CN110857449B - Improved method for producing polyhydroxyalkanoate - Google Patents
Improved method for producing polyhydroxyalkanoate Download PDFInfo
- Publication number
- CN110857449B CN110857449B CN201810971946.0A CN201810971946A CN110857449B CN 110857449 B CN110857449 B CN 110857449B CN 201810971946 A CN201810971946 A CN 201810971946A CN 110857449 B CN110857449 B CN 110857449B
- Authority
- CN
- China
- Prior art keywords
- halomonas
- acetic acid
- microorganism
- acetate
- pha
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 239000005014 poly(hydroxyalkanoate) Substances 0.000 title claims abstract description 60
- 229920000903 polyhydroxyalkanoate Polymers 0.000 title claims abstract description 54
- 238000004519 manufacturing process Methods 0.000 title claims abstract description 29
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 claims abstract description 311
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims abstract description 55
- 229910052799 carbon Inorganic materials 0.000 claims abstract description 55
- 238000000034 method Methods 0.000 claims abstract description 54
- 230000015572 biosynthetic process Effects 0.000 claims abstract description 35
- 238000003786 synthesis reaction Methods 0.000 claims abstract description 35
- 239000007640 basal medium Substances 0.000 claims abstract description 26
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 claims abstract description 22
- 230000000813 microbial effect Effects 0.000 claims abstract description 17
- 241000206596 Halomonas Species 0.000 claims description 105
- 244000005700 microbiome Species 0.000 claims description 81
- 229920000070 poly-3-hydroxybutyrate Polymers 0.000 claims description 54
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 claims description 45
- 239000008103 glucose Substances 0.000 claims description 45
- 229920001577 copolymer Polymers 0.000 claims description 37
- 241000894006 Bacteria Species 0.000 claims description 30
- 229920000520 poly(3-hydroxybutyrate-co-3-hydroxyvalerate) Polymers 0.000 claims description 27
- 229920001013 poly(3-hydroxybutyrate-co-4-hydroxybutyrate) Polymers 0.000 claims description 26
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 claims description 14
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 claims description 13
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 claims description 12
- 229940050410 gluconate Drugs 0.000 claims description 11
- 229920001519 homopolymer Polymers 0.000 claims description 11
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 claims description 7
- 239000000174 gluconic acid Substances 0.000 claims description 7
- 235000012208 gluconic acid Nutrition 0.000 claims description 7
- 230000000415 inactivating effect Effects 0.000 claims description 2
- 125000002791 glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 claims 2
- 239000000178 monomer Substances 0.000 abstract description 46
- 229920000642 polymer Polymers 0.000 abstract description 34
- 150000001242 acetic acid derivatives Chemical class 0.000 abstract description 20
- 159000000021 acetate salts Chemical class 0.000 abstract description 17
- 210000004027 cell Anatomy 0.000 description 54
- 239000002609 medium Substances 0.000 description 47
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 36
- REKYPYSUBKSCAT-UHFFFAOYSA-N 3-hydroxypentanoic acid Chemical compound CCC(O)CC(O)=O REKYPYSUBKSCAT-UHFFFAOYSA-N 0.000 description 34
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 25
- ZSLZBFCDCINBPY-ZSJPKINUSA-N acetyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 ZSLZBFCDCINBPY-ZSJPKINUSA-N 0.000 description 25
- 239000001963 growth medium Substances 0.000 description 24
- 239000013612 plasmid Substances 0.000 description 23
- WHBMMWSBFZVSSR-UHFFFAOYSA-N 3-hydroxybutyric acid Chemical compound CC(O)CC(O)=O WHBMMWSBFZVSSR-UHFFFAOYSA-N 0.000 description 22
- -1 acetate ester Chemical class 0.000 description 21
- 241000588724 Escherichia coli Species 0.000 description 20
- 108090000623 proteins and genes Proteins 0.000 description 19
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 19
- 108020004414 DNA Proteins 0.000 description 18
- 230000000694 effects Effects 0.000 description 18
- 239000011780 sodium chloride Substances 0.000 description 18
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 17
- 238000012258 culturing Methods 0.000 description 17
- 238000002474 experimental method Methods 0.000 description 17
- 238000000855 fermentation Methods 0.000 description 15
- 230000004151 fermentation Effects 0.000 description 14
- 230000008569 process Effects 0.000 description 13
- 230000005764 inhibitory process Effects 0.000 description 12
- 229940076788 pyruvate Drugs 0.000 description 12
- 229940107700 pyruvic acid Drugs 0.000 description 12
- 230000002194 synthesizing effect Effects 0.000 description 12
- 238000009825 accumulation Methods 0.000 description 11
- 230000032050 esterification Effects 0.000 description 11
- 238000005886 esterification reaction Methods 0.000 description 11
- 239000000203 mixture Substances 0.000 description 11
- 230000012010 growth Effects 0.000 description 10
- 239000000463 material Substances 0.000 description 9
- UQGPCEVQKLOLLM-UHFFFAOYSA-N pentaneperoxoic acid Chemical compound CCCCC(=O)OO UQGPCEVQKLOLLM-UHFFFAOYSA-N 0.000 description 9
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 8
- 241000589776 Pseudomonas putida Species 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- SJZRECIVHVDYJC-UHFFFAOYSA-M 4-hydroxybutyrate Chemical compound OCCCC([O-])=O SJZRECIVHVDYJC-UHFFFAOYSA-M 0.000 description 7
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 7
- 229920000331 Polyhydroxybutyrate Polymers 0.000 description 7
- 239000012153 distilled water Substances 0.000 description 7
- 238000004817 gas chromatography Methods 0.000 description 7
- 230000002503 metabolic effect Effects 0.000 description 7
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 description 7
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 6
- 239000001888 Peptone Substances 0.000 description 6
- 108010080698 Peptones Proteins 0.000 description 6
- 229940100228 acetyl coenzyme a Drugs 0.000 description 6
- 230000002411 adverse Effects 0.000 description 6
- 229940041514 candida albicans extract Drugs 0.000 description 6
- 230000001276 controlling effect Effects 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 238000012269 metabolic engineering Methods 0.000 description 6
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 description 6
- 235000019319 peptone Nutrition 0.000 description 6
- 239000005015 poly(hydroxybutyrate) Substances 0.000 description 6
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- 239000012138 yeast extract Substances 0.000 description 6
- AEQDJSLRWYMAQI-UHFFFAOYSA-N 2,3,9,10-tetramethoxy-6,8,13,13a-tetrahydro-5H-isoquinolino[2,1-b]isoquinoline Chemical compound C1CN2CC(C(=C(OC)C=C3)OC)=C3CC2C2=C1C=C(OC)C(OC)=C2 AEQDJSLRWYMAQI-UHFFFAOYSA-N 0.000 description 5
- 108091033409 CRISPR Proteins 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 238000012408 PCR amplification Methods 0.000 description 5
- 241000589516 Pseudomonas Species 0.000 description 5
- 238000000137 annealing Methods 0.000 description 5
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 238000010276 construction Methods 0.000 description 5
- 239000001301 oxygen Substances 0.000 description 5
- 229910052760 oxygen Inorganic materials 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 239000000176 sodium gluconate Substances 0.000 description 5
- 235000012207 sodium gluconate Nutrition 0.000 description 5
- 229940005574 sodium gluconate Drugs 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 241000193830 Bacillus <bacterium> Species 0.000 description 4
- 241000588722 Escherichia Species 0.000 description 4
- 239000007836 KH2PO4 Substances 0.000 description 4
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 4
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- 238000001035 drying Methods 0.000 description 4
- 150000002168 ethanoic acid esters Chemical class 0.000 description 4
- 239000007789 gas Substances 0.000 description 4
- 238000010353 genetic engineering Methods 0.000 description 4
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 4
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 4
- 229920002791 poly-4-hydroxybutyrate Polymers 0.000 description 4
- 239000002243 precursor Substances 0.000 description 4
- 239000001632 sodium acetate Substances 0.000 description 4
- 235000017281 sodium acetate Nutrition 0.000 description 4
- 108010079426 Electron-Transferring Flavoproteins Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 229920001222 biopolymer Polymers 0.000 description 3
- VSGNNIFQASZAOI-UHFFFAOYSA-L calcium acetate Chemical compound [Ca+2].CC([O-])=O.CC([O-])=O VSGNNIFQASZAOI-UHFFFAOYSA-L 0.000 description 3
- 239000001639 calcium acetate Substances 0.000 description 3
- 235000011092 calcium acetate Nutrition 0.000 description 3
- 229960005147 calcium acetate Drugs 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 3
- 229910000397 disodium phosphate Inorganic materials 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 230000034659 glycolysis Effects 0.000 description 3
- 108010037850 glycylvaline Proteins 0.000 description 3
- XLYOFNOQVPJJNP-ZSJDYOACSA-N heavy water Substances [2H]O[2H] XLYOFNOQVPJJNP-ZSJDYOACSA-N 0.000 description 3
- 108010040030 histidinoalanine Proteins 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 238000009776 industrial production Methods 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- CSNNHWWHGAXBCP-UHFFFAOYSA-L magnesium sulphate Substances [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 3
- 230000037353 metabolic pathway Effects 0.000 description 3
- 230000004060 metabolic process Effects 0.000 description 3
- 239000007003 mineral medium Substances 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 238000005457 optimization Methods 0.000 description 3
- 101150048611 phaC gene Proteins 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 235000011056 potassium acetate Nutrition 0.000 description 3
- 238000012257 pre-denaturation Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 239000013638 trimer Substances 0.000 description 3
- ALRHLSYJTWAHJZ-UHFFFAOYSA-M 3-hydroxypropionate Chemical compound OCCC([O-])=O ALRHLSYJTWAHJZ-UHFFFAOYSA-M 0.000 description 2
- SJZRECIVHVDYJC-UHFFFAOYSA-N 4-hydroxybutyric acid Chemical compound OCCCC(O)=O SJZRECIVHVDYJC-UHFFFAOYSA-N 0.000 description 2
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 2
- NBTGEURICRTMGL-WHFBIAKZSA-N Ala-Gly-Ser Chemical compound C[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O NBTGEURICRTMGL-WHFBIAKZSA-N 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- 229910021580 Cobalt(II) chloride Inorganic materials 0.000 description 2
- 102000012737 Electron-Transferring Flavoproteins Human genes 0.000 description 2
- VTLYFUHAOXGGBS-UHFFFAOYSA-N Fe3+ Chemical compound [Fe+3] VTLYFUHAOXGGBS-UHFFFAOYSA-N 0.000 description 2
- 241001569204 Halomonas campaniensis Species 0.000 description 2
- CQQGCWPXDHTTNF-GUBZILKMSA-N Leu-Ala-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O CQQGCWPXDHTTNF-GUBZILKMSA-N 0.000 description 2
- XVZCXCTYGHPNEM-UHFFFAOYSA-N Leu-Leu-Pro Natural products CC(C)CC(N)C(=O)NC(CC(C)C)C(=O)N1CCCC1C(O)=O XVZCXCTYGHPNEM-UHFFFAOYSA-N 0.000 description 2
- 229910021380 Manganese Chloride Inorganic materials 0.000 description 2
- GLFNIEUTAYBVOC-UHFFFAOYSA-L Manganese chloride Chemical compound Cl[Mn]Cl GLFNIEUTAYBVOC-UHFFFAOYSA-L 0.000 description 2
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 2
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- 229910018890 NaMoO4 Inorganic materials 0.000 description 2
- 229910021586 Nickel(II) chloride Inorganic materials 0.000 description 2
- HLCFGWHYROZGBI-JJKGCWMISA-M Potassium gluconate Chemical compound [K+].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O HLCFGWHYROZGBI-JJKGCWMISA-M 0.000 description 2
- XROLYVMNVIKVEM-BQBZGAKWSA-N Pro-Asn-Gly Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O XROLYVMNVIKVEM-BQBZGAKWSA-N 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 2
- APQIVBCUIUDSMB-OSUNSFLBSA-N Val-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N APQIVBCUIUDSMB-OSUNSFLBSA-N 0.000 description 2
- KXKVLQRXCPHEJC-UHFFFAOYSA-N acetic acid trimethyl ester Natural products COC(C)=O KXKVLQRXCPHEJC-UHFFFAOYSA-N 0.000 description 2
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 2
- 150000001413 amino acids Chemical group 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 108010068380 arginylarginine Proteins 0.000 description 2
- 235000015278 beef Nutrition 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 239000004227 calcium gluconate Substances 0.000 description 2
- 235000013927 calcium gluconate Nutrition 0.000 description 2
- 229960004494 calcium gluconate Drugs 0.000 description 2
- NEEHYRZPVYRGPP-UHFFFAOYSA-L calcium;2,3,4,5,6-pentahydroxyhexanoate Chemical compound [Ca+2].OCC(O)C(O)C(O)C(O)C([O-])=O.OCC(O)C(O)C(O)C(O)C([O-])=O NEEHYRZPVYRGPP-UHFFFAOYSA-L 0.000 description 2
- 239000004202 carbamide Substances 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 229910052927 chalcanthite Inorganic materials 0.000 description 2
- 239000013043 chemical agent Substances 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229950006191 gluconic acid Drugs 0.000 description 2
- 229960001031 glucose Drugs 0.000 description 2
- 108010077515 glycylproline Proteins 0.000 description 2
- 230000005484 gravity Effects 0.000 description 2
- 239000002054 inoculum Substances 0.000 description 2
- 108010034529 leucyl-lysine Proteins 0.000 description 2
- 108010025153 lysyl-alanyl-alanine Proteins 0.000 description 2
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 2
- 239000011565 manganese chloride Substances 0.000 description 2
- YKYONYBAUNKHLG-UHFFFAOYSA-N n-Propyl acetate Natural products CCCOC(C)=O YKYONYBAUNKHLG-UHFFFAOYSA-N 0.000 description 2
- QMMRZOWCJAIUJA-UHFFFAOYSA-L nickel dichloride Chemical compound Cl[Ni]Cl QMMRZOWCJAIUJA-UHFFFAOYSA-L 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 238000012803 optimization experiment Methods 0.000 description 2
- 229920000218 poly(hydroxyvalerate) Polymers 0.000 description 2
- 239000004224 potassium gluconate Substances 0.000 description 2
- 235000013926 potassium gluconate Nutrition 0.000 description 2
- 229960003189 potassium gluconate Drugs 0.000 description 2
- 229940090181 propyl acetate Drugs 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000007789 sealing Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000012807 shake-flask culturing Methods 0.000 description 2
- 230000009469 supplementation Effects 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 235000013619 trace mineral Nutrition 0.000 description 2
- 239000011573 trace mineral Substances 0.000 description 2
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 2
- NWONKYPBYAMBJT-UHFFFAOYSA-L zinc sulfate Chemical compound [Zn+2].[O-]S([O-])(=O)=O NWONKYPBYAMBJT-UHFFFAOYSA-L 0.000 description 2
- 229910000368 zinc sulfate Inorganic materials 0.000 description 2
- 239000011686 zinc sulphate Substances 0.000 description 2
- XVZCXCTYGHPNEM-IHRRRGAJSA-N (2s)-1-[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]-4-methylpentanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(O)=O XVZCXCTYGHPNEM-IHRRRGAJSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229940006015 4-hydroxybutyric acid Drugs 0.000 description 1
- 101100536799 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) tgnE gene Proteins 0.000 description 1
- ZKHQWZAMYRWXGA-KQYNXXCUSA-N Adenosine triphosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-N 0.000 description 1
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- YLTKNGYYPIWKHZ-ACZMJKKPSA-N Ala-Ala-Glu Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O YLTKNGYYPIWKHZ-ACZMJKKPSA-N 0.000 description 1
- FJVAQLJNTSUQPY-CIUDSAMLSA-N Ala-Ala-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCCN FJVAQLJNTSUQPY-CIUDSAMLSA-N 0.000 description 1
- QDRGPQWIVZNJQD-CIUDSAMLSA-N Ala-Arg-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O QDRGPQWIVZNJQD-CIUDSAMLSA-N 0.000 description 1
- WXERCAHAIKMTKX-ZLUOBGJFSA-N Ala-Asp-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O WXERCAHAIKMTKX-ZLUOBGJFSA-N 0.000 description 1
- ZIWWTZWAKYBUOB-CIUDSAMLSA-N Ala-Asp-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O ZIWWTZWAKYBUOB-CIUDSAMLSA-N 0.000 description 1
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 1
- NWVVKQZOVSTDBQ-CIUDSAMLSA-N Ala-Glu-Arg Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O NWVVKQZOVSTDBQ-CIUDSAMLSA-N 0.000 description 1
- HXNNRBHASOSVPG-GUBZILKMSA-N Ala-Glu-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HXNNRBHASOSVPG-GUBZILKMSA-N 0.000 description 1
- FBHOPGDGELNWRH-DRZSPHRISA-N Ala-Glu-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O FBHOPGDGELNWRH-DRZSPHRISA-N 0.000 description 1
- LMFXXZPPZDCPTA-ZKWXMUAHSA-N Ala-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N LMFXXZPPZDCPTA-ZKWXMUAHSA-N 0.000 description 1
- IFKQPMZRDQZSHI-GHCJXIJMSA-N Ala-Ile-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O IFKQPMZRDQZSHI-GHCJXIJMSA-N 0.000 description 1
- DVJSJDDYCYSMFR-ZKWXMUAHSA-N Ala-Ile-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O DVJSJDDYCYSMFR-ZKWXMUAHSA-N 0.000 description 1
- MNZHHDPWDWQJCQ-YUMQZZPRSA-N Ala-Leu-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O MNZHHDPWDWQJCQ-YUMQZZPRSA-N 0.000 description 1
- MDNAVFBZPROEHO-UHFFFAOYSA-N Ala-Lys-Val Natural products CC(C)C(C(O)=O)NC(=O)C(NC(=O)C(C)N)CCCCN MDNAVFBZPROEHO-UHFFFAOYSA-N 0.000 description 1
- IPZQNYYAYVRKKK-FXQIFTODSA-N Ala-Pro-Ala Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IPZQNYYAYVRKKK-FXQIFTODSA-N 0.000 description 1
- VJVQKGYHIZPSNS-FXQIFTODSA-N Ala-Ser-Arg Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N VJVQKGYHIZPSNS-FXQIFTODSA-N 0.000 description 1
- DYXOFPBJBAHWFY-JBDRJPRFSA-N Ala-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)N DYXOFPBJBAHWFY-JBDRJPRFSA-N 0.000 description 1
- OEVCHROQUIVQFZ-YTLHQDLWSA-N Ala-Thr-Ala Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](C)C(O)=O OEVCHROQUIVQFZ-YTLHQDLWSA-N 0.000 description 1
- BVLPIIBTWIYOML-ZKWXMUAHSA-N Ala-Val-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BVLPIIBTWIYOML-ZKWXMUAHSA-N 0.000 description 1
- 244000153158 Ammi visnaga Species 0.000 description 1
- 235000010585 Ammi visnaga Nutrition 0.000 description 1
- UXJCMQFPDWCHKX-DCAQKATOSA-N Arg-Arg-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UXJCMQFPDWCHKX-DCAQKATOSA-N 0.000 description 1
- MFAMTAVAFBPXDC-LPEHRKFASA-N Arg-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O MFAMTAVAFBPXDC-LPEHRKFASA-N 0.000 description 1
- JTWOBPNAVBESFW-FXQIFTODSA-N Arg-Cys-Asp Chemical compound C(C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)CN=C(N)N JTWOBPNAVBESFW-FXQIFTODSA-N 0.000 description 1
- AQPVUEJJARLJHB-BQBZGAKWSA-N Arg-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCCN=C(N)N AQPVUEJJARLJHB-BQBZGAKWSA-N 0.000 description 1
- YKBHOXLMMPZPHQ-GMOBBJLQSA-N Arg-Ile-Asp Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O YKBHOXLMMPZPHQ-GMOBBJLQSA-N 0.000 description 1
- KZXPVYVSHUJCEO-ULQDDVLXSA-N Arg-Phe-Lys Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=CC=C1 KZXPVYVSHUJCEO-ULQDDVLXSA-N 0.000 description 1
- XFXZKCRBBOVJKS-BVSLBCMMSA-N Arg-Phe-Trp Chemical compound C([C@H](NC(=O)[C@H](CCCN=C(N)N)N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)C1=CC=CC=C1 XFXZKCRBBOVJKS-BVSLBCMMSA-N 0.000 description 1
- XRNXPIGJPQHCPC-RCWTZXSCSA-N Arg-Thr-Val Chemical compound CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)O)C(O)=O XRNXPIGJPQHCPC-RCWTZXSCSA-N 0.000 description 1
- KEZVOBAKAXHMOF-GUBZILKMSA-N Arg-Val-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCN=C(N)N KEZVOBAKAXHMOF-GUBZILKMSA-N 0.000 description 1
- GXMSVVBIAMWMKO-BQBZGAKWSA-N Asn-Arg-Gly Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CCCN=C(N)N GXMSVVBIAMWMKO-BQBZGAKWSA-N 0.000 description 1
- QXOPPIDJKPEKCW-GUBZILKMSA-N Asn-Pro-Arg Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC(=O)N)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O QXOPPIDJKPEKCW-GUBZILKMSA-N 0.000 description 1
- MKJBPDLENBUHQU-CIUDSAMLSA-N Asn-Ser-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O MKJBPDLENBUHQU-CIUDSAMLSA-N 0.000 description 1
- SOYOSFXLXYZNRG-CIUDSAMLSA-N Asp-Arg-Gln Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O SOYOSFXLXYZNRG-CIUDSAMLSA-N 0.000 description 1
- FAEIQWHBRBWUBN-FXQIFTODSA-N Asp-Arg-Ser Chemical compound C(C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC(=O)O)N)CN=C(N)N FAEIQWHBRBWUBN-FXQIFTODSA-N 0.000 description 1
- XYBJLTKSGFBLCS-QXEWZRGKSA-N Asp-Arg-Val Chemical compound NC(N)=NCCC[C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC(O)=O XYBJLTKSGFBLCS-QXEWZRGKSA-N 0.000 description 1
- WCFCYFDBMNFSPA-ACZMJKKPSA-N Asp-Asp-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCC(O)=O WCFCYFDBMNFSPA-ACZMJKKPSA-N 0.000 description 1
- VAWNQIGQPUOPQW-ACZMJKKPSA-N Asp-Glu-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O VAWNQIGQPUOPQW-ACZMJKKPSA-N 0.000 description 1
- KHGPWGKPYHPOIK-QWRGUYRKSA-N Asp-Gly-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O KHGPWGKPYHPOIK-QWRGUYRKSA-N 0.000 description 1
- CTWCFPWFIGRAEP-CIUDSAMLSA-N Asp-Lys-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O CTWCFPWFIGRAEP-CIUDSAMLSA-N 0.000 description 1
- ZBYLEBZCVKLPCY-FXQIFTODSA-N Asp-Ser-Arg Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O ZBYLEBZCVKLPCY-FXQIFTODSA-N 0.000 description 1
- BRRPVTUFESPTCP-ACZMJKKPSA-N Asp-Ser-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O BRRPVTUFESPTCP-ACZMJKKPSA-N 0.000 description 1
- HRVQDZOWMLFAOD-BIIVOSGPSA-N Asp-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)N)C(=O)O HRVQDZOWMLFAOD-BIIVOSGPSA-N 0.000 description 1
- YIDFBWRHIYOYAA-LKXGYXEUSA-N Asp-Ser-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O YIDFBWRHIYOYAA-LKXGYXEUSA-N 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- 239000002028 Biomass Substances 0.000 description 1
- 101000623895 Bos taurus Mucin-15 Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 241001135695 Cobetia marina Species 0.000 description 1
- 241000252867 Cupriavidus metallidurans Species 0.000 description 1
- NRVQLLDIJJEIIZ-VZFHVOOUSA-N Cys-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CS)N)O NRVQLLDIJJEIIZ-VZFHVOOUSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000186394 Eubacterium Species 0.000 description 1
- XOKGKOQWADCLFQ-GARJFASQSA-N Gln-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XOKGKOQWADCLFQ-GARJFASQSA-N 0.000 description 1
- GNMQDOGFWYWPNM-LAEOZQHASA-N Gln-Gly-Ile Chemical compound CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](N)CCC(N)=O)C(O)=O GNMQDOGFWYWPNM-LAEOZQHASA-N 0.000 description 1
- IWUFOVSLWADEJC-AVGNSLFASA-N Gln-His-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(O)=O IWUFOVSLWADEJC-AVGNSLFASA-N 0.000 description 1
- HXOLDXKNWKLDMM-YVNDNENWSA-N Gln-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N HXOLDXKNWKLDMM-YVNDNENWSA-N 0.000 description 1
- FTIJVMLAGRAYMJ-MNXVOIDGSA-N Gln-Ile-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCC(N)=O FTIJVMLAGRAYMJ-MNXVOIDGSA-N 0.000 description 1
- UWKPRVKWEKEMSY-DCAQKATOSA-N Gln-Lys-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O UWKPRVKWEKEMSY-DCAQKATOSA-N 0.000 description 1
- XZLLTYBONVKGLO-SDDRHHMPSA-N Gln-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XZLLTYBONVKGLO-SDDRHHMPSA-N 0.000 description 1
- IRDASPPCLZIERZ-XHNCKOQMSA-N Glu-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)O)N IRDASPPCLZIERZ-XHNCKOQMSA-N 0.000 description 1
- CKRUHITYRFNUKW-WDSKDSINSA-N Glu-Asn-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O CKRUHITYRFNUKW-WDSKDSINSA-N 0.000 description 1
- WATXSTJXNBOHKD-LAEOZQHASA-N Glu-Asp-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O WATXSTJXNBOHKD-LAEOZQHASA-N 0.000 description 1
- XHWLNISLUFEWNS-CIUDSAMLSA-N Glu-Gln-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O XHWLNISLUFEWNS-CIUDSAMLSA-N 0.000 description 1
- WLIPTFCZLHCNFD-LPEHRKFASA-N Glu-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)O)N)C(=O)O WLIPTFCZLHCNFD-LPEHRKFASA-N 0.000 description 1
- SJPMNHCEWPTRBR-BQBZGAKWSA-N Glu-Glu-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O SJPMNHCEWPTRBR-BQBZGAKWSA-N 0.000 description 1
- GUOWMVFLAJNPDY-CIUDSAMLSA-N Glu-Ser-Met Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(O)=O GUOWMVFLAJNPDY-CIUDSAMLSA-N 0.000 description 1
- DLISPGXMKZTWQG-IFFSRLJSSA-N Glu-Thr-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O DLISPGXMKZTWQG-IFFSRLJSSA-N 0.000 description 1
- ZTNHPMZHAILHRB-JSGCOSHPSA-N Glu-Trp-Gly Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)N)C(=O)NCC(O)=O)=CNC2=C1 ZTNHPMZHAILHRB-JSGCOSHPSA-N 0.000 description 1
- PUUYVMYCMIWHFE-BQBZGAKWSA-N Gly-Ala-Arg Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N PUUYVMYCMIWHFE-BQBZGAKWSA-N 0.000 description 1
- YMUFWNJHVPQNQD-ZKWXMUAHSA-N Gly-Ala-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN YMUFWNJHVPQNQD-ZKWXMUAHSA-N 0.000 description 1
- OVSKVOOUFAKODB-UWVGGRQHSA-N Gly-Arg-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N OVSKVOOUFAKODB-UWVGGRQHSA-N 0.000 description 1
- GZBZACMXFIPIDX-WHFBIAKZSA-N Gly-Cys-Asp Chemical compound C([C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CN)C(=O)O GZBZACMXFIPIDX-WHFBIAKZSA-N 0.000 description 1
- QPDUVFSVVAOUHE-XVKPBYJWSA-N Gly-Gln-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)CN)C(O)=O QPDUVFSVVAOUHE-XVKPBYJWSA-N 0.000 description 1
- XTQFHTHIAKKCTM-YFKPBYRVSA-N Gly-Glu-Gly Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O XTQFHTHIAKKCTM-YFKPBYRVSA-N 0.000 description 1
- YYPFZVIXAVDHIK-IUCAKERBSA-N Gly-Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CN YYPFZVIXAVDHIK-IUCAKERBSA-N 0.000 description 1
- CCQOOWAONKGYKQ-BYPYZUCNSA-N Gly-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)CN CCQOOWAONKGYKQ-BYPYZUCNSA-N 0.000 description 1
- KMSGYZQRXPUKGI-BYPYZUCNSA-N Gly-Gly-Asn Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(N)=O KMSGYZQRXPUKGI-BYPYZUCNSA-N 0.000 description 1
- PDAWDNVHMUKWJR-ZETCQYMHSA-N Gly-Gly-His Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC1=CNC=N1 PDAWDNVHMUKWJR-ZETCQYMHSA-N 0.000 description 1
- UTYGDAHJBBDPBA-BYULHYEWSA-N Gly-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)CN UTYGDAHJBBDPBA-BYULHYEWSA-N 0.000 description 1
- HAXARWKYFIIHKD-ZKWXMUAHSA-N Gly-Ile-Ser Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O HAXARWKYFIIHKD-ZKWXMUAHSA-N 0.000 description 1
- TWTPDFFBLQEBOE-IUCAKERBSA-N Gly-Leu-Gln Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O TWTPDFFBLQEBOE-IUCAKERBSA-N 0.000 description 1
- UHPAZODVFFYEEL-QWRGUYRKSA-N Gly-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CN UHPAZODVFFYEEL-QWRGUYRKSA-N 0.000 description 1
- PDUHNKAFQXQNLH-ZETCQYMHSA-N Gly-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)NCC(O)=O PDUHNKAFQXQNLH-ZETCQYMHSA-N 0.000 description 1
- GWCJMBNBFYBQCV-XPUUQOCRSA-N Gly-Val-Ala Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O GWCJMBNBFYBQCV-XPUUQOCRSA-N 0.000 description 1
- RYAOJUMWLWUGNW-QMMMGPOBSA-N Gly-Val-Gly Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O RYAOJUMWLWUGNW-QMMMGPOBSA-N 0.000 description 1
- COZMNNJEGNPDED-HOCLYGCPSA-N Gly-Val-Trp Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O COZMNNJEGNPDED-HOCLYGCPSA-N 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- 241000856427 Halomonas sp. TD01 Species 0.000 description 1
- AIPUZFXMXAHZKY-QWRGUYRKSA-N His-Leu-Gly Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O AIPUZFXMXAHZKY-QWRGUYRKSA-N 0.000 description 1
- LVWIJITYHRZHBO-IXOXFDKPSA-N His-Leu-Thr Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LVWIJITYHRZHBO-IXOXFDKPSA-N 0.000 description 1
- XKIYNCLILDLGRS-QWRGUYRKSA-N His-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 XKIYNCLILDLGRS-QWRGUYRKSA-N 0.000 description 1
- OWYIDJCNRWRSJY-QTKMDUPCSA-N His-Pro-Thr Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O OWYIDJCNRWRSJY-QTKMDUPCSA-N 0.000 description 1
- JDAWAWXGAUZPNJ-ZPFDUUQYSA-N Ile-Glu-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N JDAWAWXGAUZPNJ-ZPFDUUQYSA-N 0.000 description 1
- NHJKZMDIMMTVCK-QXEWZRGKSA-N Ile-Gly-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N NHJKZMDIMMTVCK-QXEWZRGKSA-N 0.000 description 1
- KYLIZSDYWQQTFM-PEDHHIEDSA-N Ile-Ile-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CCCN=C(N)N KYLIZSDYWQQTFM-PEDHHIEDSA-N 0.000 description 1
- GVKKVHNRTUFCCE-BJDJZHNGSA-N Ile-Leu-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)O)N GVKKVHNRTUFCCE-BJDJZHNGSA-N 0.000 description 1
- KTNGVMMGIQWIDV-OSUNSFLBSA-N Ile-Pro-Thr Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O KTNGVMMGIQWIDV-OSUNSFLBSA-N 0.000 description 1
- HXIDVIFHRYRXLZ-NAKRPEOUSA-N Ile-Ser-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)O)N HXIDVIFHRYRXLZ-NAKRPEOUSA-N 0.000 description 1
- ZUWSVOYKBCHLRR-MGHWNKPDSA-N Ile-Tyr-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCCN)C(=O)O)N ZUWSVOYKBCHLRR-MGHWNKPDSA-N 0.000 description 1
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 1
- SENJXOPIZNYLHU-UHFFFAOYSA-N L-leucyl-L-arginine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CCCN=C(N)N SENJXOPIZNYLHU-UHFFFAOYSA-N 0.000 description 1
- LJHGALIOHLRRQN-DCAQKATOSA-N Leu-Ala-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N LJHGALIOHLRRQN-DCAQKATOSA-N 0.000 description 1
- MJOZZTKJZQFKDK-GUBZILKMSA-N Leu-Ala-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(N)=O MJOZZTKJZQFKDK-GUBZILKMSA-N 0.000 description 1
- KTFHTMHHKXUYPW-ZPFDUUQYSA-N Leu-Asp-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KTFHTMHHKXUYPW-ZPFDUUQYSA-N 0.000 description 1
- MMEDVBWCMGRKKC-GARJFASQSA-N Leu-Asp-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N MMEDVBWCMGRKKC-GARJFASQSA-N 0.000 description 1
- KAFOIVJDVSZUMD-UHFFFAOYSA-N Leu-Gln-Gln Natural products CC(C)CC(N)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(O)=O KAFOIVJDVSZUMD-UHFFFAOYSA-N 0.000 description 1
- VWHGTYCRDRBSFI-ZETCQYMHSA-N Leu-Gly-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(O)=O VWHGTYCRDRBSFI-ZETCQYMHSA-N 0.000 description 1
- JRJLGNFWYFSJHB-HOCLYGCPSA-N Leu-Gly-Trp Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O JRJLGNFWYFSJHB-HOCLYGCPSA-N 0.000 description 1
- QJXHMYMRGDOHRU-NHCYSSNCSA-N Leu-Ile-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O QJXHMYMRGDOHRU-NHCYSSNCSA-N 0.000 description 1
- YOKVEHGYYQEQOP-QWRGUYRKSA-N Leu-Leu-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O YOKVEHGYYQEQOP-QWRGUYRKSA-N 0.000 description 1
- HVHRPWQEQHIQJF-AVGNSLFASA-N Leu-Lys-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O HVHRPWQEQHIQJF-AVGNSLFASA-N 0.000 description 1
- SBANPBVRHYIMRR-UHFFFAOYSA-N Leu-Ser-Pro Natural products CC(C)CC(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O SBANPBVRHYIMRR-UHFFFAOYSA-N 0.000 description 1
- ICYRCNICGBJLGM-HJGDQZAQSA-N Leu-Thr-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(O)=O ICYRCNICGBJLGM-HJGDQZAQSA-N 0.000 description 1
- RIHIGSWBLHSGLV-CQDKDKBSSA-N Leu-Tyr-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O RIHIGSWBLHSGLV-CQDKDKBSSA-N 0.000 description 1
- VKVDRTGWLVZJOM-DCAQKATOSA-N Leu-Val-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O VKVDRTGWLVZJOM-DCAQKATOSA-N 0.000 description 1
- FZIJIFCXUCZHOL-CIUDSAMLSA-N Lys-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN FZIJIFCXUCZHOL-CIUDSAMLSA-N 0.000 description 1
- PNPYKQFJGRFYJE-GUBZILKMSA-N Lys-Ala-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O PNPYKQFJGRFYJE-GUBZILKMSA-N 0.000 description 1
- VHNOAIFVYUQOOY-XUXIUFHCSA-N Lys-Arg-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VHNOAIFVYUQOOY-XUXIUFHCSA-N 0.000 description 1
- YNNPKXBBRZVIRX-IHRRRGAJSA-N Lys-Arg-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O YNNPKXBBRZVIRX-IHRRRGAJSA-N 0.000 description 1
- FUKDBQGFSJUXGX-RWMBFGLXSA-N Lys-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)N)C(=O)O FUKDBQGFSJUXGX-RWMBFGLXSA-N 0.000 description 1
- JYXBNQOKPRQNQS-YTFOTSKYSA-N Lys-Ile-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JYXBNQOKPRQNQS-YTFOTSKYSA-N 0.000 description 1
- PYFNONMJYNJENN-AVGNSLFASA-N Lys-Lys-Gln Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N PYFNONMJYNJENN-AVGNSLFASA-N 0.000 description 1
- IKXQOBUBZSOWDY-AVGNSLFASA-N Lys-Val-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CCCCN)N IKXQOBUBZSOWDY-AVGNSLFASA-N 0.000 description 1
- DTICLBJHRYSJLH-GUBZILKMSA-N Met-Ala-Val Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O DTICLBJHRYSJLH-GUBZILKMSA-N 0.000 description 1
- ZAJNRWKGHWGPDQ-SDDRHHMPSA-N Met-Arg-Pro Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N ZAJNRWKGHWGPDQ-SDDRHHMPSA-N 0.000 description 1
- MYAPQOBHGWJZOM-UWVGGRQHSA-N Met-Gly-Leu Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(C)C MYAPQOBHGWJZOM-UWVGGRQHSA-N 0.000 description 1
- RMLLCGYYVZKKRT-CIUDSAMLSA-N Met-Ser-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O RMLLCGYYVZKKRT-CIUDSAMLSA-N 0.000 description 1
- NDJSSFWDYDUQID-YTWAJWBKSA-N Met-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCSC)N)O NDJSSFWDYDUQID-YTWAJWBKSA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- NAOVYENZCWFBDG-BZSNNMDCSA-N Phe-His-His Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CC=CC=C1 NAOVYENZCWFBDG-BZSNNMDCSA-N 0.000 description 1
- MJQFZGOIVBDIMZ-WHOFXGATSA-N Phe-Ile-Gly Chemical compound N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)O MJQFZGOIVBDIMZ-WHOFXGATSA-N 0.000 description 1
- 229920001397 Poly-beta-hydroxybutyrate Polymers 0.000 description 1
- FZHBZMDRDASUHN-NAKRPEOUSA-N Pro-Ala-Ile Chemical compound CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1)C(O)=O FZHBZMDRDASUHN-NAKRPEOUSA-N 0.000 description 1
- CQZNGNCAIXMAIQ-UBHSHLNASA-N Pro-Ala-Phe Chemical compound C[C@H](NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1ccccc1)C(O)=O CQZNGNCAIXMAIQ-UBHSHLNASA-N 0.000 description 1
- HJSCRFZVGXAGNG-SRVKXCTJSA-N Pro-Gln-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1 HJSCRFZVGXAGNG-SRVKXCTJSA-N 0.000 description 1
- DXTOOBDIIAJZBJ-BQBZGAKWSA-N Pro-Gly-Ser Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(O)=O DXTOOBDIIAJZBJ-BQBZGAKWSA-N 0.000 description 1
- DLZBBDSPTJBOOD-BPNCWPANSA-N Pro-Tyr-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O DLZBBDSPTJBOOD-BPNCWPANSA-N 0.000 description 1
- 101100297400 Rhizobium meliloti (strain 1021) phaAB gene Proteins 0.000 description 1
- FIXILCYTSAUERA-FXQIFTODSA-N Ser-Ala-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FIXILCYTSAUERA-FXQIFTODSA-N 0.000 description 1
- SMIDBHKWSYUBRZ-ACZMJKKPSA-N Ser-Glu-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O SMIDBHKWSYUBRZ-ACZMJKKPSA-N 0.000 description 1
- ADJDNJCSPNFFPI-FXQIFTODSA-N Ser-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO ADJDNJCSPNFFPI-FXQIFTODSA-N 0.000 description 1
- HHJFMHQYEAAOBM-ZLUOBGJFSA-N Ser-Ser-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O HHJFMHQYEAAOBM-ZLUOBGJFSA-N 0.000 description 1
- NVNPWELENFJOHH-CIUDSAMLSA-N Ser-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)N NVNPWELENFJOHH-CIUDSAMLSA-N 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 101100280476 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) fabM gene Proteins 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 101000801918 Synechocystis sp. (strain PCC 6803 / Kazusa) Acetyl-CoA acetyltransferase Proteins 0.000 description 1
- 238000003917 TEM image Methods 0.000 description 1
- PKXHGEXFMIZSER-QTKMDUPCSA-N Thr-Arg-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O PKXHGEXFMIZSER-QTKMDUPCSA-N 0.000 description 1
- SHOMROOOQBDGRL-JHEQGTHGSA-N Thr-Glu-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O SHOMROOOQBDGRL-JHEQGTHGSA-N 0.000 description 1
- KCRQEJSKXAIULJ-FJXKBIBVSA-N Thr-Gly-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O KCRQEJSKXAIULJ-FJXKBIBVSA-N 0.000 description 1
- KBBRNEDOYWMIJP-KYNKHSRBSA-N Thr-Gly-Thr Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)O)N)O KBBRNEDOYWMIJP-KYNKHSRBSA-N 0.000 description 1
- CRZNCABIJLRFKZ-IUKAMOBKSA-N Thr-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N CRZNCABIJLRFKZ-IUKAMOBKSA-N 0.000 description 1
- MEJHFIOYJHTWMK-VOAKCMCISA-N Thr-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)[C@@H](C)O MEJHFIOYJHTWMK-VOAKCMCISA-N 0.000 description 1
- PXQPYPMSLBQHJJ-WFBYXXMGSA-N Trp-Asp-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N PXQPYPMSLBQHJJ-WFBYXXMGSA-N 0.000 description 1
- RXEQOXHCHQJMSO-IHPCNDPISA-N Trp-His-Leu Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(O)=O RXEQOXHCHQJMSO-IHPCNDPISA-N 0.000 description 1
- YYXIWHBHTARPOG-HJXMPXNTSA-N Trp-Ile-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N YYXIWHBHTARPOG-HJXMPXNTSA-N 0.000 description 1
- XOLLWQIBBLBAHQ-WDSOQIARSA-N Trp-Pro-Leu Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(O)=O XOLLWQIBBLBAHQ-WDSOQIARSA-N 0.000 description 1
- XQMGDVVKFRLQKH-BBRMVZONSA-N Trp-Val-Gly Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O)=CNC2=C1 XQMGDVVKFRLQKH-BBRMVZONSA-N 0.000 description 1
- RWTFCAMQLFNPTK-UMPQAUOISA-N Trp-Val-Thr Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)=CNC2=C1 RWTFCAMQLFNPTK-UMPQAUOISA-N 0.000 description 1
- ASQFIHTXXMFENG-XPUUQOCRSA-N Val-Ala-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O ASQFIHTXXMFENG-XPUUQOCRSA-N 0.000 description 1
- AZSHAZJLOZQYAY-FXQIFTODSA-N Val-Ala-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O AZSHAZJLOZQYAY-FXQIFTODSA-N 0.000 description 1
- PAPWZOJOLKZEFR-AVGNSLFASA-N Val-Arg-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N PAPWZOJOLKZEFR-AVGNSLFASA-N 0.000 description 1
- CELJCNRXKZPTCX-XPUUQOCRSA-N Val-Gly-Ala Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O CELJCNRXKZPTCX-XPUUQOCRSA-N 0.000 description 1
- KVRLNEILGGVBJX-IHRRRGAJSA-N Val-His-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)CC1=CN=CN1 KVRLNEILGGVBJX-IHRRRGAJSA-N 0.000 description 1
- UKEVLVBHRKWECS-LSJOCFKGSA-N Val-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](C(C)C)N UKEVLVBHRKWECS-LSJOCFKGSA-N 0.000 description 1
- UMPVMAYCLYMYGA-ONGXEEELSA-N Val-Leu-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O UMPVMAYCLYMYGA-ONGXEEELSA-N 0.000 description 1
- XTDDIVQWDXMRJL-IHRRRGAJSA-N Val-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N XTDDIVQWDXMRJL-IHRRRGAJSA-N 0.000 description 1
- WBAJDGWKRIHOAC-GVXVVHGQSA-N Val-Lys-Gln Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O WBAJDGWKRIHOAC-GVXVVHGQSA-N 0.000 description 1
- ZXYPHBKIZLAQTL-QXEWZRGKSA-N Val-Pro-Asp Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)O)N ZXYPHBKIZLAQTL-QXEWZRGKSA-N 0.000 description 1
- VIKZGAUAKQZDOF-NRPADANISA-N Val-Ser-Glu Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O VIKZGAUAKQZDOF-NRPADANISA-N 0.000 description 1
- DVLWZWNAQUBZBC-ZNSHCXBVSA-N Val-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C(C)C)N)O DVLWZWNAQUBZBC-ZNSHCXBVSA-N 0.000 description 1
- XJLXINKUBYWONI-DQQFMEOOSA-N [[(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-3-hydroxy-4-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2s,3r,4s,5s)-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate Chemical compound NC(=O)C1=CC=C[N+]([C@@H]2[C@H]([C@@H](O)[C@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-DQQFMEOOSA-N 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- 108091000039 acetoacetyl-CoA reductase Proteins 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 1
- 108010041407 alanylaspartic acid Proteins 0.000 description 1
- 108010047495 alanylglycine Proteins 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 108010009111 arginyl-glycyl-glutamic acid Proteins 0.000 description 1
- 108010036533 arginylvaline Proteins 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000001427 coherent effect Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 101150043302 gabD gene Proteins 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 230000004153 glucose metabolism Effects 0.000 description 1
- 108010078144 glutaminyl-glycine Proteins 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 108010049041 glutamylalanine Proteins 0.000 description 1
- 108010090037 glycyl-alanyl-isoleucine Proteins 0.000 description 1
- 108010019832 glycyl-asparaginyl-glycine Proteins 0.000 description 1
- 108010081985 glycyl-cystinyl-aspartic acid Proteins 0.000 description 1
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 1
- 108010028188 glycyl-histidyl-serine Proteins 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- 108010084389 glycyltryptophan Proteins 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 1
- 108010000761 leucylarginine Proteins 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 238000009629 microbiological culture Methods 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 101150110984 phaB gene Proteins 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 108700042769 prolyl-leucyl-glycine Proteins 0.000 description 1
- 108010004914 prolylarginine Proteins 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 239000013049 sediment Substances 0.000 description 1
- 230000001953 sensory effect Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 229960000268 spectinomycin Drugs 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N sulfuric acid Substances OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 108010061238 threonyl-glycine Proteins 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000004102 tricarboxylic acid cycle Effects 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P39/00—Processes involving microorganisms of different genera in the same process, simultaneously
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/62—Carboxylic acid esters
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/62—Carboxylic acid esters
- C12P7/625—Polyesters of hydroxy carboxylic acids
Landscapes
- Organic Chemistry (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Wood Science & Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Biotechnology (AREA)
- Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention provides an improved microbial method for the production of Polyhydroxyalkanoates (PHAs), the method comprising adding acetic acid, acetate or other acetic acid derivative to a basal medium comprising a source of carbon for the microbial synthesis of PHAs; preferably acetic acid or an acetate salt is added. The method can be used to increase the microbial production of PHA polymers synthesized and/or control the monomer ratio in the PHA copolymer product.
Description
Technical Field
The invention relates to the field of biotechnology, in particular to an improved method for producing Polyhydroxyalkanoate (PHA). More specifically, the present invention relates to a method for increasing the microbial production of PHA and/or controlling the monomer ratio in PHA copolymer product by adding an amount of acetic acid to the culture medium.
Background
Currently, glucose or sodium gluconate is generally used as a carbon source in industrial mass production, wherein the glucose or sodium gluconate first generates pyruvic acid through glycolysis, then generates acetyl coenzyme a from the pyruvic acid, and then enters a synthesis pathway for synthesizing various polymer monomers from the acetyl coenzyme a. Glycolysis produces a large amount of NADH and ATP, NADH is also produced in the process of producing acetyl coenzyme A from pyruvic acid, NADH accumulation is caused due to the lack of oxygen in high-density cell culture, and product synthesis is further influenced, so that resource waste is caused. Accordingly, there is a need in the art for a method that alleviates or solves this problem.
Polymers can be divided into copolymers (homopolymers) and homopolymers (homopolymers) according to the composition of the monomers, the homopolymers consisting of one monomer and the copolymers consisting of more than two monomers. The material properties of the homopolymers are simple and not adjustable, while the material properties of the copolymers can be adjusted by varying the monomer ratios therein. The copolymer has higher added value due to better material performance, wherein the proportion of the monomer greatly determines the material performance.
In addition, many microorganisms are known to be capable of producing PHA copolymers through metabolic engineering, but the control of the ratio of monomers therein is difficult. The current methods for controlling the monomer ratio are mainly divided into two categories, wherein one category is to improve the ratio of specific monomers by genetically engineering the metabolic pathways of microorganisms, by optimizing the expression of specific genes, or to reduce the ratio of specific monomers by inhibiting the expression of specific genes. The other is to change the ratio of the corresponding monomers in the polymer by directly controlling the addition amount of a specific related precursor, but most of the related precursors of the monomers are expensive, and some of the precursors are toxic even to cells, so that the method is difficult to be applied to industrial production on a large scale. Therefore, it is important to find a method for adjusting the monomer ratio in the copolymer at low cost in industrial production.
Disclosure of Invention
The present invention has been made to solve the foregoing problems of the prior art.
As for the glycolytic pathway for synthesizing PHA polymer by microorganisms, the inventor of the invention has found through repeated experimental research and analysis that the inhibition of the synthesis of polymer product under high cell density fermentation is caused by the inhibition of the pathway of pyruvate to acetyl-CoA due to the accumulation of NADH, and further the inhibition of the synthesis pathway of various PHA polymer monomers starting from acetyl-CoA, and finally the limitation of the synthesis of polymer product. In view of this, finding a cost-effective method to reduce or eliminate the inhibition of pyruvate metabolism is of great importance for the industrial production of polymers.
In order to reduce or eliminate the inhibition on the metabolism of pyruvic acid, the inventor finds that the addition of acetic acid, acetate or other acetic acid derivatives to a culture medium for microbial fermentation can reduce the inhibition of NADH accumulation on the pathway of producing acetyl coenzyme A from pyruvic acid, reduce the accumulation of pyruvic acid and improve the product yield. Furthermore, it has surprisingly been found that the addition of acetic acid, acetate or other acetic acid derivatives even has the effect of adjusting the monomer ratio in the copolymer.
Based on the above findings, the present invention relates to the following aspects.
(A)
It is an object of the present invention to increase the yield of polymers obtained in microbial synthetic polymers such as Polyhydroxyalkanoate (PHA) processes. The inventor of the invention finds that the aim can be achieved by adding acetic acid, acetate or other acetic acid derivatives into a basic culture medium, and the invention has the advantages of simple production process, low cost and wide application prospect.
Accordingly, in one aspect, the present invention provides an improved method for the production of Polyhydroxyalkanoates (PHAs), comprising the addition of acetic acid, acetate salt, acetate ester or other acetic acid derivative, preferably acetic acid or acetate salt, to a basal medium comprising a carbon source for culturing microorganisms to produce polymers. By the method, the metabolic inhibition of pyruvic acid generated in the process of producing the polymer by the microorganism is relieved, the utilization rate of the carbon source is improved, and the aims of improving the content and the final yield of the polymer in the microbial cells can be fulfilled.
The microorganisms involved in the method of the invention are gram-positive or negative bacteria capable of synthesizing biopolymers. The bacteria include, but are not limited to, bacteria of the genera Escherichia (Escherichia), halophilic (Halophile), Halomonas (Halomonas), Pseudomonas (Pseudomonas), Bacillus (Bacillus), or the like, or combinations thereof. Preferably the microorganism is a bacterium of the genus Halomonas (Halomonas). More specifically, the microorganism may be, for example, Escherichia coli (Escherichia coli), Pseudomonas putida (Pseudomonas putida), Halomonas camphaniensis, or Halomonas bluephaseensis, or the like, or a combination thereof, preferably Halomonas camphaniensis or Halomonas bluephaseensis, or a combination thereof.
The microorganisms referred to above in the process of the invention may be wild-type (i.e.in their natural form under suitable culture conditions capable of synthesizing polymers, such as PHA, using appropriate substrates) or recombinant, artificially engineered, including but not limited to those obtained by mutagenesis, genetic engineering, etc. For example, in the case of a recombinant type, the microorganism may be a recombinant microorganism artificially (for example, by introducing a gene involved in PHA synthesis) modified from a microorganism incapable of synthesizing PHA by itself, and further capable of synthesizing a polymer using an appropriate substrate under appropriate culture conditions, for example, a recombinant microorganism obtained by introducing the synthesis gene phaC gene of polyhydroxybutyrate into Escherichia coli. It may also be a bacterium obtained by disruption/knock-out of the etf gene, for example by disruption/knock-out of the etf-alpha or etf-beta gene, on the basis of a wild-type microorganism capable of synthesizing PHA, such as Halomonas bluephagesis TD01, more specifically, for example by knock-out of the etf-alpha or etf-beta gene on the basis of Halomonas bluephagesis, Halomonas campaniensis and Pseudomonas putida (Pseudomonas putida). For example, the microorganism involved in the method of the present invention may be Halomonas bluegene TD01, or an engineered bacterium obtained by mutagenesis, genetic engineering, etc. on the basis of Halomonas bluegene TD 01.
More preferably, the microorganism may be selected from one or more of the following:
Escherichia coli JM109-pBHR68;
Escherichia coli JM109SG-p68orfZ+pMCSH5;
Halomonas bluephagenesis TD01;
Halomonas bluephagenesis TD08AB;
Halomonas bluephagenesis TD△gabD2-D2;
Halomonas bluephagenesis TDΔβ;
Halomonas bluephagenesis TDΔα。
the microorganism to which the present invention relates may be cultured under appropriate culture conditions (temperature, rotation speed, dissolved oxygen, pH, etc.) as long as the culture enables synthesis of the desired PHA polymer. For example, the temperature and the rotation speed during the culture can be appropriately set by those skilled in the art according to the characteristics of the microorganism or selected by routine optimization experiments.
In the above-mentioned method, a medium for fermentation culture can be obtained by adding a substrate (also referred to as a carbon source) and a regulating substance (such as acetic acid) associated with product synthesis to the basal medium. For example, the final medium may comprise glucose, gluconic acid, gluconate, or a combination thereof as a carbon source for the cultivation of the microorganism. For purposes of differentiation, the carbon sources described herein do not encompass acetic acid. Preferably, the medium comprises glucose as a carbon source. Optionally, the medium may or may not also contain a carbon source other than glucose.
The gluconate mentioned above may be any one or more gluconate salts as long as it can be used as a carbon source for the microorganism to which the present invention relates for polymer production, for example, sodium gluconate, potassium gluconate, calcium gluconate, etc. The concentration of glucose, gluconic acid, gluconate, or gluconate as the carbon source may be appropriately adjusted by those skilled in the art according to the culture conditions and microorganisms used, and may be, for example, in the range of about 1-100g/L, about 1-90g/L, about 1-80g/L, about 1-70g/L, or about 1-60 g/L; preferably, the concentration may be in the range of about 3-60g/L, about 3-50g/L, or about 3-40 g/L; more preferably in the range of about 5-60g/L, about 10-60g/L, about 20-40g/L, including for example about 25.5-34.5 g/L. It is to be understood that the above concentration ranges are not exhaustive, but may be appropriately adjusted by those skilled in the art through experiments according to the conditions of the fermentation system, and are included in the scope of the present invention as long as they do not adversely affect the object of the present invention.
In the above process, acetic acid, acetate ester or other acetic acid derivative may be added to the basal medium before the start of the culture of the microorganism. Alternatively, acetic acid, acetate or other acetic acid derivatives may be added to the medium once, in portions or in streams during the cultivation of the microorganism. Alternatively, the acetic acid, acetate ester or other acetic acid derivative may be added to the culture medium at the same time as the microorganism is inoculated into the culture medium. The acetic acid, acetate salt, acetate ester or other acetic acid derivative may be added at a concentration, for example, in the range of about 1-12g/L, about 1-11g/L, about 1-10g/L, about 1-9g/L, or about 1-8 g/L; preferably about 1-8g/L, for example in the range of about 2-8g/L, about 2-7g/L, about 2-6g/L, about 2-5g/L, about 2-4g/L, or 2-3 g/L; more preferably 2-6g/L, for example in the range of about 3-6g/L or about 3-5 g/L. These concentrations may be appropriately adjusted depending on factors such as the composition of the medium and the culture conditions on the basis of the present invention as long as they do not affect the effects of the present invention.
The acetate salt mentioned above may be any one or more acetate salts as long as the addition thereof can be reasonably expected by those skilled in the art not to adversely affect the object of the present invention, for example, the acetate salt may be, but is not limited to: sodium acetate, potassium acetate, calcium acetate, and the like. Likewise, the above-mentioned acetic acid ester may be any one or more acetic acid esters as long as the addition thereof can be reasonably expected by those skilled in the art not to adversely affect the object of the present invention, for example, methyl acetate, ethyl acetate, propyl acetate, etc.
The above-mentioned basal medium means a medium containing nutrients which can be used to support the growth of the microorganism of the present invention. The above-mentioned basic medium may be a medium conventionally used in the art for culturing microorganisms, such as mineral medium, LB medium, MM medium or beef extract peptone, etc., or a medium modified according to the intended purpose on the basis of these media. That is, one skilled in the art can routinely select an appropriate basal medium as long as it is capable of allowing the growth of the microorganism.
In the method of the present invention, the synthesized polymer may be Polyhydroxyalkanoate (PHA), but is not limited thereto. In particular, the PHA can be a copolymer or a homopolymer, or a combination thereof. In the case of a homopolymer, it may include, but is not limited to, polyhydroxypropionate, polyhydroxybutyrate, polyhydroxyvalerate, and the like, for example, poly-3-hydroxybutyrate (P3HB), poly-4-hydroxybutyrate (P4HB), poly-3-hydroxypropionate (P3HP), or poly-3-hydroxyvalerate (P3HV), and the like. In the case of the copolymer, the copolymer may be a dimer, a trimer, but is not limited thereto, and for example, the copolymer may be a copolymer of a hydroxypropionate and a hydroxybutyrate; copolymers of a hydroxy propionate and a hydroxy valerate; a copolymer of hydroxybutyrate and hydroxyvalerate; hydroxy propionate, hydroxy butyrate, hydroxy valerate, and the like. More specifically, it may be poly (3-hydroxybutyrate-co-4-hydroxybutyrate) (P3HB4HB), poly (3-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB3HV), poly (3-hydroxybutyrate-co-4-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB4HB3HV), or the like.
According to the technical scheme of the invention, by adding a proper amount of acetic acid into a basal medium containing a carbon source for culturing microorganisms, the metabolic inhibition of pyruvic acid is relieved or eliminated, the capability of the microorganisms for synthesizing polymers is improved, the dry weight of cells is increased, and the yield of the finally obtained polymers is increased.
Based on the foregoing, the present invention also provides a method for increasing the yield of polyhydroxyalkanoate in the microbial synthesis of polyhydroxyalkanoate, comprising adding acetic acid, acetate salt, acetate ester or other acetic acid derivative, preferably acetic acid or acetate salt, to a basal medium comprising a carbon source for culturing a microorganism for the production of a polymer. The definitions for the specific microorganism, carbon source, culture medium, acetic acid (or acetate, acetate or other acetic acid derivative) involved in the process are as described above.
(II)
It is another object of the present invention to adjust the monomer ratio in the copolymer product produced in the microbial production of the copolymer.
Thus, in a second aspect, the present invention provides an improved method for the production of Polyhydroxyalkanoates (PHAs), the method comprising adding acetic acid, acetate or other acetic acid derivative to a basal medium comprising a source of carbon for the growth and cultivation of the microorganism, the polymer being a copolymeric polyhydroxyalkanoate. By the method, the shunting of the microbial metabolic flow can be changed, the internal environment of the microbe is changed, the metabolic flow of acetyl coenzyme A entering different monomer synthesis paths is influenced, and the proportion of various monomers in the cell accumulated biopolymer is changed. The invention has simple production process, low cost and wide application prospect.
The microorganisms involved in the method of the invention are gram-positive or negative bacteria capable of synthesizing biopolymers. The bacteria include, but are not limited to, bacteria of the genera Escherichia (Escherichia), halophilic (Halophile), Halomonas (Halomonas), Pseudomonas (Pseudomonas), Bacillus (Bacillus), or the like, or combinations thereof. Preferably the microorganism is a bacterium of the genus Halomonas (Halomonas). More specifically, the microorganism may be, for example, Escherichia coli (Escherichia coli), Pseudomonas putida (Pseudomonas putida), Halomonas camphaniensis, or Halomonas bluephaseensis, or the like, or a combination thereof, preferably Halomonas camphaniensis or Halomonas bluephaseensis, or a combination thereof.
The microorganisms involved in the process of the invention may be wild-type (i.e.in their natural form under suitable culture conditions capable of synthesizing polymers, such as PHA, using appropriate substrates) or recombinant, artificially engineered. In the case of a recombinant type, it may be a recombinant microorganism artificially modified (for example, by introducing a gene involved in PHA synthesis) in a microorganism incapable of synthesizing PHA by itself, thereby enabling it to synthesize a polymer using an appropriate substrate under appropriate culture conditions, for example, a recombinant microorganism obtained by introducing a polyhydroxybutyrate synthesis gene, phaC, into Escherichia coli. It may also be a bacterium obtained by disruption/knock-out of the etf gene, for example by disruption/knock-out of the etf-alpha or etf-beta gene, on the basis of a wild-type microorganism capable of synthesizing PHA, such as Halomonas bluephagesis TD01, more specifically, for example by knock-out of the etf-alpha or etf-beta gene on the basis of Halomonas bluephagesis, Halomonas campaniensis, Pseudomonas putida (Pseudomonas putida). For example, the microorganism involved in the method of the present invention may be Halomonas bluegene TD01, or an engineered bacterium obtained by mutagenesis, genetic engineering, etc. on the basis of Halomonas bluegene TD 01.
More preferably, the microorganism may be selected from one or more of the following:
Escherichia coli JM109-pBHR68;
Escherichia coli JM109SG-p68orfZ+pMCSH5;
Halomonas bluephagenesis TD01;
Halomonas bluephagenesis TD08AB;
Halomonas bluephagenesis TD△gabD2-D2;
Halomonas bluephagenesis TDΔβ;
Halomonas bluephagenesis TDΔα。
the microorganism to which the present invention relates may be cultured under appropriate culture conditions (temperature, rotation speed, dissolved oxygen, pH, etc.) as long as the culture enables it to synthesize a desired polymer. For example, the temperature and the rotation speed during the culture can be appropriately set by those skilled in the art according to the characteristics of the microorganism or selected by routine optimization experiments.
In the above-mentioned method, a medium for fermentation culture can be obtained by adding a substrate (also referred to as a carbon source) and a regulating substance (such as acetic acid) associated with product synthesis to the basal medium. For example, the final medium may be glucose, gluconic acid, gluconate, or a combination thereof as a carbon source for the cultivation of the microorganism. Preferably, the medium comprises glucose as a carbon source. For purposes of differentiation, the carbon sources described herein do not encompass acetic acid. Optionally, the medium may or may not also contain a carbon source other than glucose.
The gluconate mentioned above may be any one or more gluconate salts as long as it can be used as a carbon source for the microorganism to which the present invention relates for polymer production, for example, sodium gluconate, potassium gluconate, calcium gluconate, etc. The concentration of glucose, gluconic acid, gluconate, or gluconate as the carbon source may be appropriately adjusted by those skilled in the art according to the culture conditions and microorganisms used, and may be, for example, in the range of about 1-100g/L, about 1-90g/L, about 1-80g/L, about 1-70g/L, or about 1-60 g/L; preferably, the concentration may be in the range of about 3-60g/L, about 3-50g/L, or about 3-40 g/L; more preferably in the range of about 5-60g/L, about 10-60g/L, about 20-40g/L, including for example about 25.5-34.5 g/L. It is to be understood that the above concentration ranges are not exhaustive, but may be appropriately adjusted by those skilled in the art through experiments according to the conditions of the fermentation system, and are included in the scope of the present invention as long as they do not adversely affect the object of the present invention.
In the above process, acetic acid, acetate ester or other acetic acid derivative may be added to the basal medium before the start of the culture of the microorganism. Alternatively, acetic acid, acetate or other acetic acid derivatives may be added to the medium once, in portions or in streams during the cultivation of the microorganism. Alternatively, the acetic acid, acetate ester or other acetic acid derivative may be added to the culture medium at the same time as the microorganism is inoculated into the culture medium. The acetic acid, acetate salt, acetate ester or other acetic acid derivative may be added at a concentration, for example, in the range of about 1-12g/L, about 1-11g/L, about 1-10g/L, about 1-9g/L, or about 1-8 g/L; preferably about 1-8g/L, for example in the range of about 2-8g/L, about 2-7g/L, about 2-6g/L, about 2-5g/L, about 2-4g/L, or 2-3 g/L; more preferably 2-6g/L, for example in the range of about 3-6g/L or about 3-5 g/L. These concentrations may be appropriately adjusted depending on factors such as the composition of the medium and the culture conditions on the basis of the present invention as long as they do not affect the effects of the present invention.
The acetate salt mentioned above may be any one or more acetate salts as long as the addition thereof can be reasonably expected by those skilled in the art not to adversely affect the object of the present invention, for example, the acetate salt may be, but is not limited to: sodium acetate, potassium acetate, calcium acetate, and the like. Likewise, the above-mentioned acetic acid ester may be any one or more acetic acid esters as long as the addition thereof can be reasonably expected by those skilled in the art not to adversely affect the object of the present invention, for example, methyl acetate, ethyl acetate, propyl acetate, etc.
The above-mentioned basal medium means a medium containing nutrients which can be used to support the growth of the microorganism of the present invention. The above-mentioned basic medium may be a medium conventionally used in the art for culturing microorganisms, such as mineral medium, LB medium, MM medium or beef extract peptone, etc., or a medium modified according to the intended purpose on the basis of these media. That is, one skilled in the art can routinely select an appropriate basal medium as long as it is capable of allowing the growth of the microorganism.
In the method of the present invention, the synthesized polymer is a copolymer, which may be a dimer, a trimer, but is not limited thereto, for example, the copolymer may be a copolymer of a hydroxypropionate ester and a hydroxybutyrate ester; copolymers of a hydroxy propionate and a hydroxy valerate; a copolymer of hydroxybutyrate and hydroxyvalerate; hydroxy propionate, hydroxy butyrate, hydroxy valerate, and the like. More specifically, it may be poly (3-hydroxybutyrate-co-4-hydroxybutyrate) (P3HB4HB), poly (3-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB3HV), poly (3-hydroxybutyrate-co-4-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB4HB3HV), or the like.
Based on the foregoing, the present invention also provides a method for adjusting the monomer ratio in a polyhydroxyalkanoate copolymer in the microbial synthesis, comprising adding acetic acid, acetate salt, acetate ester or other acetic acid derivative, preferably acetic acid or acetate salt, to a basal medium comprising a carbon source for culturing a microorganism to produce the polymer. The definitions for the specific microorganism, carbon source, culture medium, acetic acid (or acetate, acetate or other acetic acid derivative) involved in the process are as described above.
(III)
In a third aspect, the present invention provides a method of reducing pyruvate accumulated during production of Polyhydroxyalkanoate (PHA) by a microorganism, the method comprising adding acetic acid, acetate salt, acetate ester or other acetic acid derivative at a concentration as described in the first to second aspects above to a basal medium comprising a carbon source for culturing the microorganism. Further, the basal medium, carbon source and the like in the method are also as described in the foregoing first to second aspects.
(IV)
In a fourth aspect, the present invention provides a recombinant bacterium obtained by knocking out/inactivating any or all of the etf- α and etf- β subunits of etf gene on the basis of a bacterium of the genus Halomonas, preferably Halomonas bluegene, more preferably Halomonas bluegene TD01 with the accession number cgmccno. 4353.
The present invention also provides a method for producing poly (3-hydroxybutyrate-co-4-hydroxybutyrate), which comprises using the recombinant bacterium wherein the etf gene is knocked out/inactivated as described above to perform fermentation in a basal medium comprising a carbon source under conditions suitable for culturing the recombinant bacterium to produce poly (3-hydroxybutyrate-co-4-hydroxybutyrate). Preferably, acetic acid, acetate salt, acetate ester or other acetic acid derivative may be added to the basal medium at a concentration as described in the first to second aspects above. Further, the basal medium, carbon source and the like in the method are also as described in the foregoing first to second aspects.
Drawings
FIG. 1 is a diagram showing the agarose gel results of the etf- β subunit knock-out in example 2.
FIG. 2 is a schematic diagram of transmission electron micrographs of Halomonas bluephagesis TD01 and TD. DELTA.beta. accumulation P3HB in example 2, the left graph being TD01 under the condition of 6g/L acetic acid addition; the right panel shows TD. DELTA.beta.obtained under the condition of adding 3g/L acetic acid.
Detailed Description
The dry cell weight (CDW, g/L) referred to herein is the ratio of the mass of ice-dried biomass to the volume of fermentation broth.
PHA as referred to herein means polyhydroxyalkanoate, which can be classified into homopolymers and copolymers according to monomer composition. Depending on the number of carbon atoms of the monomer, the PHA of the present invention may be a short chain PHA (i.e., a hydroxy fatty acid monomer C3-C5) or a medium-long chain PHA (i.e., a hydroxy fatty acid monomer C6-C16), but is not limited thereto. In some embodiments of the invention, the PHA may be a homopolymer, including but not limited to polyhydroxypropionate, polyhydroxybutyrate, polyhydroxyvalerate, and the like, for example, poly-3-hydroxybutyrate (P3HB), poly-4-hydroxybutyrate (P4HB), poly-3-hydroxypropionate (P3HP), or poly-3-hydroxyvalerate (P3HV), and the like. In some embodiments of the invention, the PHA may be a copolymer such as, but not limited to, a dimer, a trimer, and the like, for example, the copolymer may be a copolymer of a hydroxypropionate ester and a hydroxybutyrate ester; copolymers of a hydroxy propionate and a hydroxy valerate; a copolymer of hydroxybutyrate and hydroxyvalerate; hydroxy propionate, hydroxy butyrate, hydroxy valerate, and the like. More specifically, in some embodiments of the invention, the PHA can be poly (3-hydroxybutyrate-co-4-hydroxybutyrate) (P3HB4HB), poly (3-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB3HV), or poly (3-hydroxybutyrate-co-4-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB4HB3HV), combinations thereof, or the like. In some embodiments of the invention, the PHA may be P3HB (i.e., a poly-beta-hydroxybutyrate or a poly-3-hydroxybutyrate). In other embodiments of the invention, the PHA may be P3HB3HV (i.e., a 3-hydroxybutyrate 3-hydroxyvalerate copolymer).
The content (wt%) of P3HB3HV referred to herein is the mass of P3HB3HV in the ice-dried cells as a percentage of the mass of the ice-dried cells participating in the esterification, wherein the mass of P3HB3HV is the sum of the mass of 3HV obtained after the esterification and the mass of 3HB, and in the examples, "%" means "% by weight" unless otherwise specified.
The P3HB content (wt%) referred to herein is the mass percentage of P3HB to the mass of the ice-dried cells participating in the esterification, where the mass of P3HB is the total mass of 3HB obtained after the esterification. In the examples, "%" means "% by weight" unless otherwise specified.
The 3HV (mol%) referred to herein in example 3 is the percentage of moles of 3HV monomer to the total moles of P3HB3HV monomer, where the total moles of P3HB3HV monomer is the moles of 3HV monomer + moles of 3HB monomer, where 3HV represents 3-hydroxyvalerate and 3HB represents 3-hydroxybutanoic acid (ester). Similarly, the reference to 4HB (mol%) in example 3 herein represents the percentage of moles of 4HB monomer to the total moles of P3HB4HB monomer.
The "basal medium" as referred to herein means a medium suitable for culturing a microorganism and for the microorganism to synthesize polyhydroxyalkanoate using a carbon source added to the medium, such as MM medium, LB medium, mineral medium, and the like, but is not limited thereto. The formulation of these media is routinely known to those skilled in the art, and those skilled in the art can routinely make appropriate adjustments to their components or component concentrations. In this context, unless otherwise specified, the medium or basal medium used for culturing the microorganism to synthesize the desired product is referred to as liquid medium.
The general formulation of LB liquid medium is: 4-6g/L yeast extract, 8-12g/L peptone, 8-12g/L NaCl, and the balance of distilled water (pH adjusted to 7.0-7.2); preferably: 5g/L yeast extract, 10g/L peptone, 10g/L NaCl, and the balance distilled water (pH adjusted to 7.0-7.2).
The general formulation of MM liquid medium is: 0.1-2 ‰ (NH)4)2SO4Or urea, 0.1-1 MgSO4,5‰-10‰Na2HPO4·12H2O,0.5‰-2‰KH2PO4Not more than 0.1% of other trace elements (Fe (III) -NH)4-Citrate,CaCl2·2H2O,ZnSO4·7H2O,MnCl2·4H2O,H3BO3,CoCl2·6H2O,CuSO4·5H2O,NiCl2·6H2O,NaMoO4·2H2Trace O) (pH adjusted to about 9.0). Preferably: 0.1% (NH)4)2SO4Or 0.2% urea, 0.02% MgSO4,1.0%Na2HPO4·12H2O,0.15%KH2PO4Not more than 0.1% of other trace elements (Fe (III) -NH)4-Citrate,CaCl2·2H2O,ZnSO4·7H2O,MnCl2·4H2O,H3BO3,CoCl2·6H2O,CuSO4·5H2O,NiCl2·6H2O,NaMoO4·2H2O) (pH adjusted to about 9.0).
The "carbon source" is a nutrient substance that provides carbon elements necessary for growth and reproduction of microorganisms. In the present invention, the "carbon source" is the source of substrate for PHA synthesis by the microorganism of the present invention, excluding acetic acid. Thus, "carbon source" may be used interchangeably herein with "substrate". The carbon source may be: glucose, gluconic acid, gluconate ester, starch, sucrose, and the like, or combinations thereof, but is not limited thereto. Glucose is preferably used as the carbon source in the present invention.
The ETF gene mentioned herein is a gene encoding Electron Transfer Flavoprotein (ETF), which is known to be present in e.g. Halomonas and pseudomonas, comprising two subunits ETF- α and ETF- β, the NCBI numbering within Halomonas bluephasenesis TD01 being respectively: WP _009724031.1, WP _ 009724032.1.
Examples
Materials, reagents and the like used in the following examples are commercially available unless otherwise specified.
Except for special instructions, the enzyme reagents are purchased from Thermo Scientific Fermentas, the kit for extracting plasmids is purchased from Beijing Bomai technical development company, the kit for recovering DNA fragments is purchased from American omega, and the corresponding operation steps are carried out according to product instructions; all culture media are prepared by deionized water if no special instructions exist; the reagents and enzymes involved in PCR were obtained from NEB corporation (USA).
Experimental materials:
the LB medium contained: 5g/L yeast extract (from OXID, U.K., catalog No. LP0021), 10g/L peptone (from OXID, U.K., catalog No. LP0042), 10g/L NaCl, and the balance distilled water; adjusting the pH value to 7.0-7.2; then autoclaved.
The LB60 medium contained: 5g/L yeast extract (from OXID, U.K., catalog No. LP0021), 10g/L peptone (from OXID, U.K., catalog No. LP0042), 60g/L NaCl, and the balance distilled water; adjusting the pH value to 7.0-7.2; then autoclaved.
MM60 medium configuration method: preparing a NaCl solution of yeast extract (available from OXID, UK, catalog No. LP0021) at a yeast extract concentration of 1g/L and a NaCl concentration of 60 g/L; after dissolution, autoclaving; after cooling, 1ml of component I (to 10g (NH) was added per 50ml of solution4)2SO4And 2g MgSO4Adding distilled water to a volume of 200mL, followed by autoclaving) and 1mL of component II (96.5 g Na to2HPO4·12H2O and 15g KH2PO4Adding distilled water to a constant volume of 200ml, and then sterilizing by high-pressure steam); finally, the pH of the system was adjusted to about 9.0 with 5M aqueous NaOH.
(NH) used in the above preparation4)2SO4、NaCl、MgSO4、Na2HPO4·12H2O、KH2PO4From the national pharmaceutical group chemical agents, ltd, catalog numbers 10002992, 10019308, 10034998, 10020392, 1017628, respectively; glucose was purchased from national pharmaceutical group chemical agents limited under catalog number 63005518; sodium gluconate was purchased from SIGMA-ALDRICH, USA under the catalog number S2054-1 KG.
During the culture process, antibiotics with certain concentration, such as 100. mu.g/mL ampicillin, are added to the culture medium according to actual needs to maintain the stability of the plasmid. Acetic acid and glucose were added after the medium was sterilized, and the pH was adjusted to an appropriate value.
The following strains were used in the examples:
coli S17-1: described in Simon R, Priefer U, Suhler A.A broad host range mobility system for in vivo genetic engineering, transposon mutagenetics in gram negative bacteria [ J ]. Nature biotechnology,1983,1(9):784. presented by professor Uwe Sauer, university of Soviet Richardson; the bacteria are available to the public from the university of Qinghua.
Halomonas bluephagene TD 01: the strain is deposited in China general microbiological culture Collection center on 19 th 11 th 2010 with the collection registration number of CGMCCNo.4353 and is classified and named as Halomonas sp.TD01 (also known as Halomonas bluephagenes TD01, see XB Chen et al (2017), Construction of Halomonas bluephagenes capable of high cell density growth for effective PHA production. applied Microbiol. biotechnol. volume 244, Part 1,534 + 541 pages); it is described in patent application publication No. CN 102120973A; the bacteria are available to the public from the university of Qinghua.
Escherichia coli JM109-pBHR 68: prepared by transforming the plasmid pBHR68, pBHR68 being a plasmid containing synthetic polyhydroxybutyrate-related genes, into Escherichia coli JM109 (available from Beijing Bomaide Gene technology Co., Ltd.), described in the following documents: spiekermann P, Rehm BHA, Kalscheuer R, Baumeister D, Steinbuchel A (1999) A sensory, viable-collagen stabilizing method using Ni red for direct screening of bacteria at culture complex polyhydroxyalkanoic acids and other storage com-points Arch Microbiol 171: 73-80 containing the polyhydroxybutyrate synthesis gene phaC gene, beta-ketothiolase phaA and NADPH-dependent acetoacetyl-CoA reductase phaB from Eubacterium rolstoni, Ralstonia eutropha, which is publicly available from the university of Qinghua, and Escherichia coli JM109-pBHR68, which can be obtained by a person skilled in the art by conventional molecular biology means according to the above disclosure.
Escherichia coli JM109SG-p68orfZ + pMCSH 5: this strain is described in Li Z J, Shi Z Y, Jian J, et al.production of poly (3-hydroxybutyric-co-4-hydroxybutyric) from unreported carbon sources by Metabolic engineering Escherichia coli [ J ] Metabolic engineering,2010,12(4): 352-) 359, which is capable of producing P3HB4HB using glucose as a single carbon source, which is stored at the university of Qing Hua and which is publicly available from the university of Qing Hua.
Halomonas bluephagene TD08 AB: this strain is described in Yin J, Wang H, Fu X Z, et al, effects of chromosomal gene copy number and location on polyhydroxyakanoate synthesis by Escherichia coli and Halomonas sp [ J ]. Applied Microbiology and Biotechnology,2015,99(13): 5523. 5534. P3HB3HV can be produced using glucose as a single carbon source, which is stored at the university of Qinghua and is publicly available from the university of Qinghua.
Halomonas bluephagene TD Δ gabD 2-D2: this strain is described in Ye J, Hu D, Che X, et al, Engineering of Halomonas bluepharmacologesis for low cost production of poly (3-hydroxybutyric-co-4-hydroxybutanoate) from glucose [ J ]. Metabolic Engineering,2018,47: 143. the strain is capable of producing P3HB4HB using glucose as a single carbon source, and is stored at the university of Qinghua and publicly available from the university of Qinghua.
Halomonas bluephagene TD. DELTA.beta.: the Halomonas bluephagene TD01 strain is obtained by etf-beta subunit knockout of a starting strain, is constructed in experiments in the application and is deposited at Qinghua university, and the specific construction process is shown in example 2. The bacterium can be prepared by those skilled in the art in light of the disclosure of the present application, and can be obtained by the public from the university of Qinghua.
Halomonas bluephagene TD Δ α: the Halomonas bluephagene TD01 strain is obtained by etf-alpha subunit knockout of a starting strain, is constructed in experiments in the application and is deposited at Qinghua university, and the specific construction process is shown in example 2. The bacterium can be prepared by those skilled in the art in light of the disclosure of the present application, and can be obtained by the public from the university of Qinghua.
The method for detecting the content of Polyhydroxyalkanoate (PHA) by gas chromatography comprises the following steps:
setting the furnace temperature to 80 ℃, the injector temperature to 200 ℃, the detector temperature to 220 ℃, the column head pressure to 0.25Mpa, and the temperature programming conditions as follows: the temperature was held at 80 ℃ for 1.5 minutes, raised to 140 ℃ at a rate of 30 ℃/min, then raised to 220 ℃ at a rate of 40 ℃/min and held at this temperature for 0.5 minutes. The amount of the sample to be introduced was 1. mu.l, and a microsyringe manufactured by Agilent was used.
Gas phase sample preparation: taking 40-60mg of stem cells of a sample to be detected (bacterial liquid is taken to be centrifuged at 10000rpm at normal temperature for 10 minutes, and after the obtained cell sediment is washed once by water, the stem cells are dried by ice to obtain the stem cells, and the homopolymer is produced in the cells), adding 2ml of chloroform and 2ml of esterification solution (3% (v/v) of concentrated sulfuric acid and 2g/L of benzoic acid in pure methanol are taken as internal standards) into an esterification tube, covering and sealing the esterification tube, and heating the esterification tube at 100 ℃ for 4 hours. After cooling, 1ml of distilled water was added thereto, the mixture was sufficiently shaken and allowed to stand, and after the chloroform phase and the aqueous phase were completely separated, 1. mu.l of the chloroform phase in the lower layer was taken out and injected into a gas chromatograph (Hewlett Packard 6890, HP) to conduct chromatography. The gas chromatograph was operated according to the specifications for the HP Hewlett Packard 6890 gas chromatograph.
Preparation of a standard sample: 10-20mg of standard sample is put into an esterification tube, 2ml of chloroform and 2ml of esterification solution are added, and esterification is carried out at 100 ℃ after capping and sealing.
And (4) analyzing results: taking a standard sample as a reference, if an esterified sample (a sample to be detected) of a cell to be detected has an obvious peak at a standard sample, calculating the mass of each monomer according to the peak area, and then calculating the molar ratio according to the mass fraction of each monomer; the specific gravity (wt%) of the polymer contained in the dry cell weight can be calculated from the amount of the sample added.
Example 1 increasing the yield of P3HB fermentative synthesis by microorganisms by adding acetic acid to the basal Medium
Optimization of culture medium and culture conditions
(1) Optimization of glucose concentration
Experiments were performed with Halomonas bluephagene TD01 as the P3HB producing strain to determine the optimum glucose concentration for P3HB production. Firstly, picking single colony to 20mL LB60 (LB containing 60g/L NaCl) culture medium to culture at 37 ℃ and 200rpm overnight; then, the cells were inoculated into 50mL of MM60 medium (pH8.5-9.0, NaCl concentration 60g/L) containing glucose (see Table 1) of various concentrations at an inoculum size of 5% (v/v), respectively, subjected to shake-flask culture at 37 ℃ and 200rpm for 48 hours to obtain a bacterial solution, and after centrifugation, washing with water and ice-drying, the dry cell weight (CDW; unit g/L) of the sample was measured, and then the percentage (%) of P3HB in the dry cell weight was determined by gas chromatography. Three sets of parallels were set for each condition. The dry cell weight and P3HB content are shown in Table 1.
TABLE 1 Shake flask experimental results of Halomonas TD01 for production of P3HB with different glucose concentrations
As can be seen from the results in Table 1, 30g/L of glucose is the optimal concentration for TD01 to accumulate P3HB, and therefore this concentration was chosen for subsequent experiments.
(2) Optimization of shaking culture rotation speed
The culture rotating speed of the shake flask has direct influence on the oxygen environment for the growth of the microorganism, and the external oxygen environment directly influences the internal environment of the microorganism, so that the optimal environment for the microorganism to accumulate P3HB is found by controlling the rotating speed of the shake flask. Taking Halomonas bluephagene TD01 as a P3HB producing strain, firstly picking out a single strain to be cultured in 20mL LB60 (LB containing 60g/L NaCl) culture medium at 37 ℃ and 200rpm overnight; then inoculating the cells into 50mL of MM60 medium (pH8.5-9.0, NaCl concentration 60g/L) containing 30g/L glucose according to the inoculation amount (v/v) of 5%, setting three rotation speed gradients of 100rpm, 200rpm and 300rpm respectively, performing shake culture at 37 ℃ for 48 hours to obtain a bacterial liquid, performing centrifugation, washing and ice drying to obtain the cell dry weight of the sample, and detecting the content percentage (%) of P3HB in the cell dry weight by gas chromatography. Three sets of parallels were set for each condition. The dry cell weight and P3HB content are shown in Table 2.
TABLE 2 Shake flask experimental results of Halomonas TD01 for P3HB production under different rotation speed conditions
From table 2 we can see that the optimum speed for P3HB production by Halomonas TD01 is 200rpm, so a speed of 200rpm was chosen for subsequent experiments.
Secondly, acetic acid was added to the carbon source supplemented medium to test its effect on the synthesis of Halomonas bluephaseensis TD01 and P3HB
Acetic acid is known to be a carbon source that is less reducing than glucose, and a number of documents have reported that acetic acid has an inhibitory effect on the growth of microorganisms. In the present application, however, the inventors have found that not only is no inhibitory effect of acetic acid on cell growth and accumulation of P3HB observed by adding acetic acid and controlling the appropriate amount of addition, but also it has been found that it can increase the accumulation amount of P3HB, which is likely to be achieved by regulating the microenvironment inside the microorganism, eliminating metabolic inhibition of pyruvate, and saving carbon sources.
Taking P3HB produced by Halomonas bluephagene TD01 as an example, firstly picking up single colony in 20mL LB60 (LB containing 60g/L NaCl) culture medium, and culturing at 37 ℃ and 200rpm overnight; then, the medium was inoculated at 5% (v/v) into 50mL of MM60 medium (pH8.5-9.0, NaCl concentration 60g/L) to which glucose and acetic acid were added, wherein the glucose concentration was 30g/L and the acetic acid was set between 0 and 12g/L, to conduct a concentration gradient experiment (see Table 3). The culture temperature is set to be 37 ℃, the set rotating speed is set to be 200rpm, the shake flask culture is carried out for 48 hours to obtain bacterial liquid, the cell dry weight of the sample is obtained after centrifugation, water washing and ice drying, and then the content percentage (%) of P3HB in the cell dry weight is detected through gas chromatography. Three sets of parallels were set for each condition. The dry cell weight and P3HB content are shown in Table 3.
TABLE 3 Effect of different concentrations of acetic acid addition on P3HB production by Halomonas TD01
As can be seen from the data in Table 3, supplementation with acetic acid increased the ability of the cells of the microorganism to accumulate P3HB per weight, and within certain limits increased the dry cell weight of the microorganism. Supplementation with 1-8g/L acetic acid, particularly 2-8g/L acetic acid, was calculated to increase the total yield (g/L) of the P3HB product by at least about 12% over the range of 2-8g/L acetic acid addition compared to the control without acetic acid. Wherein, under the condition of acetic acid addition of less than 6g/L, the growth of cells and the accumulation of P3HB are promoted to be larger along with the increase of the acetic acid concentration, but when the acetic acid concentration is increased to be more than 6g/L, the dry weight of the cells and the percentage content of P3HB are not further increased along with the increase of the acetic acid concentration and even begin to decrease.
We also examined the contents of various substances in the fermentation broth after the end of fermentation, including glucose, acetic acid and pyruvic acid (Table 4).
TABLE 4 analysis and detection of substances in fermentation broth after fermentation
According to the results of this example, the addition of acetic acid indeed reduced the inhibition of pyruvate metabolism by NADH in the fermentation system and reduced the pyruvate residue, compared to the case where acetic acid was not added, thereby improving the glucose utilization rate.
By combining the P3HB accumulation and cell dry weight data in Table 3, we can find that the addition of 1-8g/L acetic acid, especially 2-8g/L acetic acid, can significantly improve the cell dry weight and the utilization rate of carbon sources, and effectively improve the synthetic amount of P3 HB; simultaneously reducing glucose and pyruvate residuals, thereby alleviating metabolic inhibition of glucose and pyruvate; and the residual proportion of acetic acid is lower, so that the whole fermentation system is optimized.
Thirdly, adding acetic acid and other carbon sources for comparison
To verify that the addition of acetic acid has a alleviating effect on the inhibition of pyruvate and glucose metabolism rather than the effect of additional carbon source addition, we set up a control experiment with additional pyruvate and glucose addition. In this experiment, the strains, the culture media and the culture conditions used were the same as those in the second part of example 1, except that acetic acid, pyruvic acid or glucose, respectively, was additionally added to the basal medium in amounts shown in Table 5, the amounts added of which would theoretically be converted to the same amount of acetyl-CoA (Table 5).
TABLE 5 Effect of addition of acetic acid, pyruvic acid and glucose on the synthesis of P3HB
From table 5 we can conclude that: the extra addition of carbon sources such as glucose or pyruvate cannot increase the cell dry weight or the P3HB accumulation, and even the addition of pyruvate can reduce the cell dry weight and the P3HB content, which proves that the accumulation of pyruvate can actually inhibit the synthesis of P3 HB; the experiment further proves that the addition of acetic acid reduces the residue of pyruvic acid, and further has the promotion effect on the growth of microbial cells and the synthesis of P3 HB.
Fourth, influence of acetate addition on P3HB Synthesis
Considering that acetic acid exists in the form of ions in the culture medium solution, the inventors expect that the addition of acetate will obtain substantially the same effect as the addition of acetic acid, and the same experiment was performed as in the second part of example 1 except that acetic acid was replaced with acetate (sodium acetate, potassium acetate, calcium acetate, etc.).
The results show that the effect of the addition of acetic acid and sodium acetate on the dry cell weight and the percentage of synthesis of P3HB is indeed essentially the same.
Example 2 the effect of acetic acid addition to carbon source supplemented media on the synthesis of Halomonas bluephasensis TD Δ β and P3HB was tested.
Firstly, construction of engineering bacteria TD delta beta:
1) construction of the homology arms of the knock-out plasmid pKObeta 23
Extracting genome of Halomonas bluephagene Halomonas TD01, performing PCR amplification by taking the genome as a template and pfu enzyme (NEB, USA), and amplifying a left homologous arm H1 and a right homologous arm H2 of etf-beta (the nucleotide sequence is shown in SEQ ID NO: 1; the amino acid sequence is shown in SEQ ID NO:2) by taking beta-H1-F and beta-H1-R, and taking beta-H2-F and beta-H2-R as primers; plasmid template Donor-1 was obtained by amplification using primers Donor-H-F and Donor-H-R as primers, using plasmid pSEVA241 as a template (The plasmid is described in "The Standard European Vector Architecture (SEVA): a coherent plant for The analysis and purification of complex prokaemic genotypes," Nucleic Acids Research 41.D1(2012): D666-D675.).
etf-beta (SEQ ID NO: 1):
ATGCGGCCTGAACAACAGCAAAAACAACAAAAGCCGGGTATCGACGTGGCGGTGCTGGTCTCCATAGGCCGTCACCCCACAACCGGTCGTGCGAGGCGCGCCGAGCAGGATGCACGGGGTCTGGAACTTGCTCTAGCCATGGAAGCAGAACTGCCGGGTAGCCGGATTGACGTACTGCACGCTGGTTCTCAGGATGTCGACAGCGAGGCAGCTCTGCGCAGTTACTTGGGTATGGCCACAGGCGTTGGTATGGGGCTTGAGTCTATGACCTTGCTGGAGCAGCCCGATGGCAGCGATGCCATTCTACCGCTGGTGGAACATTTAGCCGCTACCTCGCCCCAACTAGTGATCACCGGTGCCCGGGCCGAGCGCGGAGAAGGTTCTGGGCTTTTGCCCTATGCGTTGGCTGAGCATCTCGGTTGGCCGTTAGTGAATAGCTTGGCGTCGATAGAGACAGTGGAGAATGGTGTGATAACGCTGCTTCAAGCGTTGCCACGGGGCCAGCGTCGCCGTCTCAAGGTGCGCTTGCCCGCCATCATCAGCGTGGATGAAGCAGCGCCGGCGGCGCGTCAGAGCGCCTTCGGCCCGGCTCGCCGAGCCAGCTTCTCGGTGGCGCCCACTACCTCTGAAGCCGACAGTGAGTTGGCCCAGTGGCACTTGAGCCCCGCACGTAAACGGCCTAAGCGTCTGAAAATCATTAAAGCCGCCTCAGCCAGAGATCGTTTCAAAGCGGCGGCTTCCAAAGCCGAGGGCAAGGGCGGGCAAGTGCTCACCGACGTCACCCCCGAAGAGGGCGCCGAGGCGATCTACAAGCTACTCAAGGAAGAGGACGTGCTGCGCTGA
etf-beta (SEQ ID NO: 2):
MRPEQQQKQQKPGIDVAVLVSIGRHPTTGRARRAEQDARGLELALAMEAELPGSRIDVLHAGSQDVDSEAALRSYLGMATGVGMGLESMTLLEQPDGSDAILPLVEHLAATSPQLVITGARAERGEGSGLLPYALAEHLGWPLVNSLASIETVENGVITLLQALPRGQRRRLKVRLPAIISVDEAAPAARQSAFGPARRASFSVAPTTSEADSELAQWHLSPARKRPKRLKIIKAASARDRFKAAASKAEGKGGQVLTDVTPEEGAEAIYKLLKEEDVLR*
primers for H1 were:
beta-H1-F:5’CGAGGCGATCTACAAGCTACT 3’(SEQ ID NO:3)
beta-H1-R:5’
AGGGTTTTCCCAGTCACGACGCCGCTATCCAGCCATTGAC 3’(SEQ ID NO:4)
primers for H2 were:
beta-H2-F:5’
AGTCGGTGCTTTTTTTGAACCCTGACCTTGGCAGCGTCCATT 3’(SEQ ID NO:5)
beta-H2-R:5’
AGTAGCTTGTAGATCGCCTCGTATGGAGACCAGCACCGCC 3’(SEQ ID NO:6)
the primer of the Donor-1 is as follows:
donor-H-F:5’GTCGTGACTGGGAAAACCCT 3’(SEQ ID NO:7)
donor-H-R:5’GGGTTCAAAAAAAGCACCGACT 3’(SEQ ID NO:8)
and (3) PCR reaction conditions:
pre-denaturation at 95 ℃ for 5 minutes; then denaturation at 95 ℃ for 30 seconds, annealing at 58 ℃ for 30 seconds, extension at 72 ℃ for 30 seconds, and 30 cycles; then, the mixture was stretched at 72 ℃ for 10 minutes.
PCR reaction system (50. mu.L system):
when the PCR amplification system is prepared, DNA polymerase is added finally.
Obtaining a 504bp PCR product as a homology arm H1 of a target gene etf-beta; the 565bp product is the homology arm H2 of the target gene etf-beta; the 5291bp product is derived from the plasmid backbone Donor-1 of pSEVA 241. The three amplified products were then ligated using a Gibson kit (available from NEB, USA under catalog number E2611L).
Gibson ligation conditions:
the target fragments were mixed, made up to 10. mu.l with water and then treated at 50 ℃ for 1 hour according to the instructions of the Gibson kit. The Gibson ligation system (10. mu.L system) is as follows:
the ligation product was obtained and transformed into E.coli JM109 to obtain transformants, which were sequenced, sorted for correct sequencing and stored and cultured overnight in LB medium and then the plasmid was named pSEVA 241-HR.
2) Knockout of sgRNA insertion into pKObet23 plasmid
The pSEVA241-HR plasmid inserted with homology arms H1 and H2 in the previous step is used as a template, donor-G-F and donor-G-R are used as primers, and pfu enzyme is used for PCR amplification to obtain a plasmid skeleton derived from pSEVA 241-HR; then annealing and connecting the primers sgRNA-F and sgRNA-R to obtain a DNA double strand with a sticky end; the above plasmid backbone and the double strand of DNA with sticky ends were digested with BsaI and ligated to give a knock-out plasmid pKObeta 23 for the target gene etf-beta.
Amplification was performed using pSEVA241-HR with homology arms H1 and H2 as template:
donor-G-F:5’
CTAGGGTCTCAGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGT 3’(SEQ ID NO:9)
donor-G-R:5’
CTAGGGTCTCAACTAGTATTATACCTAGGACTGAGCTAGCTGT 3’
(SEQ ID NO:10)
the 6300bp PCR product was obtained, the plasmid backbone obtained was digested with restriction enzyme BsaI, and the digested fragment was recovered.
Annealing conditions of sgRNA-F and sgRNA-R primers:
pre-denaturation at 95 ℃ for 5 minutes; every 3 minutes, 10 ℃ was lowered, and finally 15 ℃ was maintained for 5 minutes.
The primer sequence is as follows:
sgRNA-F:5’TAGTTGGGCTTTTGCCCTATGCGT 3’(SEQ ID NO:11)
sgRNA-R:5’AAACACGCATAGGGCAAAAGCCCA 3’(SEQ ID NO:12)
annealing system (10 μ L):
sgRNA-F 5μL
sgRNA-R 5μL
the final concentration of the primers was 10 pM.
The obtained plasmid skeleton after enzyme digestion and the annealed DNA double strand are connected by T4DNA ligase, transformed into Escherichia coli JM109, and the grown recombinant colony is sequenced, and is preserved with correct sequencing, and a plasmid is extracted, wherein the plasmid is a knock-out plasmid pKObeta 23 for knocking out the target gene etf-beta.
3) And deletion of etf-beta gene in halomonas TD01
Firstly, plasmid pQ08 expressing Cas9 protein is transferred into Halomonas TD01 (the transfer process is shown in Qin, Qin, et al, "CRISPR/Cas9 edition genome of exotrophylon Halomonas spp." Metabolic Engineering (2018):219-229.), the plasmid contains Cas9 protein from Streptococcus pyogenes, and the strain is stored in university of Qinghua.
The pseudomonas halodurans TD01 containing the Cas9 protein is used as a recipient bacterium, E.coli S17-1 carrying plasmid pKObet23 is used as a donor bacterium to carry out conjugation transformation, and a single clone is screened on a plate containing a spectinomycin resistant (100mg/ml) LB60 solid culture medium (15 g/L of agar powder is additionally added into the formula of an LB60 liquid culture medium, the mixture is autoclaved at 121 ℃ for 20min, and the plate is poured after being cooled). Colony PCR amplification is carried out by using tag enzyme by using a monoclonal genome as a template and using Test-beta-F and Test-beta-R as primers.
The primers are as follows:
Test-beta-F:5’GGGTGTGGCAGATTGAAGCT 3’(SEQ ID NO:13)
Test-beta-R:5’GTGCCGCTAAGAACGTTGTT 3’(SEQ ID NO:14)
colony PCR reaction conditions:
pre-denaturation at 95 ℃ for 5 minutes; then denaturation at 95 ℃ for 30 seconds, annealing at 58 ℃ for 30 seconds, extension at 72 ℃ for 30 seconds, and 30 cycles; then, the mixture was stretched at 72 ℃ for 10 minutes.
PCR reaction system (50. mu.L system):
after the PCR amplification system is prepared and subpackaged, single colony is picked in by a toothpick. The colony with the amplified band size of 1338bp is a knockout type, the colony with the amplified band size of 2069bp is a wild type (see figure 1), and finally the etf-beta gene knockout type of TD01 is obtained and is named as Halomonas bluephagene TD delta beta.
Secondly, the influence of acetic acid on P3HB synthesized by recombinant bacteria TD delta beta
To examine the ability of TD Δ β to synthesize P3HB, we performed shake flask experiments with TD01 and TD Δ β; firstly, respectively picking single colonies into 20mL LB60 culture medium, and culturing at 37 ℃ overnight at 200 rpm; then, the cells were inoculated at 5% inoculum size (v/v) into 50mL of MM60 medium (pH8.5-9.0, NaCl concentration 60g/L), glucose concentration was set at 30g/L, and acetic acid was used to set a concentration gradient: 0g/L, 1g/L, 2g/L, 3g/L, 4g/L, 5g/L, 6g/L, 7g/L, 8g/L, 9g/L, 12 g/L. Culturing at 37 ℃ and 200rpm, shaking for 48 hours to obtain a bacterial solution, centrifuging, washing with water, and drying by ice to obtain the dry cell weight of the sample, and detecting the content percentage (%) of P3HB in the dry cell weight by gas chromatography. Three sets of parallels were set for each condition. The dry cell weight and P3HB content are shown in Table 6.
TABLE 6 Effect of acetic acid addition on Halomonas TD01 and TD. DELTA.beta
From the data of table 6 we can conclude that: etf-beta is knocked out from halomonas TD01 to obtain TD delta beta, and the halomonas TD delta beta can synthesize P3HB with a content which is obviously higher than that of TD01 under the same condition. Similarly to the results obtained by adding acetic acid in TD01 culture, adding acetic acid in a certain concentration range to the culture medium of halomonas TD Δ β can also increase the cell dry weight of the microorganism and the content of P3HB accumulated in the cells, wherein after adding 3g/L of acetic acid, the content of P3HB of TD Δ β accounts for 94% of the cell dry weight, which is the highest content reported in the world so far.
The results of this experiment show that by deleting etf- β, in combination with the addition of acetic acid, the specific gravity of P3HB in the cells can be increased up to 94% and the cell volume also increased (see fig. 2).
Thirdly, constructing engineering bacteria TD delta alpha and testing the influence of acetic acid on the synthesis of P3HB by the recombinant bacteria
The etf-alpha subunit of the etf gene in Halomonas bluephagenetics TD01 was knocked out to construct the engineered bacterium Halomonas bluephagenetics TD delta alpha, operating as described in the first part of example 2, and experiments and analyses were performed as described in the second part of example 2 to determine the effect of acetic acid addition on the synthesis of P3 HB.
etf-alpha subunit is represented by the nucleotide sequence (SEQ ID NO: 15):
ATGAGTGAAATTATTCGCCGCGACCCACGTCGTGAGTGGATCGCCCGAAACCGTCTGCACCCCGACAACGCCGCGGTGCTGGCCGCTCTTGGTGTAAACAGGGGCGGCGGAGCGGTCAGCGAATGGGTGGGGCCCAACGGCGTGGTGCGTAAGAATCCTCGCGCTATTGGCTTTATCGGCCCCAATGGCGTTAAACGAATTGATCGTAGCGGCCTCCAGCAAGGAGGGCATTCCAGCGCGGCAACCGCCGTGGCTAGCGATAGCCGCCGTACAGTGACTATTGATCAGCCCGCTTTTCTAGTGGCCGGGGTACCTGACCTGATCGGTGGACGCCTTTCTAGCCATGATAAGGATCTGCTGGGACTAGCCAGACGCGTGGCGGATGCCGACGCCGAACAGCCAGGCGCCGTGGTGGCGATCCTGTTTGGTGAGCATAAAGGCGAGTGGGGCGGCGAGCTTAAGAAGCAAGCGCTGGGCGAAGCTGGGATTGATCGCGTCGTACATCTTGATGATGAGCTTTACGCTGGGTTTGCTCCCGAGGCACGGTTAGCGGTGTTAAGTGCCGTCGAACGGGAGATGACGCCGCGTTTCTGGCTGTTGCCGGATTCACCCCTAGGCGGAGCTGATCTGGGGCGGCGGCTTGCCTTACGCCTGGGTGAACGCGCTGCTACAGGGGTGTGGCAGATTGAAGCTGACGATGAGGCACCTCTGGGCTGGCAGTGCACTGCCCGTGGCGCCGCTGGAAGTTTGGATATCCAGCGCCCTCTGCCACGGGTTGCCCTGGCGTTGGCCGAGTGCGCCGAACCGGTGGACGAGACCCGACATGCGGCCGAACACCTGACCTTGGCAGCGTCCATTCCCACCACTCTATCGCGCATTGAAGATCTGGGTCAGGTGGCGGTGGATCCCGCTGGCGTGGCGTTGGCCGAGGCTGAGTTCATCCTCTCTGGTGGCAATGGTGTTAAACAGTGGGACGCCTTCCATCATGCCGCGAAAGTACTGGGCGCTACCGAAGGGGCCTCGCGTGTTGCGGTAGACGACGGCTTTATGGCCCGCGACCGGCAGGTAGGCGCGACCGGTACCTGGGTAACCGCCCGAGTCTATATGGCGGTGGGGATTTCAGGCGCTATCCAGCACCTGCAGGGCATTCAGCGCTGCGACAAGGTGGTGGCCATCAATCTCGATCCGGGGTGCGACATGATCgAACGCGCAGACCTGGCGGTGATAGGCGACAGCACGCAAATTCTTGCTGCGTTAGTGGCGATGGTGGAACAGCAGCGAGGAGGGCAGCGCGATGCGGCCTGA
etf-alpha subunit is of amino acid sequence (SEQ ID NO: 16):
MSEIIRRDPRREWIARNRLHPDNAAVLAALGVNRGGGAVSEWVGPNGVVRKNPRAIGFIGPNGVKRIDRSGLQQGGHSSAATAVASDSRRTVTIDQPAFLVAGVPDLIGGRLSSHDKDLLGLARRVADADAEQPGAVVAILFGEHKGEWGGELKKQALGEAGIDRVVHLDDELYAGFAPEARLAVLSAVEREMTPRFWLLPDSPLGGADLGRRLALRLGERAATGVWQIEADDEAPLGWQCTARGAAGSLDIQRPLPRVALALAECAEPVDETRHAAEHLTLAASIPTTLSRIEDLGQVAVDPAGVALAEAEFILSGGNGVKQWDAFHHAAKVLGATEGASRVAVDDGFMARDRQVGATGTWVTARVYMAVGISGAIQHLQGIQRCDKVVAINLDPGCDMIERADLAVIGDSTQILAALVAMVEQQRGGQRDAA*
as a result, it was found that Halomonas bluephagesis TD Δ α also showed significantly increased P3HB content under the same culture conditions as compared to the original strain Halomonas bluephagesis TD01, presumably because the influence on the P3HB synthesis pathway was substantially the same because either the knockout of etf- α subunit or the knockout of etf- β subunit resulted in the inactivation of etf gene.
In addition, the addition of acetic acid within a certain concentration range can also improve the cell dry weight and the content of P3HB of the knockout strain, and the experimental result and the trend are basically consistent with Halomonas bluephagesis TD delta beta.
Example 3 control of the proportion of monomers in the copolymer by addition of acetic acid to the basal Medium
The material properties of the copolymers P3HB3HV and P3HB4HB depend to a large extent on the monomer proportions therein, in particular for P3HB3 HV. The biggest problem in producing copolymer by Halomonas bluephagene TD is that the proportion of 3HB monomer is high, and the proportion of 3HV and 4HB is low. Acetic acid is a carbon source that is less reductive than glucose, and it is considered by the inventors that acetic acid and glucose are used together to regulate the internal redox environment of the microorganism, thereby controlling the metabolic pathway of acetyl-coa. Specifically, the copolymers P3HB3HV and P3HB4HB are dimers in which the former is copolymerized from 3-hydroxybutyric acid (3HB) and 3-hydroxyvaleric acid (3HV), and the latter is copolymerized from 3-hydroxybutyric acid (3HB) and 4-hydroxybutyric acid (4 HB). 3HB is synthesized directly from acetyl-CoA by anaerobic fermentation, whereas both 3HV and 4HB are derived from precursors generated from acetyl-CoA into the TCA cycle, and therefore, a key to changing the monomer ratios in P3HB3HV and P3HB4HB is to control the metabolic pathway of acetyl-CoA. This experiment demonstrates that by varying the amount of acetic acid added within the appropriate range, the ratio of monomers in the copolymers P3HB3HV and P3HB4HB can also be adjusted.
Firstly, the content of 3HV in P3HB3HV is adjusted by changing the concentration of added acetic acid
Halomonas bluephagene TD08AB was used as a P3HB3HV synthetic strain, and the strain is described in the following documents: yin J, Wang H, Fu X Z, et al.effects of chromosomal gene copy number and location on polyhydroxyakanoate synthesis by Escherichia coli and Halomonas sp [ J ]. Applied microbiology and biotechnology 2015,99(13): 5523) 5534. in this strain, P3HB3HV can be produced using glucose as the sole carbon source.
Firstly, picking single colony in 20mL LB60 (LB containing 60g/L NaCl) culture medium, culturing at 37 ℃ and 200rpm overnight; then, the medium was inoculated at 5% (v/v) into 50mL of MM60 medium (pH8.5-9.0, NaCl concentration 60g/L), glucose concentration was set at 30g/L, and acetic acid was set at 8 concentration gradients: 0g/L, 1g/L, 2g/L, 3g/L, 4g/L, 5g/L, 6g/L, 7g/L, 8 g/L. Culturing at 37 deg.C and 200rpm for 48 hr, centrifuging, washing with water, and lyophilizing to obtain cell dry weight, and detecting the polymer content (%) by gas chromatography. Three sets of parallels were set for each condition. The dry cell weight, P3HB3HV content, and 3HV ratio are shown in Table 7.
TABLE 7 Synthesis of P3HB3HV at different acetic acid concentrations by Halomonas bluephagene TD08AB
From the data of table 7 we can conclude that: the monomer ratio of the copolymer P3HB3HV can be changed by adding 1g/L, 2g/L, 3g/L, 4g/L, 5g/L, 6g/L, 7g/L and 8g/L of acetic acid, particularly after 1g/L and 2g/L of acetic acid are added, the monomer ratio of 3HV is improved by nearly one time compared with the result when no acetic acid is added, and the promotion effect on the improvement of the material performance is very obvious. Furthermore, the results also show that the addition of 1-8g/L acetic acid results in an increase in cell dry weight, resulting in a significant increase in the final P3HB3HV yield as compared to no addition (data not shown).
Secondly, the content of 4HB in P3HB4HB is controlled by changing the concentration of added acetic acid
Halomonas bluephagene TD Δ gabD2-D2 was used as P3HB4HB synthetic strain, and the strain is described in the following documents: ye J, Hu D, Che X, et al. engineering of halonas bluepharmacologesis for low cost production of poly (3-hydroxybutyric-co-4-hydroxybutanoate) from glucose [ J ] Metabolic engineering,2018,47: 143. in this strain, P3HB4HB can be produced using glucose as a single carbon source, and this strain is maintained at the university of Qinghua, and is publicly available at the university of Qinghua.
Firstly, picking single colony in 20mL LB60 (LB containing 60g/L NaCl) culture medium, culturing at 37 ℃ and 200rpm overnight; then, the medium was inoculated at 5% (v/v) into 50mL of MM60 medium (pH8.5-9.0, NaCl concentration 60g/L), glucose concentration was fixed at 30g/L, and acetic acid was set at 9 concentration gradients: 0g/L, 1g/L, 2g/L, 3g/L, 4g/L, 5g/L, 6g/L, 7g/L, 8 g/L. Culturing at 37 deg.C and 200rpm for 48 hr, centrifuging, washing with water, and lyophilizing to obtain cell dry weight, and detecting the polymer content (%) by gas chromatography. Three sets of parallels were set for each condition. The dry cell weight, P3HB4HB content, and 4HB ratio are shown in Table 8.
TABLE 8 Synthesis of P3HB4HB by Halomonas bluephagene TD. DELTA. gabD2-D2 at different acetic acid concentrations
The experimental results show that the cell content and the yield of the copolymer P3HB4HB can be improved by adding acetic acid, compared with a control group without adding acetic acid (the cell dry weight: 8.79 +/-0.07 g/L; the content of P3HB4 HB: 66.89 +/-0.37%), the cell dry weight and the content of P3HB4HB are improved within the range of adding 1g/L-8g/L of acetic acid, wherein the yield improvement effect under the condition of adding 6g/L of acetic acid is most remarkable, the cell dry weight is measured to be 9.11 +/-0.28 g/L, and the content of P3HB4HB is measured to be 69.91 +/-1.93%. Furthermore, from the data of table 8 we can also conclude that: the monomer proportion of the copolymer P3HB4HB can be changed by adding acetic acid, and particularly after 4g/L of acetic acid is added, the 3HV monomer proportion is increased by more than 50%, so that the improvement of the material performance is remarkably promoted.
The two groups of experiments prove that the invention can really adjust the internal environment of microbial cells and control the metabolic flow of acetyl coenzyme A entering 3HV and 4HB by adding a proper amount of acetic acid in a basic culture medium, thereby changing the proportion of each monomer in the polymer synthesized by the microbes. In a specific embodiment, the proportion of 3HV monomer in P3HB3HV polymer can be significantly increased (from 4% to 8%) by adjusting the concentration of acetic acid added; the proportion of 4HB monomer in the P3HB4HB polymer can also be increased significantly (from 7.8% to 12%).
Sequence listing
<110> Qinghua university
<120> an improved method for producing polyhydroxyalkanoate
<130> CGCNL181110W
<160> 16
<170> SIPOSequenceListing 1.0
<210> 1
<211> 843
<212> DNA
<213> Halomonas bluephagenesis TD01
<400> 1
atgcggcctg aacaacagca aaaacaacaa aagccgggta tcgacgtggc ggtgctggtc 60
tccataggcc gtcaccccac aaccggtcgt gcgaggcgcg ccgagcagga tgcacggggt 120
ctggaacttg ctctagccat ggaagcagaa ctgccgggta gccggattga cgtactgcac 180
gctggttctc aggatgtcga cagcgaggca gctctgcgca gttacttggg tatggccaca 240
ggcgttggta tggggcttga gtctatgacc ttgctggagc agcccgatgg cagcgatgcc 300
attctaccgc tggtggaaca tttagccgct acctcgcccc aactagtgat caccggtgcc 360
cgggccgagc gcggagaagg ttctgggctt ttgccctatg cgttggctga gcatctcggt 420
tggccgttag tgaatagctt ggcgtcgata gagacagtgg agaatggtgt gataacgctg 480
cttcaagcgt tgccacgggg ccagcgtcgc cgtctcaagg tgcgcttgcc cgccatcatc 540
agcgtggatg aagcagcgcc ggcggcgcgt cagagcgcct tcggcccggc tcgccgagcc 600
agcttctcgg tggcgcccac tacctctgaa gccgacagtg agttggccca gtggcacttg 660
agccccgcac gtaaacggcc taagcgtctg aaaatcatta aagccgcctc agccagagat 720
cgtttcaaag cggcggcttc caaagccgag ggcaagggcg ggcaagtgct caccgacgtc 780
acccccgaag agggcgccga ggcgatctac aagctactca aggaagagga cgtgctgcgc 840
tga 871
<210> 2
<211> 280
<212> PRT
<213> Halomonas bluephagenesis TD01
<400> 2
Met Arg Pro Glu Gln Gln Gln Lys Gln Gln Lys Pro Gly Ile Asp Val
1 5 10 15
Ala Val Leu Val Ser Ile Gly Arg His Pro Thr Thr Gly Arg Ala Arg
20 25 30
Arg Ala Glu Gln Asp Ala Arg Gly Leu Glu Leu Ala Leu Ala Met Glu
35 40 45
Ala Glu Leu Pro Gly Ser Arg Ile Asp Val Leu His Ala Gly Ser Gln
50 55 60
Asp Val Asp Ser Glu Ala Ala Leu Arg Ser Tyr Leu Gly Met Ala Thr
65 70 75 80
Gly Val Gly Met Gly Leu Glu Ser Met Thr Leu Leu Glu Gln Pro Asp
85 90 95
Gly Ser Asp Ala Ile Leu Pro Leu Val Glu His Leu Ala Ala Thr Ser
100 105 110
Pro Gln Leu Val Ile Thr Gly Ala Arg Ala Glu Arg Gly Glu Gly Ser
115 120 125
Gly Leu Leu Pro Tyr Ala Leu Ala Glu His Leu Gly Trp Pro Leu Val
130 135 140
Asn Ser Leu Ala Ser Ile Glu Thr Val Glu Asn Gly Val Ile Thr Leu
145 150 155 160
Leu Gln Ala Leu Pro Arg Gly Gln Arg Arg Arg Leu Lys Val Arg Leu
165 170 175
Pro Ala Ile Ile Ser Val Asp Glu Ala Ala Pro Ala Ala Arg Gln Ser
180 185 190
Ala Phe Gly Pro Ala Arg Arg Ala Ser Phe Ser Val Ala Pro Thr Thr
195 200 205
Ser Glu Ala Asp Ser Glu Leu Ala Gln Trp His Leu Ser Pro Ala Arg
210 215 220
Lys Arg Pro Lys Arg Leu Lys Ile Ile Lys Ala Ala Ser Ala Arg Asp
225 230 235 240
Arg Phe Lys Ala Ala Ala Ser Lys Ala Glu Gly Lys Gly Gly Gln Val
245 250 255
Leu Thr Asp Val Thr Pro Glu Glu Gly Ala Glu Ala Ile Tyr Lys Leu
260 265 270
Leu Lys Glu Glu Asp Val Leu Arg
275 280
<210> 3
<211> 21
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 3
cgaggcgatc tacaagctac t 21
<210> 4
<211> 40
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 4
agggttttcc cagtcacgac gccgctatcc agccattgac 40
<210> 5
<211> 42
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 5
agtcggtgct ttttttgaac cctgaccttg gcagcgtcca tt 42
<210> 6
<211> 40
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 6
agtagcttgt agatcgcctc gtatggagac cagcaccgcc 40
<210> 7
<211> 20
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 7
gtcgtgactg ggaaaaccct 20
<210> 8
<211> 22
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 8
gggttcaaaa aaagcaccga ct 22
<210> 9
<211> 50
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 9
ctagggtctc agttttagag ctagaaatag caagttaaaa taaggctagt 50
<210> 10
<211> 43
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 10
ctagggtctc aactagtatt atacctagga ctgagctagc tgt 43
<210> 11
<211> 24
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 11
tagttgggct tttgccctat gcgt 24
<210> 12
<211> 24
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 12
aaacacgcat agggcaaaag ccca 24
<210> 13
<211> 20
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 13
gggtgtggca gattgaagct 20
<210> 14
<211> 20
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 14
gtgccgctaa gaacgttgtt 20
<210> 15
<211> 1305
<212> DNA
<213> Halomonas bluephagenesis TD01
<400> 15
atgagtgaaa ttattcgccg cgacccacgt cgtgagtgga tcgcccgaaa ccgtctgcac 60
cccgacaacg ccgcggtgct ggccgctctt ggtgtaaaca ggggcggcgg agcggtcagc 120
gaatgggtgg ggcccaacgg cgtggtgcgt aagaatcctc gcgctattgg ctttatcggc 180
cccaatggcg ttaaacgaat tgatcgtagc ggcctccagc aaggagggca ttccagcgcg 240
gcaaccgccg tggctagcga tagccgccgt acagtgacta ttgatcagcc cgcttttcta 300
gtggccgggg tacctgacct gatcggtgga cgcctttcta gccatgataa ggatctgctg 360
ggactagcca gacgcgtggc ggatgccgac gccgaacagc caggcgccgt ggtggcgatc 420
ctgtttggtg agcataaagg cgagtggggc ggcgagctta agaagcaagc gctgggcgaa 480
gctgggattg atcgcgtcgt acatcttgat gatgagcttt acgctgggtt tgctcccgag 540
gcacggttag cggtgttaag tgccgtcgaa cgggagatga cgccgcgttt ctggctgttg 600
ccggattcac ccctaggcgg agctgatctg gggcggcggc ttgccttacg cctgggtgaa 660
cgcgctgcta caggggtgtg gcagattgaa gctgacgatg aggcacctct gggctggcag 720
tgcactgccc gtggcgccgc tggaagtttg gatatccagc gccctctgcc acgggttgcc 780
ctggcgttgg ccgagtgcgc cgaaccggtg gacgagaccc gacatgcggc cgaacacctg 840
accttggcag cgtccattcc caccactcta tcgcgcattg aagatctggg tcaggtggcg 900
gtggatcccg ctggcgtggc gttggccgag gctgagttca tcctctctgg tggcaatggt 960
gttaaacagt gggacgcctt ccatcatgcc gcgaaagtac tgggcgctac cgaaggggcc 1020
tcgcgtgttg cggtagacga cggctttatg gcccgcgacc ggcaggtagg cgcgaccggt 1080
acctgggtaa ccgcccgagt ctatatggcg gtggggattt caggcgctat ccagcacctg 1140
cagggcattc agcgctgcga caaggtggtg gccatcaatc tcgatccggg gtgcgacatg 1200
atcgaacgcg cagacctggc ggtgataggc gacagcacgc aaattcttgc tgcgttagtg 1260
gcgatggtgg aacagcagcg aggagggcag cgcgatgcgg cctga 1305
<210> 16
<211> 434
<212> PRT
<213> Halomonas bluephagenesis TD01
<400> 16
Met Ser Glu Ile Ile Arg Arg Asp Pro Arg Arg Glu Trp Ile Ala Arg
1 5 10 15
Asn Arg Leu His Pro Asp Asn Ala Ala Val Leu Ala Ala Leu Gly Val
20 25 30
Asn Arg Gly Gly Gly Ala Val Ser Glu Trp Val Gly Pro Asn Gly Val
35 40 45
Val Arg Lys Asn Pro Arg Ala Ile Gly Phe Ile Gly Pro Asn Gly Val
50 55 60
Lys Arg Ile Asp Arg Ser Gly Leu Gln Gln Gly Gly His Ser Ser Ala
65 70 75 80
Ala Thr Ala Val Ala Ser Asp Ser Arg Arg Thr Val Thr Ile Asp Gln
85 90 95
Pro Ala Phe Leu Val Ala Gly Val Pro Asp Leu Ile Gly Gly Arg Leu
100 105 110
Ser Ser His Asp Lys Asp Leu Leu Gly Leu Ala Arg Arg Val Ala Asp
115 120 125
Ala Asp Ala Glu Gln Pro Gly Ala Val Val Ala Ile Leu Phe Gly Glu
130 135 140
His Lys Gly Glu Trp Gly Gly Glu Leu Lys Lys Gln Ala Leu Gly Glu
145 150 155 160
Ala Gly Ile Asp Arg Val Val His Leu Asp Asp Glu Leu Tyr Ala Gly
165 170 175
Phe Ala Pro Glu Ala Arg Leu Ala Val Leu Ser Ala Val Glu Arg Glu
180 185 190
Met Thr Pro Arg Phe Trp Leu Leu Pro Asp Ser Pro Leu Gly Gly Ala
195 200 205
Asp Leu Gly Arg Arg Leu Ala Leu Arg Leu Gly Glu Arg Ala Ala Thr
210 215 220
Gly Val Trp Gln Ile Glu Ala Asp Asp Glu Ala Pro Leu Gly Trp Gln
225 230 235 240
Cys Thr Ala Arg Gly Ala Ala Gly Ser Leu Asp Ile Gln Arg Pro Leu
245 250 255
Pro Arg Val Ala Leu Ala Leu Ala Glu Cys Ala Glu Pro Val Asp Glu
260 265 270
Thr Arg His Ala Ala Glu His Leu Thr Leu Ala Ala Ser Ile Pro Thr
275 280 285
Thr Leu Ser Arg Ile Glu Asp Leu Gly Gln Val Ala Val Asp Pro Ala
290 295 300
Gly Val Ala Leu Ala Glu Ala Glu Phe Ile Leu Ser Gly Gly Asn Gly
305 310 315 320
Val Lys Gln Trp Asp Ala Phe His His Ala Ala Lys Val Leu Gly Ala
325 330 335
Thr Glu Gly Ala Ser Arg Val Ala Val Asp Asp Gly Phe Met Ala Arg
340 345 350
Asp Arg Gln Val Gly Ala Thr Gly Thr Trp Val Thr Ala Arg Val Tyr
355 360 365
Met Ala Val Gly Ile Ser Gly Ala Ile Gln His Leu Gln Gly Ile Gln
370 375 380
Arg Cys Asp Lys Val Val Ala Ile Asn Leu Asp Pro Gly Cys Asp Met
385 390 395 400
Ile Glu Arg Ala Asp Leu Ala Val Ile Gly Asp Ser Thr Gln Ile Leu
405 410 415
Ala Ala Leu Val Ala Met Val Glu Gln Gln Arg Gly Gly Gln Arg Asp
420 425 430
Ala Ala
Claims (10)
1. An improved microbial production method of Polyhydroxyalkanoates (PHAs), comprising adding acetic acid, acetate, or acetate to a basal medium comprising a carbon source for microbial synthesis of PHAs, wherein the microorganism is Halomonas, wherein the concentration of the added acetic acid, acetate, or acetate is 1-8g/L, and the carbon source is glucose, gluconic acid, gluconate, or a combination thereof.
2. The method of claim 1, wherein the microorganism is Halomonas campeniensis or Halomonas bluephasegenetics or a combination thereof.
3. The method of claim 2, wherein the microorganism is selected from one or more of the following:
Halomonas bluephagenesis TD01;
Halomonas bluephagenesis TD08AB;
Halomonas bluephagenesis TD△gabD2-D2;
halomonas bluephagene TD. beta.; and
Halomonas bluephagenesis TDΔα,
wherein Halomonas bluephagene TD delta beta is obtained by knocking out etf-beta subunit by using Halomonas bluephagene TD01 as an original strain; halomonas bluephagene TD delta alpha is obtained by etf-alpha subunit knockout of Halomonas bluephagene TD01 as an original strain.
4. The method of claim 1, wherein the microorganism is a recombinant bacterium obtained by knocking out or inactivating the etf gene in Halomonas.
5. The method of claim 4, wherein the microorganism is a recombinant bacterium obtained by knocking out either or both of etf-alpha subunit and etf-beta subunit of etf gene.
6. The method of claim 1, wherein the carbon source is added at a concentration of 1-100 g/L.
7. The method of claim 1, wherein the PHA is a homopolymeric PHA or a copolymeric PHA.
8. The method of claim 7, wherein the microorganism is Halomonas bluephagenesis TD01, Halomonas bluephagenesis TD Δ α, or Halomonas bluephagenesis TD Δ β, and the PHA is poly-3-hydroxybutyrate (P3 HB).
9. The method of claim 7, wherein the microorganism is Halomonas bluephaigenesis TD08AB and the PHA is poly (3-hydroxybutyrate-co-3-hydroxyvalerate) (P3HB3HV), or the microorganism is Halomonas bluephaigenesis TD Δ gabD2-D2 and the PHA is poly (3-hydroxybutyrate-co-4-hydroxybutyrate) (P3HB4 HB).
10. A method of reducing pyruvate accumulated during microbial production of Polyhydroxyalkanoate (PHA), the method comprising adding acetic acid, acetate, or acetate to a basal medium comprising a carbon source for microbial synthesis of PHA, wherein the microorganism is Halomonas (Halomonas), wherein the concentration of acetic acid, acetate, or acetate added is 1-8g/L, and the carbon source is glucose, gluconic acid, gluconate, or a combination thereof.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201810971946.0A CN110857449B (en) | 2018-08-24 | 2018-08-24 | Improved method for producing polyhydroxyalkanoate |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201810971946.0A CN110857449B (en) | 2018-08-24 | 2018-08-24 | Improved method for producing polyhydroxyalkanoate |
Publications (2)
Publication Number | Publication Date |
---|---|
CN110857449A CN110857449A (en) | 2020-03-03 |
CN110857449B true CN110857449B (en) | 2021-12-14 |
Family
ID=69636162
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810971946.0A Active CN110857449B (en) | 2018-08-24 | 2018-08-24 | Improved method for producing polyhydroxyalkanoate |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN110857449B (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111593006B (en) * | 2020-06-03 | 2021-10-26 | 北京微构工场生物技术有限公司 | Self-flocculating halophilic bacteria and application thereof |
CN113088475B (en) * | 2021-05-25 | 2022-05-17 | 北京化工大学 | Vibrio salina and application thereof |
CN113564193B (en) * | 2021-09-27 | 2022-03-11 | 清华大学 | Microorganism gene expression fate community and construction method and application thereof |
CN117143899B (en) * | 2023-10-24 | 2024-01-30 | 珠海麦得发生物科技股份有限公司 | Bacterial strain for synthesizing P34HB3HP, construction method and application thereof |
CN117363554B (en) * | 2023-12-08 | 2024-04-09 | 清华大学 | Engineered halophilic microorganism and construction method and application thereof |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101323864A (en) * | 2007-06-12 | 2008-12-17 | 同济大学 | Method for synthesizing poly(hydroxyalkanoate) |
WO2011069244A1 (en) * | 2009-12-07 | 2011-06-16 | Queen's University At Kingston | Medium chain length polyhydroxyalkanoate polymer and method of making same |
CN105821084A (en) * | 2015-01-28 | 2016-08-03 | 赢创德固赛有限公司 | Aerobic method of producing alcohols |
-
2018
- 2018-08-24 CN CN201810971946.0A patent/CN110857449B/en active Active
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101323864A (en) * | 2007-06-12 | 2008-12-17 | 同济大学 | Method for synthesizing poly(hydroxyalkanoate) |
WO2011069244A1 (en) * | 2009-12-07 | 2011-06-16 | Queen's University At Kingston | Medium chain length polyhydroxyalkanoate polymer and method of making same |
CN105821084A (en) * | 2015-01-28 | 2016-08-03 | 赢创德固赛有限公司 | Aerobic method of producing alcohols |
Non-Patent Citations (3)
Title |
---|
Diverse protein regulations on PHA formation in Ralstonia eutropha on short chain organic acids;Sung-Eun Lee等;《International Journal of Biological Sciences》;20090223;第5卷(第3期);第215-225页 * |
electron transfer flavoprotein subunit beta [Halomonas sp. TD01];GenBank;《NCBI》;20130527;WP_009724032.1 * |
Fed-batch production of poly-3-hydroxydecanoate from decanoic acid;Jie Gao等;《Journal of Biotechnology》;20151212;第218卷;第102-107页 * |
Also Published As
Publication number | Publication date |
---|---|
CN110857449A (en) | 2020-03-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN110857449B (en) | Improved method for producing polyhydroxyalkanoate | |
Chen et al. | Chromosome engineering of the TCA cycle in Halomonas bluephagenesis for production of copolymers of 3-hydroxybutyrate and 3-hydroxyvalerate (PHBV) | |
JP6085023B2 (en) | Novel D-lactic acid producing strain and use thereof | |
JP3062459B2 (en) | Polyester synthase gene and method for producing polyester | |
CN113583922B (en) | Method for producing PHA (polyhydroxyalkanoate) by culturing halophilic bacteria in low-salt culture medium | |
DK2803722T3 (en) | Corynebacterium microorganisms capable of utilizing xylose, and method for producing L-lysine using the same | |
US8877466B2 (en) | Bacterial cells having a glyoxylate shunt for the manufacture of succinic acid | |
CN110079489B (en) | Recombinant halomonas and method for producing P (3HB-co-4HB) by using same | |
EP2204443B1 (en) | Bacterial cells exhibiting formate dehydrogenase activity for the manufacture of suc-cinic acid | |
EP2910641B1 (en) | High molecular weight pha-producing microbe and method of producing high molecular weight pha using same | |
WO2017209103A1 (en) | Method for producing α-hydromuconic acid | |
RU2668830C2 (en) | Corynebacterium genus microorganism for producing l-lysine and method for producing l-lysine by using same | |
CN110904018A (en) | 5-aminolevulinic acid production strain and construction method and application thereof | |
CN113249238B (en) | Acid-resistant saccharomyces cerevisiae and application thereof in preparation of organic acid | |
CN116970659B (en) | Method for producing polyhydroxyalkanoate | |
US20210324427A1 (en) | Genetically modified bacterium for producing lactate from co2 | |
KR102311152B1 (en) | Production of poly(3HB-co-3HP) from methane by metabolic engineered methanotrophs | |
CN111148839B (en) | Production of polyhydroxybutyrate in wood-Yangdali microorganisms | |
WO2018233703A1 (en) | Gene cassette for fine control of composition ratio of 4-hydroxybutanoic acid in copolymer and application thereof | |
CN110295188A (en) | A method of improving lactic acid constituent content in poly- (3-hydroxybutyrate-co- lactic acid) of Escherichia coli synthesis | |
Zamakhaeva et al. | Methylotrophic producers of bioplastics | |
CN117363554B (en) | Engineered halophilic microorganism and construction method and application thereof | |
Lee et al. | Effect of the Supplement of Metabolites on Cell Growth and Poly-$\beta $-hydroxybutyrate Biosynthesis of Alcaligenes latus | |
KR102331270B1 (en) | Transformed microorganism producing polyhydroxyalkanoate | |
CN112410274B (en) | Genetic engineering bacterium for producing ascomycin and preparation method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |