val Glu Thr Pro Ala Asp Val
1075 1080 1085
Glu Thr Lys Pro Arg Glu Glu Ala Glu Val Glu Asp Asp Gly Lys Ile
1090 1095 1100
Thr Met Thr Asp Phe Leu Gln Lys Leu Lys Glu Val Ser Pro Val Asp
1105 1110 1115 1120
Asp Ile Tyr Ser Phe Gln Tyr Pro Ser Asp Ile Thr Pro Pro Asn Asp
1125 1130 1135
Arg Tyr Lys Lys Thr Ser Ile Lys Tyr Ala Tyr Gly Pro Asp Phe Leu
1140 1145 1150
Tyr Gln Phe Lys Glu Lys Val Asp Val Lys Tyr Asp Pro Ala Trp Met
1155 1160 1165
Ala Glu Met Thr Ser Lys Ile Val Ile Pro Pro Lys Lys Pro Gly Ser
1170 1175 1180
Ser Gly Arg Gly Glu Asp Arg Phe Ser Lys Gly Lys Val Gly Ser Leu
1185 1190 1195 1200
Arg Ser Glu Gly Arg Ser Gly Ser Arg Ser Asn Ser Lys Lys Lys Ser
1205 1210 1215
Lys Arg Asp Asp Arg Lys Ser Asn Arg Ser Tyr Thr Ser Arg Lys Asp
1220 1225 1230
Arg Glu Arg Phe Arg Glu Glu Glu Val Glu Glu Pro Lys Val Glu Val
1235 1240 1245
Ala Pro Leu Val Pro Ser Ala Asn Arg Trp Val Pro Lys Ser Lys Met
1250 1255 1260
Lys Lys Thr Glu Val Lys Leu Ala Pro Asp Gly Thr Glu Leu Tyr Asp
1265 1270 1275 1280
Ala Glu Glu Ala Ser Arg Lys Met Lys Ser Leu Leu Asn Lys Leu Thr
1285 1290 1295
Leu Glu Met Phe Glu Pro Ile Ser Asp Asp Ile Met Lys Ile Ala Asn
1300 1305 1310
Gln Ser Arg Trp Glu Glu Lys Gly Glu Thr Leu Lys Ile Val Ile Gln
1315 1320 1325
Gln Ile Phe Asn Lys Ala Cys Asp Glu Pro His Trp Ser Ser Met Tyr
1330 1335 1340
Ala Gln Leu Cys Gly Lys Val Val Lys Asp Leu Asp Asp Ser Ile Lys
1345 1350 1355 1360
Asp Ser Glu Thr Pro Asp Lys Thr Gly Ser His Leu Val Leu His Tyr
1365 1370 1375
Leu Val Gln Arg Cys Gln Thr Glu Phe Gln Thr Gly Trp Thr Asp Gln
1380 1385 1390
Leu Pro Thr Asn Glu Asp Gly Thr Pro Leu Gln Pro Glu Met Met Ser
1395 1400 1405
Asp Glu Tyr Tyr Lys Met Ala Ala Ala Lys Arg Arg Gly Leu Gly Leu
1410 1415 1420
Val Arg Phe Ile Gly Phe Leu Tyr Arg Ser Asn Leu Leu Thr Ser Arg
1425 1430 1435 1440
Met Val Phe Phe Cys Phe Lys Arg Leu Met Lys Asp Ile Gln Asn Ser
1445 1450 1455
Pro Thr Glu Asp Thr Leu Glu Ser Val Cys Glu Leu Leu Glu Thr Ile
1460 1465 1470
Gly Glu Gln Phe Glu Gly Ala Arg Ile Gln Val Thr Ala Glu Ala Val
1475 1480 1485
Ile Glu Gly Ser Ser Leu Leu Asp Thr Leu Phe Asp Gln Ile Lys Asn
1490 1495 1500
Val Ile Glu Asn Gly Asp Ile Ser Ser Arg Ile Lys Phe Lys Leu Ile
1505 1510 1515 1520
Asp Ile Val Glu Leu Arg Glu Lys Arg Asn Trp Asn Ser Lys Asn Lys
1525 1530 1535
Asn Asp Gly Pro Lys Thr Ile Ala Gln Ile His Glu Glu Glu Ala Leu
1540 1545 1550
Lys Arg Ala Leu Glu Glu Arg Glu Arg Glu Arg Asp Arg His Gly Ser
1555 1560 1565
Arg Gly Gly Ser Arg Arg Met Asn Ser Glu Arg Asn Ser Ser Arg Arg
1570 1575 1580
Asp Phe Ser Ser His Ser His Ser His Asn Gln Asn Arg Asp Gly Phe
1585 1590 1595 1600
Thr Thr Thr Arg Ser Ser Ser Val Arg Tyr Ser Glu Pro Lys Lys Glu
1605 1610 1615
Glu Gln Ala Pro Thr Pro Thr Lys Ser Ser Gly Gly Ala Ala Asn Met
1620 1625 1630
Phe Asp Ala Leu Met Asp Ala Glu Asp Asp
1635 1640
<210>4
<211>3542
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>4
agtcgaacaa gaagcaggca aagtttagag cactgcccct ccgcactcaa aaaagaaaaa 60
actaggagga aaataaaatt ctcaaccaca caaacacata aacacataca aatacaaata 120
caagcttatt tacttgacat cgcgcgatct tccactattc agcgccgtcc gccctctctc 180
gtgttttttg tttacgcgac aactatgcga aatccggagc aacgggcaac cgtttgggga 240
aagaccacac ccacgcgcga tcgccatggc aacgaggtcg cacacgcccc acacccagac 300
ctccctgcga gcgggcatgg gtacaatgtc cccgttgcca cagacaccac ttcgtagcac 360
agcgcagagc gtagcgtgtt gttgctgctg acaaaagaaa atttttctta gcaaagcaaa 420
ggaggggaag cacgggcaga tagcaccgta ccataccctt ggaaactcga aatgaacgaa 480
gcaggaaatg agagaatgag agttttgtag gtatatatag cggtagtgtt tgcgcgttac 540
catcatcttc tggatctatc tattgttctt ttcctcatca ctttcccctt tttcgctctt 600
cttcttgtct tttatttctt tctttttttt aattgttccc tcgattggct atctaccaaa 660
gaatccaaac ttaatacacg tatttatttg tccaattacc atgaacacga ttaacatcgc 720
taagaacgac ttctctgaca tcgaactggc tgctatcccg ttcaacactc tggctgacca 780
ttacggtgag cgtttagctc gcgaacagtt ggcccttgag catgagtctt acgagatggg 840
tgaagcacgc ttccgcaaga tgtttgagcg tcaacttaaa gctggtgagg ttgcggataa 900
cgctgccgcc aagcctctca tcactaccct actccctaag atgattgcac gcatcaacga 960
ctggtttgag gaagtgaaag ctaagcgcgg caagcgcccg acagccttcc agttcctgca 1020
agaaatcaag ccggaagccg tagcgtacat caccattaag accactctgg cttgcctaac 1080
cagtgctgac aatacaaccg ttcaggctgt agcaagcgca atcggtcggg ccattgagga 1140
cgaggctcgc ttcggtcgta tccgtgacct tgaagctaag cacttcaaga aaaacgttga 1200
ggaacaactc aacaagcgcg tagggcacgt ctacaagaaa gcatttatgc aagttgtcga 1260
ggctgacatg ctctctaagg gtctactcgg tggcgaggcg tggtcttcgt ggcataagga 1320
agactctatt catgtaggag tacgctgcat cgagatgctc attgagtcaa ccggaatggt 1380
tagcttacac cgccaaaatg ctggcgtagt aggtcaagac tctgagacta tcgaactcgc 1440
acctgaatac gctgaggcta tcgcaacccg tgcaggtgcg ctggctggca tctctccgat 1500
gttccaacct tgcgtagttc ctcctaagcc gtggactggc attactggtg gtggctattg 1560
ggctaacggt cgtcgtcctc tggcgctggt gcgtactcac agtaagaaag cactgatgcg 1620
ctacgaagac gtttacatgc ctgaggtgta caaagcgatt aacattgcgc aaaacaccgc 1680
atggaaaatc aacaagaaag tcctagcggt cgccaacgta atcaccaagt ggaagcattg 1740
tccggtcgag gacatccctg cgattgagcg tgaagaactc ccgatgaaac cggaagacat 1800
cgacatgaat cctgaggctc tcaccgcgtg gaaacgtgct gccgctgctg tgtaccgcaa 1860
ggacaaggct cgcaagtctc gccgtatcag ccttgagttc atgcttgagc aagccaataa 1920
gtttgctaac cataaggcca tctggttccc ttacaacatg gactggcgcg gtcgtgttta 1980
cgctgtgtca atgttcaacc cgcaaggtaa cgatatgacc aaaggactgc ttacgctggc 2040
gaaaggtaaa ccaatcggta aggaaggtta ctactggctg aaaatccacg gtgcaaactg 2100
tgcgggtgtc gataaggttc cgttccctga gcgcatcaag ttcattgagg aaaaccacga 2160
gaacatcatg gcttgcgcta agtctccact ggagaacact tggtgggctg agcaagattc 2220
tccgttctgc ttccttgcgt tctgctttga gtacgctggg gtacagcacc acggcctgag 2280
ctataactgc tcccttccgc tggcgtttga cgggtcttgc tctggcatcc agcacttctc 2340
cgcgatgctc cgagatgagg taggtggtcg cgcggttaac ttgcttccta gtgaaaccgt 2400
tcaggacatc tacgggattg ttgctaagaa agtcaacgag attctacaag cagacgcaat 2460
caatgggacc gataacgaag tagttaccgt gaccgatgag aacactggtg aaatctctga 2520
gaaagtcaag ctgggcacta aggcactggc tggtcaatgg ctggcttacg gtgttactcg 2580
cagtgtgact aagcgttcag tcatgacgct ggcttacggg tccaaagagt tcggcttccg 2640
tcaacaagtg ctggaagata ccattcagcc agctattgat tccggcaagg gtctgatgtt 2700
cactcagccg aatcaggctg ctggatacat ggctaagctg atttgggaat ctgtgagcgt 2760
gacggtggta gctgcggttg aagcaatgaa ctggcttaag tctgctgcta agctgctggc 2820
tgctgaggtc aaagataaga agactggaga gattcttcgc aagcgttgcg ctgtgcattg 2880
ggtaactcct gatggtttcc ctgtgtggca ggaatacaag aagcctattc agacgcgctt 2940
gaacctgatg ttcctcggtc agttccgctt acagcctacc attaacacca acaaagatag 3000
cgagattgat gcacacaaac aggagtctgg tatcgctcct aactttgtac acagccaaga 3060
cggtagccac cttcgtaaga ctgtagtgtg ggcacacgag aagtacggaa tcgaatcttt 3120
tgcactgatt cacgactcct tcggtaccat tccggctgac gctgcgaacc tgttcaaagc 3180
agtgcgcgaa actatggttg acacatatga gtcttgtgat gtactggctg atttctacga 3240
ccagttcgct gaccagttgc acgagtctca attggacaaa atgccagcac ttccggctaa 3300
aggtaacttg aacctccgtg acatcttaga gtcggacttcgcgttcgcgt aaatccgctc 3360
taaccgaaaa ggaaggagtt agacaacctg aagtctaggt ccctatttat ttttttatag 3420
ttatgttagt attaagaacg ttatttatat ttcaaatttt tctttttttt ctgtacagac 3480
gcgtgtacgc atgtaacatt atactgaaaa ccttgcttga gaaggttttg ggacgctcga 3540
ag 3542
<210>5
<211>4362
<212>DNA
<213> Kluyveromyces lactis (Kluyveromyces lactis)
<400>5
atgggtattc caaaattctt tcatttcatc tctgagagat ggcctcaaat ttctcaattg 60
atcgatggat cacagattcc agagttcgac aatttgtact tggatatgaa ttctattttg 120
cataattgta cgcatggtga tggtagcgag gtgaattcaa gactatcaga ggaagaagtt 180
tattccaaaa ttttcagtta tattgatcat cttttccata ctattaaacc aaaacagaca 240
ttttatatgg caatcgatgg tgtggcccca agagcaaaga tgaaccaaca aagagctcgt 300
agattcagaa ctgccatgga tgccgaaaag gctttgcaga aggccattga aaatggtgac 360
gagttgccta agggagagcc atttgattcc aacgctatta ccccaggaac agaatttatg 420
gcaaaattaa ccgagaattt gaaatatttc atccatgaca agatcaccaa cgataccaga 480
tggcagaacg tgaaggttat tttctccggg catgaggttc ctggtgaagg tgaacataag 540
atcatggatt acatcagagc aattagagca caagaggatt acaatccaaa tacaagacat 600
tgtatctacg ggttagatgc tgatttgatc atcctaggtt tatccaccca tgatcaccac 660
ttttgtttat taagagaaga agttacttttggtaaacgtt cgtcttctgt gaaaactcta 720
gaaacacaga acttcttctt gttgcatttg tctatcttga gagaatattt ggcattagag 780
ttcgaagaaa taacagattc tgtgcagttt gaatacgact ttgaaagagt attagatgat 840
ttcatctttg tattatttac catcggtaat gatttcttac caaatttgcc cgatttgcat 900
ttgaaaaaag gtgcattccc tgtgctatta caaactttta aagaagctct ccaacatatg 960
gatggttaca ttaatgaaca aggtaagata aatttggcaa gattttccat ttggttgaag 1020
tacttgtccg attttgaata ccttaacttt gagaagaaag atattgacgt tgaatggttc 1080
aatcaacaac ttgaaaatat ttccttggaa ggtgagcgta aacgtactag gatgggtaaa 1140
aagttgttga tgaaacaaca aaagaaattg attggcgccg taaaaccatg gttattgaaa 1200
accgttcaac ggaaggtcac ttctgaatta caggatgccg atttcgaaat tttccctctt 1260
gaggataaag aattggttcg ggccaacctg gatttcttga aggaattcgc atttgatttg 1320
ggtttaattc ttgctcattc taaatcaaaa gatttgtact acttcaagtt ggatttagac 1380
tccatcaatg tgcaagaaac agatgaagag catgaagccc gtattcacga aacaagacgt 1440
tctattaaga aatatgaaca aggtattatt attgcatctg aagaagaatt agaagaagag 1500
cgtgaaattt atagcgagag attcgttgag tggaaagatc aatactataa agataaatta 1560
gatttttcca tcaatgatac tgatagtcta aaagaaatga cagaaaacta tgtcggaggt 1620
ttacaatggg ttttatacta ctattatcgt ggatgtccat cttggtcctg gtattacaga 1680
tatcattacg ctcctcgtat atcagatgtg atcaaaggta tagatcagaa catagaattt 1740
cacaagggac agcctttcaa gcccttccaa caattgatgg ccgtcttgcc tgagagatca 1800
aagaatttga ttccagttgt gtacagacca ctcatgtatg atgaacactc tcctatcttg 1860
gacttctatc ctaacgaagt agagttggat ctaaatggca aaacagcaga ctgggaagct 1920
gtcgtcaaaa tttcattcgt ggatcaaaag cgtttagtag aagcaatggc tccttatgat 1980
gctaagcttt ctccggatga aaagaaaaga aattcgttcg gaactgatct gattttcata 2040
ttcaatcctc aggtagacac agtttacaaa acaccactag cggggttgtt taatgatatt 2100
gaacacaatc attgtatcga aagggaattc attccagaat cgatggaaaa cgttaagttc 2160
ttatttggtt tgccaaaggg cgctaaactc ggagctagct ctttggccgg tttcccatcc 2220
ctaaagacac taccactaac tgcagagctt gcttataatt cttctgttgt cttcaatttc 2280
ccttctaaac aacaatctat ggtgttgcat attcaggacc tttacaagga aaatggcatc 2340
tctctgtcag atctagcaaa aagacatatg ggtaagattg tttattcaag atggccgttt 2400
ctaagagaat ctaaactttt gtcgttgatt acagaggaaa ctgtgtatga aggagttaag 2460
tcaggcaaat taacaaaggt cattgaaaga aagcctcagg attttgaaag gaaagaattt 2520
agagagttga agatgactct caaatcgaat tatcaaagga caaaggccat tcttttggat 2580
gacatttctg ctttggctaa agtggttcca gtaaatggat tggtgagaaa ctctgatggt 2640
tcctattcta agtctttcaa tgaaactatc gaatactatc ctttacaatt aatcgtagag 2700
gacgtaaaaa ataaggacga aagatatatt gaaaaagagc cgttaccaat taataaagaa 2760
tttccaaaag gttcaaaagt tgtgttttta ggtgattatg cgtatggtgg ggaggcgacc 2820
gttgatggtt ataatagtga gactagatta aaacttacag tcaaaaaggg ttctctcaga2880
gcagagccta acatcggaaa agttagagcg aaattggatt ctcaagcctt gagattctac 2940
ccaacacaag tgttttcaaa aatagctcgt gtccaccctc tcttcttgtc aaaaattact 3000
tcaagatatt tggtcaatga ttctaaaaag aaaagccata acgtcggttt gatgatcaaa 3060
ttcaaagcaa gaaatcaaaa agttctcggt tatgccagat gcagctcaaa caaatgggaa 3120
tactctgacg tcgctcttgg tttgttagag cagttcagat ctacattccc tgagttcttt 3180
gcgaaacttt ctaactcgaa ggaacaagca attccatcga tcactgatct cttccctaac 3240
aaatctagcg cggaagctga ttccattttg aaaacagtgg ctgattggct ctcagaagca 3300
agaaaaccat tcgtggtggt gtctttggaa agtgattcgc taaccaaggc ttcgatggca 3360
gctgttgaat ctgaaatcat aaaatacgtt tctttaccag attcaagcga gcagaagaaa 3420
ttagctaagg tcccacgtga ggcaatctta aatgcggaat cgtcatatgt tctattgcgc 3480
tcccaaaggt tccacttagg tgatagggta atgtacattc aagattcagg caaggttcca 3540
cttcacagca aaggtactgt cgttggctac acttcaattg gcaagaacgt ctcaatccaa 3600
gttctatttg acaatgaaat aattgcagga aacaactttg gtggtaggtt gcagaccaga 3660
cgtggtttgg gattggactc ttccttctta ttaaacttgt ctgatagaca attggtatat 3720
cattcaaagg catcgaagag tgctgataag aaaccaaaag cagttcctaa tgataagcaa 3780
gtcgccctcg caaaaaagaa gagagtggag gaactcaaaa aaaagcaagc ccatgagttg 3840
ttaaatcata tcaagaagga taacgcggaa tcaaataccg aatctggatc cgctccgcaa 3900
atagcagtta acactttaaa tccttcggct gctaacaacg tgttcaatgc cgtcttgaac 3960
caaatcaaac caggttctca acagcaaatt caaccacctc cagcaaattc tctgccttac 4020
aatttcactg ttcccccaca tatggttcct ggtggtattc ctcatcctct tatgatgcag 4080
ccgcctttca ttccgaataa tgagcatatt gcttatgcag ctcctcctca gtcacaacct 4140
gtacaaaatc caccattaga taaagaggca tccaggaatc ttaagaatct cctaattaga 4200
gatgagaatg gacgtacagc aaatgtggag aataaagact cagatgatac aaagagatct 4260
tctcattctc gtggcggtcg tcgtggccgt agtaatcgtg gtcgtggtgc ctccgggagg 4320
ggtggtcatt tcaaaaattc tcctaaaaaa actgaaacct ga 4362
<210>6
<211>513
<212>PRT
<213> Kluyveromyces lactis (Kluyveromyces lactis)
<400>6
Met Gly Ile Pro Lys Phe Phe His Phe Ile Ser Glu Arg Trp Pro Gln
1 5 10 15
Ile Ser Gln Leu Ile Asp Gly Ser Gln Ile Pro Glu Phe Asp Asn Leu
20 25 30
Tyr Leu Asp Met Asn Ser Ile Leu His Asn Cys Thr His Gly Asp Gly
35 40 45
Ser Glu Val Asn Ser Arg Leu Ser Glu Glu Glu Val Tyr Ser Lys Ile
50 55 60
Phe Ser Tyr Ile Asp His Leu Phe His Thr Ile Lys Pro Lys Gln Thr
6570 75 80
Phe Tyr Met Ala Ile Asp Gly Val Ala Pro Arg Ala Lys Met Asn Gln
85 90 95
Gln Arg Ala Arg Arg Phe Arg Thr Ala Met Asp Ala Glu Lys Ala Leu
100 105 110
Gln Lys Ala Ile Glu Asn Gly Asp Glu Leu Pro Lys Gly Glu Pro Phe
115 120 125
Asp Ser Asn Ala Ile Thr Pro Gly Thr Glu Phe Met Ala Lys Leu Thr
130 135 140
Glu Asn Leu Lys Tyr Phe Ile His Asp Lys Ile Thr Asn Asp Thr Arg
145 150 155 160
Trp Gln Asn Val Lys Val Ile Phe Ser Gly His Glu Val Pro Gly Glu
165 170 175
Gly Glu His Lys Ile Met Asp Tyr Ile Arg Ala Ile Arg Ala Gln Glu
180 185 190
Asp Tyr Asn Pro Asn Thr Arg His Cys Ile Tyr Gly Leu Asp Ala Asp
195 200 205
Leu Ile Ile Leu Gly Leu Ser Thr His Asp His His Phe Cys Leu Leu
210 215 220
Arg Glu Glu Val Thr Phe Gly Lys Arg Ser Ser Ser Val Lys Thr Leu
225230 235 240
Glu Thr Gln Asn Phe Phe Leu Leu His Leu Ser Ile Leu Arg Glu Tyr
245 250 255
Leu Ala Leu Glu Phe Glu Glu Ile Thr Asp Ser Val Gln Phe Glu Tyr
260 265 270
Asp Phe Glu Arg Val Leu Asp Asp Phe Ile Phe Val Leu Phe Thr Ile
275 280 285
Gly Asn Asp Phe Leu Pro Asn Leu Pro Asp Leu His Leu Lys Lys Gly
290 295 300
Ala Phe Pro Val Leu Leu Gln Thr Phe Lys Glu Ala Leu Gln His Met
305 310 315 320
Asp Gly Tyr Ile Asn Glu Gln Gly Lys Ile Asn Leu Ala Arg Phe Ser
325 330 335
Ile Trp Leu Lys Tyr Leu Ser Asp Phe Glu Tyr Leu Asn Phe Glu Lys
340 345 350
Lys Asp Ile Asp Val Glu Trp Phe Asn Gln Gln Leu Glu Asn Ile Ser
355 360 365
Leu Glu Gly Glu Arg Lys Arg Thr Arg Met Gly Lys Lys Leu Leu Met
370 375 380
Lys Gln Gln Lys Lys Leu Ile Gly Ala Val Lys Pro Trp Leu Leu Lys
385 390395 400
Thr Val Gln Arg Lys Val Thr Ser Glu Leu Gln Asp Ala Asp Phe Glu
405 410 415
Ile Phe Pro Leu Glu Asp Lys Glu Leu Val Arg Ala Asn Leu Asp Phe
420 425 430
Leu Lys Glu Phe Ala Phe Asp Leu Gly Leu Ile Leu Ala His Ser Lys
435 440 445
Ser Lys Asp Leu Tyr Tyr Phe Lys Leu Asp Leu Asp Ser Ile Asn Val
450 455 460
Gln Glu Thr Asp Glu Glu His Glu Ala Arg Ile His Glu Thr Arg Arg
465 470 475 480
Ser Ile Lys Lys Tyr Glu Gln Gly Ile Ile Ile Ala Ser Glu Glu Glu
485 490 495
Leu Glu Glu Glu Arg Glu Ile Tyr Ser Glu Arg Phe Val Glu Trp Lys
500 505 510
Asp
<210>7
<211>3066
<212>DNA
<213> Kluyveromyces lactis (Kluyveromyces lactis)
<400>7
atgggcgaac ctacatccga tcagcaacca gctgttgaag ctccagttgt gcaggaggag 60
acaaccagtt ctccgcaaaa aaacagtgga tatgtcaaga atactgctgg aagcggtgct 120
cctagaaatg ggaaatatga tggtaacagg aagaactcta ggccttataa ccaaagaggt 180
aacaacaaca ataataatgg ttcttcctcg aataagcact atcaaaagta taaccaacca 240
gcgtacggtg tttctgcggg atacattccg aactacggcg tatcggcaga gtacaaccct 300
ctgtactata accagtacca acagcagcaa cagctgtacg ctgctgctta ccagactcca 360
atgagcggac aaggttatgt ccccccagta gtgtctccag ctgctgtttc agctaaacca 420
gcgaaggttg agattactaa caagtctggt gaacacatag atattgcttc cattgctcat 480
ccacatactc attctcattc tcaatctcat tcgcgtgcag ttccagtagt gtcgcctcca 540
gctaacgtta ccgtcgctgc tgctgtatca tcctctgtgt ctccatcagc ttctccagct 600
gtcaaagtac agagccctgc tgctaatggt aaggaacaat ctccagctaa gcctgaagaa 660
ccaaagaagg acactttaat tgtgaacgat ttcttggaac aagttaaaag acgcaaggct 720
gctttagctg ctaagaaggc tgtcgaagag aagggtcctg aggaaccgaa ggaatctgtc 780
gttggaactg acactgatgc aagcgttgat actaagacag ggcctacagc cactgaatct 840
gccaagtctg aagaagctca atcagaatca caagaaaaga ctaaggaaga ggctccagct 900
gagccaaaac cattgacttt ggccgaaaaa ttgagactta agaggatgga agctgcaaag 960
caagcttctg ctaagaccga ggaactaaag actgaagaat ctaagcctga agaaacaaag 1020
accgaggagc taaagactga agaatctaag cctgaagaaa caaagaccga ggagctaaag 1080
actgaagaaa caaagtccga ggaactaaag actgaagaac ctaaggcgga agaatcaaag 1140
gcggaagaac caaagcctga agaaccaaag accgaggaac cgacgactga acaaccaaag 1200
tcagatgaac caaagtcgga agaatcaaaa actgaagagc caaaaaccga ggtattaaag 1260
actgaagaac caaaatcgga agaatcaaag cctgcagaac caaagactga agaaacagca 1320
actgaagaaa cagcaactga agcaaacgcc gaagaaggtg aaccggctcc tgctggtccc 1380
gttgaaactc ctgctgatgt tgaaacaaaa cctcgagaag aggctgaagt tgaagacgat 1440
ggaaagatta ccatgaccga tttcctacag aagttgaaag aggtttctcc agttgatgat 1500
atttattcct tccaataccc aagtgacatt acgcctccaa atgatagata taaaaagaca 1560
agcattaaat atgcatacgg acctgatttc ttgtatcagt tcaaagaaaa ggtcgatgtt 1620
aaatacgatc cagcgtggat ggctgaaatg acgagtaaaa ttgtcatccc tcctaagaag 1680
cctggttcaa gcggaagagg cgaagataga tttagtaagg gtaaggttgg atctctaaga 1740
agtgaaggca gatcgggttc caggtccaac tcgaagaaga agtcaaagag ggatgataga 1800
aaatctaata gatcatacac ttccagaaag gaccgtgaaa gattcagaga ggaagaagtc 1860
gaagagccaa aggttgaggt tgccccattg gtcccaagtg ctaatagatg ggttcctaaa 1920
tctaagatga agaaaacaga agtcaagtta gctccagacg gaacagaact ttacgacgcg 1980
gaagaagcat caagaaagat gaagtcattg ctgaataaat tgacattaga aatgttcgaa 2040
cctatttctg atgatatcat gaagatcgct aaccaatcta gatgggaaga aaagggtgag 2100
actttgaaga ttgtcatcca acaaattttc aataaggcct gcgatgaacc tcattggtca 2160
tcaatgtacg cgcaattatg tggtaaggtc gttaaagact tagatgatag cattaaagac 2220
tcagaaaccc cagataagac tggttctcac ttggttttgc attacttagt ccaaagatgt 2280
caaactgaat tccaaacagg atggactgat caactaccta caaacgaaga cggtactcct 2340
ctacaacctg aaatgatgtc cgatgaatac tataagatgg ctgccgctaa gagaagaggt 2400
ttgggtttgg ttcgtttcat tggtttcttg taccgttcga acttattgac ttccagaatg 2460
gtcttcttct gtttcaagag actaatgaag gatattcaaa actctcctac tgaagatact 2520
ctagagtctg tatgtgaact tttggaaaca attggtgaac agttcgaagg tgctcgtatt 2580
caagttactg cagaagctgt cattgagggt tcaagcttgc tagacacact attcgaccaa 2640
ataaagaacg tgatcgaaaa tggtgacatc tccagcagaa tcaagtttaa gttgatcgac 2700
attgtcgaac taagagaaaa gaggaactgg aatagtaaaa ataagaacga tggtccaaag 2760
accattgctc aaattcacga agaagaagcc ttgaagaggg ctttggagga aagagaaaga 2820
gaaagagatc gccatgggtc cagaggtggt tccagacgta tgaatagcga gagaaactct 2880
tctagaagag atttctcctc tcattctcac agtcacaatc aaaatagaga cggtttcact 2940
actaccagat cgtcatcagt gagatattct gagccaaaga aggaagaaca agctccaact 3000
ccaactaaat cttctggtgg cgctgccaac atgtttgatg cattgatgga tgccgaagat 3060
gattaa 3066
<210>8
<211>1779
<212>DNA
<213> Kluyveromyces lactis (Kluyveromyces lactis)
<400>8
atgtctgata ttactgaaaa aactgctgag caattggaaa acttgcagat caacgatgat 60
cagcaaccag ctcaatctgc cagtgctcca tccacttctg cttctgaaag cgaagcttct120
tctgtttcta aggttgaaaa caacaacgct tcattgtacg ttggtgaatt ggatccaaac 180
attactgaag cattgttgta cgatgtgttt tcaccattgg gtccaatttc ctcgatccgt 240
gtttgtcgtg atgccgtcac caaggcttcg ttaggttacg cttacgttaa ctatactgat 300
tacgaagctg gtaagaaagc tattcaagaa ttgaactatg ctgaaatcaa cggtagacca 360
tgtagaatta tgtggtccga acgtgaccca gctatcagaa agaagggttc tggtaacatt 420
ttcatcaaga acttgcaccc agccattgac aacaaggctt tgcatgaaac tttctccact 480
ttcggtgaag tcttgtcttg taaagttgct ttagatgaga atggaaactc tagaggcttc 540
ggtttcgttc atttcaagga agaatccgat gctaaggatg ctattgaagc cgtcaacggt 600
atgttgatga acggtttgga agtttacgtt gccatgcacg ttccaaagaa ggaccgtatc 660
tccaagttgg aagaagccaa ggctaacttc accaacattt acgtcaagaa cattgacgtt 720
gaaaccactg acgaagagtt cgaacagttg ttctcccaat acggtgaaat tgtctctgct 780
gctttggaaa aggatgctga gggtaagcca aagggtttcg gtttcgttaa ctttgttgac 840
cacaacgccg ctgccaaggc cgttgaagag ttgaacggta aggaattcaa gtctcaagct 900
ttgtacgttg gcagagctca aaagaagtac gaacgtgctg aagaattgaa gaaacaatac 960
gaacaatacc gtttggaaaa attggctaag ttccaaggtg ttaacttgtt catcaagaac 1020
ttggacgatt ccatcgatga cgaaaaattg aaggaagaat tcgccccata cggtaccatc 1080
acctctgcta gagtcatgag agaccaagag ggtaactcta agggtttcgg tttcgtttgt 1140
ttctcttctc cagaagaagc taccaaggct atgaccgaaa agaaccaaca aattgttgcc 1200
ggtaagccat tgtacgttgc cattgctcaa agaaaggatg tcagaagatc ccaattggct 1260
caacaaattc aagccagaaa ccaaatcaga ttccaacaac agcaacaaca acaagctgct 1320
gccgctgctg ctggtatgcc aggccaatac atgccacaaa tgttctatgg tgttatggcc 1380
ccaagaggtt tcccaggtcc aaacccaggt atgaacggcc caatgggtgc cggtattcca 1440
aagaacggta tggtcccacc accacaacaa tttgctggta gaccaaacgg tccaatgtac 1500
caaggtatgc cacctcaaaa ccaattccca agacaccaac aacaacacta catccaacaa 1560
caaaagcaaa gacaagcctt gggtgaacaa ttgtacaaga aggtcagtgc caagattgac 1620
gacgaaaacg ccgctggtaa gatcaccggt atgatcttgg atctaccacc acagcaagtc 1680
atccaattgt tggacaacga cgaacaattt gaacagcaat tccaagaagc cttagctgct 1740
tacgaaaact tcaagaagga acaagaagct caagcttaa 1779
<210>9
<211>62
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>9
tgcttacgaa aacttcaaga gttttagagc tagaaatagc aagttaaaat aaggctagtc 60
cg 62
<210>10
<211>50
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>10
gctctaaaac tcttgaagtt ttcgtaagca aaagtcccat tcgccacccg 50
<210>11
<211>55
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>11
gagctcggta cccggggatc ctctagagat ccggtaagcc attgtacgtt gccat 55
<210>12
<211>55
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>12
gccaagcttg catgcctgca ggtcgacgat cagtataccg tccatgttga tgact 55
<210>13
<211>20
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>13
atcgtcgacc tgcaggcatg 20
<210>14
<211>20
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>14
atctctagag gatccccggg 20
<210>15
<211>63
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>15
gatgcattga tggatgccga agatgattaa acttgatttt ttgaccttga tcttcatctt 60
gtc 63
<210>16
<211>100
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>16
cttgaacttc atcttgagtt gaacctccac ctccagatcc acctccacca gcttgagctt 60
cttgttcttt tttaaaattc tcgtaagcag ctaaggcttc 100
<210>17
<211>93
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>17
gtggaggttc aactcaagat gaagttcaag gtccacatgc tggtaagtct actgttggtg 60
gaggtggatc tggcgaacct acatccgatc agc 93
<210>18
<211>27
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>18
ttaatcatct tcggcatcca tcaatgc 27
<210>19
<211>17
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>19
gtaaaacgac ggccagt 17
<210>20
<211>17
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>20
caggaaacag ctatgac 17
<210>21
<211>25
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>21
tctccagaag aagctaccaa ggcta 25
<210>22
<211>25
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>22
ttctcttcga cagccttctt agcag 25
<210>23
<211>20
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>23
agagttcgac aatttgtact 20
<210>24
<211>20
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>24
cgtcgtggcc gtagtaatcg 20
<210>25
<211>60
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>25
agagttcgac aatttgtact gttttagagc tagaaatagc aagttaaaat aaggctagtc 60
<210>26
<211>50
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>26
gctctaaaac agtacaaatt gtcgaactct aaagtcccat tcgccacccg 50
<210>27
<211>60
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>27
cgtcgtggcc gtagtaatcg gttttagagc tagaaatagc aagttaaaat aaggctagtc 60
<210>28
<211>50
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>28
gctctaaaac cgattactac ggccacgacg aaagtcccat tcgccacccg 50
<210>29
<211>30
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>29
taggtctaga gatctgttta gcttgcctcg 30
<210>30
<211>27
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>30
tatccactag acagaagttt gcgttcc 27
<210>31
<211>80
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>31
tatggaacgc aaacttctgt ctagtggata gtatatgtgt tatgtagtat actctttctt 60
caacaattaa atactctcgg 80
<210>32
<211>57
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>32
cgaggcaagc taaacagatc tctagaccta tatccactag acagaagttt gcgttcc 57
<210>33
<211>28
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>33
atgaacacga ttaacatcgc taagaacg 28
<210>34
<211>20
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>34
ttacgcgaac gcgaagtccg 20
<210>35
<211>52
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>35
atcttagagt cggacttcgc gttcgcgtaa gaagatgctt ctgctcatca tc 52
<210>36
<211>56
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>36
agtcgttctt agcgatgtta atcgtgttca tggtaattgg acaaataaat acgtgt 56
<210>37
<211>43
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>37
gtacccgggg atcctctaga gatccagttg cagagcctcc gaa 43
<210>38
<211>45
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>38
catgcctgca ggtcgacgat gcgaaacctt agctctttat cgaac 45
<210>39
<211>104
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>39
atgttggttt gaatggacta ttaacagtaa atattatatc acttcgtgtt caattaatta 60
cggtttgtgg cttaactaaa aagtcgaaca agaagcaggc aaag 104
<210>40
<211>84
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>40
gaagtgatat aatatttact gttaatagtc cattcaaacc aacatttatt ttagttaagc 60
cacaaaccgt aattaattga acac 84
<210>41
<211>59
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>41
gtgttcaatt aattacggtt tgtggcttaa ctaaaaagtc gaacaagaag caggcaaag 59
<210>42
<211>67
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>42
gaagtgatat aatatttact gttaatagtc cattcaaacc aacatcttcg agcgtcccaa 60
aaccttc 67
<210>43
<211>45
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>43
atgttggttt gaatggacta ttaacagtaa atattatatc acttc 45
<210>44
<211>36
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>44
ttttagttaa gccacaaacc gtaattaatt gaacac 36
<210>45
<211>22
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>45
tttgctggtt gcccgtattc cc 22
<210>46
<211>23
<212>DNA
<213> Artificial sequence (artificial sequence)
<400>46
taatagcaca gggaatgcac ctt 23
Claims (15)
1. A genetically engineered strain for in vitro cell-free protein synthesis, wherein a genome of said genetically engineered strain incorporates a first exogenous gene expression cassette expressing a first nucleic acid construct of a first fusion protein; the first fusion protein has the structure of formula Ia or formula Ib:
S-A-B-C (Ia)
S-C-B-A (Ib);
in the formula (I), the compound is shown in the specification,
a is a PabI element;
b is nothing or a connecting peptide;
c is an eIF4G element;
s is an optional signal peptide, with or without a signal peptide in the first fusion protein;
wherein each "-" is a peptide bond;
the genetic engineering strain is Kluyveromyces lactis, and the expression or the activity of KlEXN53 gene is reduced in the genetic engineering strain; the amino acid sequence of the KlEXN53 nuclease expressed by the KlEXN53 gene is SEQ ID NO. 6;
wherein A and C satisfy at least one of the following conditions: (1) said a is derived from a yeast cell; (2) the C is derived from a yeast cell.
2. The genetically engineered strain of claim 1, wherein a and C satisfy at least one of the following conditions: (1) the A is derived from a Kluyveromyces lactis cell; (2) the C is derived from a Kluyveromyces lactis cell.
3. The genetically engineered strain of claim 1, wherein the first fusion protein contains or does not contain an initial Met.
4. The genetically engineered strain of claim 1, wherein a is a wild-type or mutant PabI sequence;
preferably, A is an amino acid sequence shown in SEQ ID NO.1 or an active fragment thereof;
more preferably, the nucleotide sequence of the Pab1 element is SEQ ID NO. 8.
5. The genetically engineered strain of claim 1 or 4, wherein C is a wild-type or mutant eIF4G sequence;
with or without the starting Met;
preferably, the C is an amino acid sequence shown in SEQ ID NO.2 or an active fragment thereof;
more preferably, the nucleotide sequence of the eIF4G element is SEQ ID No. 7.
6. The genetically engineered strain of claim 1, wherein B is 0-50 amino acids in length;
preferably, said B is 10-40 amino acids in length; more preferably, the amino acid sequence of B is Gly GlyGly Gly Ser Gly Gly Gly Gly Ser Thr Gln Asp Glu Val Gln Gly Pro His Ala GlyLys Ser Thr Val Gly Gly Gly Gly Ser;
in another preferred embodiment, said B is 15-25 amino acids in length.
7. The genetically engineered strain of claim 1, wherein the amino acid sequence of the first fusion protein is SEQ ID No. 3.
8. The genetically engineered strain of any one of claims 1 to 7, further comprising integrated into its genome a second exogenous gene expression cassette of a second nucleic acid construct having a structure of formula II from 5 'to 3':
Z1-Z2 (II)
in the formula (I), the compound is shown in the specification,
z1 and Z2 are elements for constituting the construct respectively;
each "-" is independently a bond or a nucleotide linking sequence;
z1 is a promoter element which is ScRNR 2;
z2 is the coding sequence of T7RNA polymerase;
preferably, the KlEXN53 gene in the genetically engineered strain is knocked out and the second nucleic acid construct is integrated at the knocked out KlEXN53 gene position;
more preferably, the nucleotide sequence shown in SEQ ID NO.5 in the genetically engineered strain is knocked out, and the second nucleic acid construct is integrated at the knocked-out KlEXN53 gene position.
9. The genetically engineered strain of claim 8, wherein the nucleotide sequence of the second nucleic acid construct is SEQ ID No. 4.
10. The genetically engineered strain of claim 1, wherein "reducing" means reducing the expression or activity of the KlEXN53 gene satisfies the following condition:
the ratio of A1 to A0 is less than or equal to 30 percent;
wherein, A1 is the expression or activity of KlEXN53 gene in the genetic engineering strain; a0 is the expression or activity of KlexN53 gene in wild type strain;
preferably, the "reduction" means that the reduction of the expression or activity of the KlEXN53 gene satisfies the following condition: the ratio of A1 to A0 is less than or equal to 10 percent;
more preferably, the "reduction" means that the reduction of the expression or activity of the KlEXN53 gene satisfies the following condition: the ratio of A1 to A0 is less than or equal to 5 percent;
more preferably, the "reduction" means that the reduction of the expression or activity of the KlEXN53 gene satisfies the following condition: the ratio of A1 to A0 is less than or equal to 2 percent;
more preferably, the "reduction" means that the reduction of the expression or activity of the KlEXN53 gene satisfies the following condition: the ratio A1/A0 is selected from 0-2%.
11. A genetically engineered strain for in vitro cell-free protein synthesis, wherein a genome of said genetically engineered strain incorporates a first exogenous gene expression cassette expressing a first nucleic acid construct of a first fusion protein; the first fusion protein has the structure of formula Ia or formula Ib:
S-A-B-C (Ia)
S-C-B-A (Ib);
in the formula (I), the compound is shown in the specification,
a is a PabI element;
b is nothing or a connecting peptide;
c is an eIF4G element;
s is an optional signal peptide, wherein each "-" is a peptide bond;
the genetic engineering strain is Kluyveromyces lactis, and the expression or the activity of KlEXN53 gene is reduced in the genetic engineering strain; the nucleotide sequence of the KlEXN53 gene is SEQ ID NO. 5;
a is an amino acid sequence shown in SEQ ID NO.1 or an active fragment thereof,
c is an amino acid sequence shown in SEQ ID NO.2 or an active fragment thereof;
preferably, said B is 0 to 50 amino acids in length; more preferably, said B is 10-40 amino acids in length; more preferably, the amino acid sequence of B is Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Thr Gln AspGlu Val Gln Gly Pro His Ala Gly Lys Ser Thr Val Gly Gly Gly Gly Ser;
in another preferred embodiment, said B is 15-25 amino acids in length.
More preferably, the first fusion protein is a polypeptide which has homology of more than or equal to 80% (preferably one, more than or equal to 90% homology; more preferably one, more than or equal to 95% homology; more preferably one, more than or equal to 97% homology; more preferably one, more than 98% homology; more than or equal to 99% homology) with the amino acid sequence shown in SEQ ID NO.3, and the polypeptide has the function or activity of improving the expression efficiency of the foreign protein;
preferably, the genome of the genetically engineered strain further integrates into it a second exogenous gene expression cassette of a second nucleic acid construct having a structure of formula II from 5 'to 3':
Z1-Z2 (II)
in the formula (I), the compound is shown in the specification,
z1 and Z2 are elements for constituting the construct respectively;
each "-" is independently a bond or a nucleotide linking sequence;
z1 is a promoter element which is ScRNR 2;
z2 is the coding sequence of T7RNA polymerase;
preferably, the nucleotide sequence of the second nucleic acid construct is SEQ ID No. 4;
in another preferred embodiment, the KlEXN53 gene in the genetically engineered strain is knocked out, and the second nucleic acid construct is integrated at the knocked-out KlEXN53 gene position.
12. Use of the genetically engineered strain of any one of claims 1 to 11 for increasing the efficiency of protein synthesis in vitro.
13. A cell-free cell extract derived from the genetically engineered strain of any one of claims 1 to 11.
14. An in vitro cell-free protein synthesis system, wherein the in vitro cell-free protein synthesis system comprises the cell extract of claim 13;
preferably, the in vitro cell-free protein synthesis system further comprises one or more components selected from the group consisting of:
(b) polyethylene glycol;
(c) optionally exogenous sucrose; and
(d) optionally a solvent which is water or an aqueous solvent;
preferably, the in vitro cell-free protein synthesis system further comprises one or more components selected from the group consisting of:
(e1) a substrate for RNA synthesis;
(e2) a substrate for synthesizing a protein;
(e3) magnesium ions;
(e4) potassium ions;
(e5) a buffering agent;
(e6) an RNA polymerase; and
(e7) an energy regeneration system; more preferably, the energy regeneration system is a phosphocreatine/phosphocreatine system;
in another preferred aspect, the in vitro cell-free protein synthesis system further comprises one or more components selected from the group consisting of:
(e8) heme; and
(e9) spermidine.
15. A method for synthesizing a protein in vitro, comprising the steps of:
(i) providing the in vitro cell-free protein synthesis system of claim 14 and adding an exogenous DNA molecule for directing protein synthesis;
(ii) (ii) incubating the in vitro cell-free protein synthesis system of step (i) under suitable conditions for a period of time T1, thereby synthesizing a protein encoded by the exogenous DNA;
preferably, the method for in vitro synthesis of a protein further comprises: (iii) optionally isolating or detecting said protein encoded by the exogenous DNA from said in vitro cell-free protein synthesis system.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202010673244.1A CN111778169B (en) | 2018-01-31 | 2018-01-31 | Method for improving in vitro protein synthesis efficiency |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202010673244.1A CN111778169B (en) | 2018-01-31 | 2018-01-31 | Method for improving in vitro protein synthesis efficiency |
CN201810093624.0A CN110093284B (en) | 2018-01-31 | 2018-01-31 | Method for improving protein synthesis efficiency in cell |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810093624.0A Division CN110093284B (en) | 2018-01-31 | 2018-01-31 | Method for improving protein synthesis efficiency in cell |
Publications (2)
Publication Number | Publication Date |
---|---|
CN111778169A true CN111778169A (en) | 2020-10-16 |
CN111778169B CN111778169B (en) | 2023-02-10 |
Family
ID=67441924
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810093624.0A Active CN110093284B (en) | 2018-01-31 | 2018-01-31 | Method for improving protein synthesis efficiency in cell |
CN202010673244.1A Active CN111778169B (en) | 2018-01-31 | 2018-01-31 | Method for improving in vitro protein synthesis efficiency |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810093624.0A Active CN110093284B (en) | 2018-01-31 | 2018-01-31 | Method for improving protein synthesis efficiency in cell |
Country Status (1)
Country | Link |
---|---|
CN (2) | CN110093284B (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110093284B (en) * | 2018-01-31 | 2020-08-18 | 康码(上海)生物科技有限公司 | Method for improving protein synthesis efficiency in cell |
CN111484998B (en) | 2019-05-30 | 2023-04-21 | 康码(上海)生物科技有限公司 | Method for in vitro quantitative co-expression of multiple proteins and application thereof |
CN112111042B (en) | 2019-06-21 | 2024-04-05 | 康码(上海)生物科技有限公司 | Biological magnetic microsphere and preparation method and application method thereof |
EP4066931A4 (en) | 2019-11-30 | 2024-02-14 | Kangma Healthcode Shanghai Biotech Co Ltd | Biomagnetic microsphere and preparation method therefor and use thereof |
CN115109792A (en) * | 2022-06-22 | 2022-09-27 | 清华大学 | Cell-free reaction system based on escherichia coli and application thereof |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999061605A2 (en) * | 1998-05-26 | 1999-12-02 | University Of Medicine And Dentistry Of New Jersey | System for reproducing and modulating stability and turnover of rna molecules |
WO2009097133A2 (en) * | 2008-01-30 | 2009-08-06 | Monsanto Technology, Llc | Transgenic plants with enhanced agronomic traits |
CN102459613A (en) * | 2009-04-29 | 2012-05-16 | 巴斯夫植物科学有限公司 | Plants having enhanced yield-related traits and a method for making the same |
CN103068987A (en) * | 2010-08-13 | 2013-04-24 | 库瑞瓦格有限责任公司 | Nucleic acid comprising or coding for a histone stem-loop and a poly(a) sequence or a polyadenylation signal for increasing the expression of an encoded protein |
CN108949801A (en) * | 2017-11-24 | 2018-12-07 | 康码(上海)生物科技有限公司 | A method of by knocking out nucleic acid enzyme system to regulate and control external biological synthesizing activity |
CN110093284A (en) * | 2018-01-31 | 2019-08-06 | 康码(上海)生物科技有限公司 | A method of improving albumen combined coefficient in cell |
CN110845622A (en) * | 2018-08-21 | 2020-02-28 | 康码(上海)生物科技有限公司 | Preparation of fusion protein with deletion of different structural domains and application of fusion protein in improvement of protein synthesis |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN103060334B (en) * | 2013-01-28 | 2014-05-07 | 西南大学 | Silkworm PABP (polyadenylic acid bonding protein) bonding protein interacting factor gene BmPaip1 as well as recombinant expression vector and application thereof |
CN106978349B (en) * | 2016-09-30 | 2018-06-22 | 康码(上海)生物科技有限公司 | A kind of kit of protein synthesis in vitro and preparation method thereof |
CN106701607B (en) * | 2017-01-11 | 2020-05-08 | 浙江科技学院 | Method for realizing high-accuracy fixed-point gene knockout in saccharomycetes |
-
2018
- 2018-01-31 CN CN201810093624.0A patent/CN110093284B/en active Active
- 2018-01-31 CN CN202010673244.1A patent/CN111778169B/en active Active
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999061605A2 (en) * | 1998-05-26 | 1999-12-02 | University Of Medicine And Dentistry Of New Jersey | System for reproducing and modulating stability and turnover of rna molecules |
WO2009097133A2 (en) * | 2008-01-30 | 2009-08-06 | Monsanto Technology, Llc | Transgenic plants with enhanced agronomic traits |
CN102459613A (en) * | 2009-04-29 | 2012-05-16 | 巴斯夫植物科学有限公司 | Plants having enhanced yield-related traits and a method for making the same |
CN103068987A (en) * | 2010-08-13 | 2013-04-24 | 库瑞瓦格有限责任公司 | Nucleic acid comprising or coding for a histone stem-loop and a poly(a) sequence or a polyadenylation signal for increasing the expression of an encoded protein |
CN108949801A (en) * | 2017-11-24 | 2018-12-07 | 康码(上海)生物科技有限公司 | A method of by knocking out nucleic acid enzyme system to regulate and control external biological synthesizing activity |
CN110093284A (en) * | 2018-01-31 | 2019-08-06 | 康码(上海)生物科技有限公司 | A method of improving albumen combined coefficient in cell |
CN110845622A (en) * | 2018-08-21 | 2020-02-28 | 康码(上海)生物科技有限公司 | Preparation of fusion protein with deletion of different structural domains and application of fusion protein in improvement of protein synthesis |
Non-Patent Citations (9)
Title |
---|
DUJON,B.等: "uncharacterized protein KLLA0_A04730g [Kluyveromyces lactis]", 《GENBANK DATABASE》 * |
DUJON,B.等: "uncharacterized protein KLLA0_C17600g [Kluyveromyces lactis]", 《GENBANK DATABASE》 * |
DUJON,B.等: "uncharacterized protein KLLA0_F22385g [Kluyveromyces lactis]", 《GENBANK DATABASE》 * |
JUSTIN T BROWN等: "Inhibition of mRNA turnover in yeast by an xrn1 mutation enhances the requirement for eIF4E binding to eIF4G and for proper capping of transcripts by Ceg1p", 《GENETICS》 * |
ORTIZ-MERINO,R.A.等: "Xrn1[Kluyveromyces lactis]", 《GENBANK DATABASE》 * |
YUICHI KIMURA等: "Pbp1 Is Involved in Ccr4- and Khd1-Mediated Regulation of Cell Growth through Association with Ribosomal Proteins Rpl12a and Rpl12b", 《EUKARYOTIC CELL》 * |
刘黎明等: "真核生物mRNA降解途径", 《中国生物化学与分子生物学报》 * |
杨晓雪: "酿酒酵母中应激颗粒形成的相关基因及作用规律", 《中国博士学位论文全文数据库(电子期刊)基础科学辑》 * |
陈绍华: "无细胞蛋白质合成体系提高活力的方法", 《产业科技创新》 * |
Also Published As
Publication number | Publication date |
---|---|
CN111778169B (en) | 2023-02-10 |
CN110093284A (en) | 2019-08-06 |
CN110093284B (en) | 2020-08-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111778169B (en) | Method for improving in vitro protein synthesis efficiency | |
JP7246100B2 (en) | Preparation of Novel Fusion Proteins and Their Use in Improving Protein Synthesis | |
KR102345759B1 (en) | Methods for modulating biosynthetic activity in vitro by knock-out of nuclease systems | |
CN110408635B (en) | Application of nucleic acid construct containing streptavidin element in protein expression and purification | |
CN109423496B (en) | Nucleic acid construct for endogenously expressing RNA polymerase in cells | |
CN110408636B (en) | DNA sequence with multiple labels connected in series and application thereof in protein expression and purification system | |
WO2018161374A1 (en) | Protein synthesis system for protein synthesis in vitro, kit and preparation method thereof | |
CN110845622B (en) | Preparation of fusion protein with deletion of different structural domains and application of fusion protein in improvement of protein synthesis | |
CN113481226B (en) | Signal peptide related sequence and application thereof in protein synthesis | |
CN110938649A (en) | Protein synthesis system for improving expression quantity of foreign protein and application method thereof | |
CN110551745A (en) | Multiple histidine sequence tag and application thereof in protein expression and purification | |
WO2019100431A1 (en) | Tandem dna element capable of enhancing protein synthesis efficiency | |
CN112342248A (en) | Method for changing in vitro protein synthesis capacity through gene knockout and application thereof | |
WO2024051855A1 (en) | Nucleic acid construct and use thereof in ivtt system | |
CN111118065A (en) | Gene modification method of eukaryote, corresponding gene engineering cell and application thereof | |
US7198932B1 (en) | Gdp-4-keto-6-deoxy-d-mannose-3,5-epimerase-4-reductase gene derived from arabidopsis thaliana | |
CN111378706A (en) | Method for changing in vitro protein synthesis capacity through Edc3 gene knockout and application thereof | |
CN114317575A (en) | Method for improving in vitro synthesis efficiency of protein |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant | ||
PE01 | Entry into force of the registration of the contract for pledge of patent right |
Denomination of invention: A method to improve the efficiency of in vitro protein synthesis Granted publication date: 20230210 Pledgee: China Construction Bank Corporation Shanghai Fengxian Branch Pledgor: KANGMA-HEATHCODE (SHANGHAI) BIOTECH Co.,Ltd. Registration number: Y2024980016719 |