CN109970854A - Hybridoma cell strain AntiTput-13 and its AntiTput-DP10 monoclonal antibody of secretion - Google Patents
Hybridoma cell strain AntiTput-13 and its AntiTput-DP10 monoclonal antibody of secretion Download PDFInfo
- Publication number
- CN109970854A CN109970854A CN201910280947.5A CN201910280947A CN109970854A CN 109970854 A CN109970854 A CN 109970854A CN 201910280947 A CN201910280947 A CN 201910280947A CN 109970854 A CN109970854 A CN 109970854A
- Authority
- CN
- China
- Prior art keywords
- antitput
- monoclonal antibody
- der
- tyrophagus putrescentiae
- strain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to the relevant genetic engineering fields of dust mite allergen, disclose a strain of hybridoma strain AntiTput-13, the monoclonal antibody of the anti-tyrophagus putrescentiae allergen Der p10 of secretion that can be stable, the bacterial strain is preserved in China Committee for Culture Collection of Microorganisms's common micro-organisms center, deposit number is CGMCC No.16298, preservation address are as follows: BeiChen West Road, Chaoyang District, BeiJing City institute number, Institute of Microorganism, Academia Sinica.Test proves that specific reaction can occur for monoclonal antibody antiTPUT-DP10 secreted by the hybridoma cell strain and tyrophagus putrescentiae allergen Der p10.Based on the hybridoma secrete monoclonal antibody, the double sandwich-ELISA method of detection tyrophagus putrescentiae is established, the diagnostic method for precisely detecting the dust mites such as tyrophagus putrescentiae for environment such as house, storage, fields lays the foundation.
Description
Technical field
The invention belongs to the relevant genetic engineering fields of dust mite allergen, and in particular to a strain of hybridoma strain and its point
The monoclonal antibody for the anti-tyrophagus putrescentiae allergen Der p10 albumen secreted.
Background technique
Tyrophagus putrescentiae (Tyrophagus putrescentiae) belongs to Arachnoidea (Arachinida), Acari
(Acari), Acariformes (Acariformes) flour mite suborder (Acaridida) is universal storage harmful mite, Ji Zhufan
It encloses extensively, is also widely present in human lives and working environment.Its mite body and metabolin, excreta etc. all have stronger allergen
Property, the type Ⅰ allergies disease such as allergic asthma, dermatitis, allergic rhinitis can be caused, be the member of dust mite, dermatophagoides pteronyssinus
One of.Research shows that about 50% or more type Ⅰ hypersensitivity Disease is caused by dust mite, population in the world sum 10~
20% pair of dust mite allergy.Voorhort in 1964 etc. has found that mite has been in room dirt since main allergen, it has been discovered that dust mite
Allergen is there are about 20 kinds, and there are the cross reactivities of height for dust mite and dermatophagoides pteronyssinus, and most dust mite patients are dermatophagoides pteronyssinus
With the common sensitization of dust mite.Wherein, the first component allergen Der p1 of dermatophagoides pteronyssinus is primarily present in dermatophagoides pteronyssinus excreta, the
2 component allergen Der p2 are primarily present in mite body, and Der p1 and Der p2 are the masters of 80% or more dermatophagoides pteronyssinus autopath
Want Allergen.The 1st group of allergic effect stock blend Der f1 of dust mite and the 2nd group of allergic effect stock blend Der f2 is main sensitization group
Point.Der f1 and Der p1 can induce cross reaction, and Der f2 and Der p2 almost intersect.The 10th class of dermatophagoides pteronyssinus becomes
Though answering the not main Allergen of former Der p10, the main allergic protein of cross reaction prompts Der p10 to can be used as room
There are the monitoring Allergens of cross reaction with other allergens for dust mite.Research also shows that it is systemic that Der p10 is that one kind causes
The important allergen of severe allergic reaction.Der p10 is compared with Der f10, there was only 3 amino acid differences, sequence in complete sequence
Column consistency is widely present in dust mite muscle and nonmuscle cells up to 98.5%, and there are the conclusion of cross reaction is true for they
It is fixed.
Der p10 protein structure and the tropomyosin in invertebrate are closely similar, such as shrimp, lobster, crab, roach
Dung beetle and other mollusks.Der p10 is because of its extensive cross reactivity feature, except being positive in acarid autopath, and
It also plays a significant role in the cross allergy of cockroach, Shrimp waste and shellfish food.In the inhibition test of cross reaction, dust mite
Immersion liquid is strong inhibiting factor, shows that dust mite is main source in the allergen of sensitization.Therefore, Der p10 is by wide
General concern, but as the tropomyosin Der p10 of dust mite, there are no detailed reports.
Antibody is biological and extremely wide medical domain purposes protein molecule.Monoclonal antibody is since immune B is thin
Born of the same parents merge what the hybridoma to be formed generated with myeloma cell, which not only there is oncocyte constantly to divide
Ability, and the ability with immunocyte generation antibody.Since monoclonal antibody is specific antibody, high specificity, therefore
It is used widely.Test strips or ELISA kit etc. can be made for carrying out dust mite in environment in allergen monoclonal antibody
The detection of allergen or the quantity that mite population is speculated according to the amount of allergen in detection environment.It can be with so filtering out one plant
The hybridoma cell strain of the specific antibody of anti-Der p10 albumen is secreted, and the monoclonal antibody identified secreted by it is known
Other Der p10 protein-specific B cell epitope polypeptide has positive effect to the diagnosis and prevention of Der p10 allergen, and
Development for Der p10 diagnostic kit lays the foundation.
Summary of the invention
One of the object of the invention is to provide the hybridoma of one plant of secretion Der p10 allergen protein monoclonal antibody
Strain;
The second object of the present invention is to providing a kind of monoclonal antibody antiTPUT- as secreted by above-mentioned hybridoma cell strain
With Der p10 albumen specific reaction can occur for DP10, monoclonal antibody antiTPUT-DP10;
Its sequence are as follows:
MNHKVHHHHHHMEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELD
QVQENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESERMRKMLEHRSI
TDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEE
KAQQREEAYEQQIRIMTSKLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY
Above-mentioned purpose of the present invention is achieved through the following technical solutions:
The present invention extracts tyrophagus putrescentiae total serum IgE using TRIZOL method, and tropomyosin gene (Der p10) is cloned in reverse transcription
CDNA, which is inserted into prokaryotic expression carrier pCzn1, Der p10 gene is carried out using pCzn1 prokaryotic expression carrier former
Nuclear expression regard the Der p10 of expressed inclusion bodies out as immunogene after HIS label affinity purification, SPF is immunized
BALB/c mouse takes its splenocyte to merge with SP2/0 myeloma cell.In addition, the present invention also utilizes Bacillus coli expression
System carries out prokaryotic expression to Der p10 gene, carries out inclusion body purification to the Der p10 albumen of expressed inclusion bodies
It is used as detection antigen afterwards, establishes indirect ELISA detection method and positive hybridoma cell is screened, it is final to obtain one plant surely
Surely the hybridoma cell strain of anti-Der p10 protein monoclonal antibody is secreted, microbial preservation number is: CGMCC 16298, life
Entitled AntiTput-13, classification naming are: secreting the hybridoma cell strain of anti-Der p10 allergen monoclonal antibody;When preservation
Between: on September 13rd, 2018;Depositary institution is: China General Microbiological culture presevation administrative center;Preservation address is: Beijing
The institute of microbiology, the Chinese Academy of Sciences, institute of Chaoyang District North Star West Road 1.
The present invention also provides a kind of monoclonal antibodies as secreted by above-mentioned hybridoma cell strain, are named as
AntiTput-DP10, Western-blot testing result show that monoclonal antibody AntiTput-DP10 can be with Der p10 albumen
Specific reaction occurs, it is anti-that ELISA testing result shows that specificity occurs for monoclonal antibody AntiTput-DP10 and Der p10
It answers.
In one embodiment of the invention, with tyrophagus putrescentiae more resist for coated antibody, antibody label after monoclonal
Antibody A ntiTput-DP10 is enzyme labelled antibody, establishes the double-antibody sandwich engineering method of detection tyrophagus putrescentiae, the dual anti-folder established with this
Tyrophagus putrescentiae in the environment such as heart method detection detection house, storage, field, has practical application value.
Detailed description of the invention
Attached drawing is used to provide further understanding of the present invention, and constitutes part of specification, with reality of the invention
It applies example to be used to explain the present invention together, not be construed as limiting the invention.In the accompanying drawings:
Fig. 1 recombinates pCzn1-TM-T plasmid enzyme restriction as a result, wherein M:DNA Marker;1: plasmid before digestion;2: after digestion
Plasmid;
Fig. 2 is to recombinate the SDS-PAGE analysis of pCzn1-TM-T albumen as a result, wherein M: standard protein Marker;1:
Product before pCzn1-TM-T is induced;Product after 2:pCzn1-TM-T induction;3:pCzn1-TM-T purified product.
Fig. 3 is that SDS-PAGE is analyzed after purification for monoclonal antibody AntiTput-DP10, wherein 1: standard protein
Marker;2: monoclonal antibody antiTPUT-DP10 heavy chain and light chain.
Fig. 4 is for application Western blot testing inspection monoclonal antibody antiTPUT-DP10 and Der p10 albumen WB
Analysis, wherein 1: product after acarid cracking precipitating;M: standard protein Marker.
Specific embodiment
Hereinafter, preferred embodiments of the present invention will be described with reference to the accompanying drawings, it should be understood that preferred reality described herein
Apply example only for the purpose of illustrating and explaining the present invention and is not intended to limit the present invention.
Main experimental materials and source
1, cell, dust mite and serum
SP2/0 murine myeloma cell, HGPRT missing;Immunoglobulin is not generated and passes through detection of mycoplasma, by this
Laboratory saves, and tyrophagus putrescentiae is raised in this laboratory population.Tyrophagus putrescentiae is positive, negative serum is prepared by laboratory, passes through
ELISA experiment is detected as negative and positive.
2, main agents and drug
Fetal calf serum, DMEM culture medium are purchased from GIBCO company;Diaminobenzidine (DAB) colour reagent box, horseradish peroxide
The goat anti-mouse IgG antibodies of compound enzyme (HRP) label, FITC label sheep anti-mouse igg antibody, plastic recovery kit are purchased from Bei Jingkang
For century Biotechnology Co., Ltd;50%PEG, 50 × HAT, 50 × HT are purchased from Sigma company;O-phenylenediamine, pre-dyed albumen
Marker is purchased from Fermentas company;SBA ClonotypingTM System/HRP Subclass of antibody identification kit is purchased from
Southern Biotechnology company;Plasmid extraction kit is purchased from AXYGEN company, T-E1, reverse transcriptase, Ex Taq
Archaeal dna polymerase, T4DNA ligase, HIS label purified reagent are purchased from Dalian treasured biotech firm.
3, experimental animal
BALB/c outbred mice is provided by this experimental animal of Changchun hundred million.Production licence: SCXK (Jilin) 2016-
0003
4, test equipment
The surgical instrument of sterilizing: three scissors, three tweezers, a cell sieve, syringe inner core, a plate
Wet box, 2 500mL beakers, 2 50mL centrifuge tubes, 3 15mL centrifuge tubes.
5, culture medium
IMDM culture medium, fetal calf serum are purchased from HyCLone company, are configured to IMDM complete medium (containing 15% serum);
PEG1500 is purchased from Roche, article No.: 78364;HAT culture solution, HT culture solution are purchased from Sigma, and article No. is respectively H0262-
10VL and H0137-10VL.Hybridoma supematant ELISA detection: coating buffer: sodium carbonate-bicarbonate buffer, pH9.6;0.1M
PBS buffer solution pH7.4;Confining liquid: 2% skim milk;Washing lotion: PBST (0.05% tween, PBS);Developing solution soluble T MB;
Terminate liquid: 2M sulfuric acid.
The prokaryotic expression of 1 Der p10 albumen of embodiment and purifying
1. design of primers
It (is logged according to tropomyosin (tropomyosin) gene order of tyrophagus putrescentiae listed in Genbank
Number: AAT40866.1), PCR amplification primer is designed, sequence is as follows: 5 '-ATGAATCACAAAGTGCATCATCATC of upstream primer
ATCATCATGGC- 3 ', 5 '-CCG of downstream primerTCTAGATTAATAACCGGTCAGTTCGGCAAA-3 ', underscore are digestion position
Point.
2. the extraction and reverse transcription of tyrophagus putrescentiae total serum IgE
Total serum IgE is extracted from tyrophagus putrescentiae using Trizol method as template, carries out reverse transcription synthesis with random primer
cDNA。
Trizol method extracts RNA step: picking tyrophagus putrescentiae adult mite 30 under microscope, and it is mixed that 0.5mL Trizol is added
It is even, it is stored at room temperature 5min, 0.1mL chloroform is added, firmly shakes 15s, is incubated at room temperature 2-3min, 12000g, 4 DEG C of centrifugation 15min,
It is careful to take out upper layer colourless liquid, the isopropanol being pre-chilled in equal volume is added, be incubated at room temperature after mixing 10min, 12000g, 4 DEG C from
Heart 10min, abandons supernatant, and the ethyl alcohol (DEPC water is prepared) of 0.5mL75%, 15s, 7500g, 4 DEG C of centrifugations of gently shaking are added in precipitating
5min, careful to abandon supernatant to the greatest extent, precipitating is air-dried at room temperature 3-5min, and the dissolution of 20-30 μ L DEPC water, -20 DEG C of preservations are added.
Reverse transcription synthesis cDNA is carried out with the total serum IgE of extraction, system is as follows:
In reaction process, first by template ribonucleic acid solution and random primer in 95 DEG C of incubation 10min, the cooling 5min of ice bath, then
Remaining reagent is added, mixes, is placed at room temperature for 10min, 42 DEG C of incubations 60min cool down 2min in ice.
3.Der p10 gene magnification and purifying
The cDNA obtained using reverse transcription, using designed PCR amplification primer, expands Der p10 gene as template.
PCR reaction system (50 μ L) is as follows:
Reaction condition is 95 DEG C of initial denaturation 5min;95 DEG C of denaturation 30s, 55 DEG C of annealing 30s, 72 DEG C of extension 3min, 30 are followed
Ring;72 DEG C of extension 10min.Whole pcr amplification products are carried out agarose gel electrophoresis by the recycling of PCR product glue, and in ultraviolet lamp
Under cut the blob of viscose containing target gene, recycle PCR according to the precious biological Co., Ltd's plastic recovery kit specification in Dalian later
The Der p10 gene amplified.
The building of 4.Der p10 albumen pronucleus expression recombinant vector
Der p10 gene and prokaryotic expression carrier pCzn1 that glue recycles are attached respectively, linked system
Are as follows:
Condition of contact: 16 DEG C of connections are overnight.
5. converting and choosing bacterium
Connection product obtained in 4 is all transferred in Ecoli BL21 competent cell, ice bath 30min, 42 DEG C later
Water-bath thermostimulation 90s, then rapid ice bath 2min.250 μ L LB liquid mediums are added in Xiang Guanzhong, shake culture in 37 DEG C of shaking tables
100 μ L bacterium solutions are coated on the LB plate containing ampicillin (100 μ g/mL), 37 DEG C of overnight incubations by 1h.From plate with
Machine picking single bacterium colony is inoculated into 3mL LB (Amp respectively+, 100 μ g/mL) and 37 DEG C of shaken cultivations in fluid nutrient medium.
6. the PCR identification and sequencing of recombinant plasmid
1) the small amount plasmid extraction agent box for utilizing AXYGEN company is cultivated from 5 according to kit specification operation
Plasmid is extracted in bacterium solution, and extracted plasmid is subjected to PCR identification and is sequenced.
2) PCR identification is carried out to doubtful recombinant plasmid
PCR reaction system (50 μ L) is as follows:
Reaction condition is 95 DEG C of initial denaturation 5min;95 DEG C of denaturation 30s, 55 DEG C of annealing 30s, 72 DEG C of extension 3min, 30 are followed
Ring;72 DEG C of extension 10min.
Plasmid (as shown in Figure 1) Jing Guo the PCR result positive is delivered into Nanjing Qing Ke Bioisystech Co., Ltd and carries out sequence
Column measurement, will identify that correct recombinant plasmid is named as pCzn1-TM-T by sequencing.
The prokaryotic expression of 7.Der p10 gene and purifying
Recombinant plasmid pCzn1-TM-T is transformed into prokaryotic expression BL21 competent cell according to 5 method for transformation,
It then takes out 100 μ L bacterium solutions to be coated on the LB plate containing ampicillin (100 μ g/mL), 37 DEG C of overnight incubations, picking LB
White colony on plating medium is inoculated in 3mL and contains in the LB liquid medium of ampicillin (100 μ g/mL) 37 DEG C
Overnight incubation.Induced expression concrete operations are as follows: 1mL recombinant bacterium bacterium solution being taken to be added to 37 DEG C of concussions in the LB culture medium of 100mL
Cultivating to OD600nm is about 0.6-0.8 (about 2h);Add IPTG to final concentration of 1mmol/L, 37 DEG C of induction 4h.By expression product
SDS-PAGE electrophoresis is carried out, is purified by the affinity chromatography method of HIS label, expression and purification result are shown in Fig. 2.Affine layer
Analysis method is as follows:
1, it will be centrifuged by the bacterium solution of IPTG induction, 7000rpm, 10min.Somatic cells are collected, are rinsed twice with PBS,
The bacterium solution ultrasonication that will be gathered, until clarification, 13000rpm are centrifuged 10min, take precipitating.The loading used with purifying again
Buffer rinses one time, is finally resuspended with sample-loading buffer, 13000rpm, is centrifuged 10min, supernatant is taken, with 0.45 μm of filter mistake
Filter.
2, chromatographic column is added after mixing filler, is stored at room temperature 10 minutes, after gel and solution layering, going out for bottom
Liquid mouth is opened, and ethyl alcohol is allowed slowly to flow out by gravity.
3, supernatant is loaded into upper prop, flow velocity is 10 times of column volume/hours, and collection flows through liquid.Use 15 times of column volumes
Binding Buffer rinses pillar, washes away foreign protein.It is eluted using 5mlElution Buffer, collects eluting peak.It will purifying
Product carries out SDS-PAGE electrophoresis detection afterwards.
The preparation of 2 monoclonal antibody of embodiment
1. mouse immune
It is small with 46 week old female SPF BALB/c females of recombination Der p10 protein immunization of the prokaryotic expression of affinity purification
Mouse is immunized 3 times, each immunization interval two weeks altogether, and immunizing dose is 30 μ g/, and immunization route is peritoneal immunity.
Respectively two exempt from three exempt from it is latter week to mouse carry out eye socket blood sampling, separation serum (4 DEG C, 10000rpm,
20min), antibody level is detected with indirect ELISA, it is best to the results are shown in Table 1, No. 3 Mouse titers, and cell fusion selects No. 3 mouse.
3 days before cell fusion, booster immunization, every mouse peritoneal note are carried out again to No. 3 SPF BALB/c mouses of good immune effect
Penetrate 50 μ g immunizing antigens.
Indirect ELISA method: with recombination Der p10 proteantigen after purification, 2ug/ml, the hole 100uL/, 4 DEG C were coated with
Night;It is washed 3 times with washing lotion afterwards;The closing of 2% skimmed milk confining liquid, the hole 200uL/, 37 DEG C of incubators, 2h;It is washed 3 times with washing lotion afterwards;
Serum 2 times of gradient dilutions since 200 times, blank control (blank) are PBS, and negative control (negative) is negative serum
200 times of dilutions.It is the hole 100uL/, 37 DEG C of incubators, 1h;It is washed 3 times with washing lotion afterwards;The secondary antibody that PBS dilutes 20000 times is added
(sheep anti-mouse igg of HRP label), the hole 100uL/, 37 DEG C of incubators, 1h;It is washed 3 times after taking-up with washing lotion;Colour developing, developing solution
The hole 100uL/, developing time 5min;Every hole is added 50uL terminate liquid and terminates;OD value is surveyed at 450nm, record saves data.
Table 1 recombinates Der p10 protein ELISA potency result
2. cell fusion
First 1 day preparation feeder cells are merged, SPF BALB/c mouse peritoneal macrophage is conventionally taken to spread 96
It is stand-by in porocyte culture plates.Disconnected neck puts to death the mouse of spleen to be taken, sterile to take spleen and separating Morr. cell, by splenocyte and SP2/0
The ratio of myeloma cell 3:1 carries out cell fusion with PEG, and fused cell is laid on ready feeder cells.
3. screening and the clone of positive hybridoma cell strain
It is thin that indirect ELISA detection method screening positive hybridoma is established using prokaryotic expression Der p10 albumen after purification
Born of the same parents' strain expands culture to the hybridoma of reacting positive, while carrying out the Ya Ke of positive hybridoma cell with limiting dilution assay
It is grand, it is at least subcloned 3 times, the positive hybridoma cell being subcloned is frozen in time.Final one plant of acquisition can be with stably excreting
The hybridoma cell strain of anti-Der p10 allergen protein monoclonal antibody, and the monoclonal antibody secreted is named as
AntiTput-13。
4. the ascites preparation and purification of monoclonal antibody
To 10 week old or so healthy SPF BALB/c mouse be injected intraperitoneally incomplete Freund's adjuvant, 0.5mL/ only, after 1 week
Intraperitoneal injection 1 × 106A hybridoma extracts ascites when mouse web portion extreme expansion after 7~10d, taken out every 2d it is primary, will
The ascites 10000r/min of extraction is centrifuged 10min, removes upper layer grease and precipitating, and supernatant packing is stored in -20 DEG C.
Mouse ascites antibody uses G-protein affinity purification.Method is as follows: filler being loaded into chromatographic column, with caching liquid
Ascites is diluted about 5 times by (20mM PBS, 300mM NaCl, pH7.4-8.5), and upper prop is purified.After loading, equalizing and buffering is used
Liquid (20mM PBS, 300mM NaCl, pH7.4-8.5) removes the unbonded part of albumen;Then elution buffer (0.1M is added
Sodium citrate, pH4.0), binding protein is eluted, finally carries out PH with neutralization buffer (1M tris-HCl, pH9.0)
Value adjustment, antibody concentration and purity are shown in Table 2.Antibody after purification carries out SDS-PAGE detection, as a result sees Fig. 3.
Table 2: AntiTput-13 purity, concentration and potency after purification
The identification of 3 monoclonal antibody of embodiment
1. the subgroup identification of monoclonal antibody
According to SBA ClonotypingTMSystem-HRP (Southern Biotech) Subclass of antibody identification kit behaviour
It explains book and subgroup identification is carried out to the obtained monoclonal antibody of embodiment 2.
The heavy chain of monoclonal antibody AntiTput-DP10 of the present invention is IgG1 as the result is shown, and light chain is Kappa chain, identification
It the results are shown in Table 3.
3 monoclonal cell subgroup identification of table
2.Western blot qualification test
SDS-PAGE electrophoresis is carried out after centrifugation processing after 5 tyrophagus putrescentiae adult mite polypide pestles are ground, then through electricity
By on protein delivery to nitrocellulose filter, it is 18V voltage 30min that electricity, which turns condition, for transfer, will be turned with 5% skimmed milk power confining liquid
4 DEG C of nitrocellulose filter closings after print are overnight;Monoclonal antibody supernatant is added and is incubated at room temperature 1h, (is spat containing 0.5mL/L with PBST
The PBS buffer solution of the pH7.4 of temperature -20) it washs three times, then the mountain with 4000 times of diluted horseradish peroxidases (HRP) labels
Sheep anti-mouse igg antibody is incubated at room temperature 1h, after PBST is washed 3 times, is developed the color with DAB colour reagent box, scanning record.
Test result confirms that monoclonal antibody AntiTput-DP10 prepared by the present invention can occur with tyrophagus putrescentiae
Specific reaction, and do not react with (oyster cap fungus mycelia) is compareed, as a result see Fig. 4, thus it is speculated that AntiTput-13 was identified
Der p10 protein B cell epitope is a linear epitope.
Embodiment 4 establishes detection dust mite mistake using tyrophagus putrescentiae allergen Der p10 monoclonal antibody AntiTput-DP10
The sandwich ELISA method in quick source
Double antibody sandwich method, the antigen or antibody for being usually incorporated in surface of solid phase carriers still keep its immunologic competence,
The antigen or antibody of enzyme label had not only retained its immunologic competence, but also retained the activity of enzyme.By inspection sample and surface of solid phase carriers
Antigen or antibody react.Make other objects in the antigen antibody complex and liquid that are formed on solid phase carrier with the method for washing
Matter separates.The antigen or antibody of enzyme label is added, is also integrated on solid phase carrier by reaction.After the substrate of enzyme reaction is added,
Substrate becomes color products by enzymatic, and the amount of product is directly related with the amount of tested substance in sample, according to the depth of colour generation
Carry out qualitative or quantitative analysis.The catalytic efficiency of enzyme is very high, be exaggerated indirectly immune response as a result, reaching measuring method
Very high susceptibility.This research prepares the positive polyvalent antibody of tyrophagus putrescentiae, as coated antibody;Monoclonal antibody
AntiTput-DP10 marks horseradish peroxidase as colour developing antibody, and detectable substance is doubtful tyrophagus putrescentiae culture.This method
Can using with mushroom acarid hazard detection, have very strong practicability.
1, the determination of standard Der p10 albumen difference dilution standard curve
A. the determination of antibody working concentration: coated antibody (the positive polyvalent antibody of tyrophagus putrescentiae) and enzyme mark are marked anti-
Body (monoclonal antibody AntiTput-DP10) carries out gradient dilution, determines its working concentration using Checkerboard titration method, experiment shows
Coated antibody concentration is 100 μ g/ml, and when enzyme labelled antibody dilution 1:2000, effect is best, and the positive is than negative value highest.
The determination of B double antibody sandwich method operating procedure
1, be coated with: positive No. I of tyrophagus putrescentiae and coating buffer are diluted to 100 holes μ g/ml, 100ul/, 37 DEG C of insulating box 1.5h,
Board-washing machine cleans 1 time.
2 closings: 10% skimmed milk+3%BSA is closed, every hole 250ul, and board-washing machine cleans 4 times for 24 hours for 4 DEG C of closings.
3 sample 100ul are diluted using coating buffer (1% skimmed milk), and 37 DEG C of insulating box 1.5h board-washing machines clean 3 times.
4 secondary antibody 1:2000 dilute 100 μ l, PBS (1% skimmed milk), 37 DEG C of 1h, and board-washing machine cleans 2 times.
5 colour developings: 100 μ l room temperature 3min of TMB.50 μ l of 2M H2SO4 terminate liquid.
Sequence table
<110>Jiangsu Province Agriculture Science Institute
<120>hybridoma cell strain AntiTput-13 and its AntiTput-DP10 monoclonal antibody of secretion
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 295
<212> PRT
<213>artificial sequence (Artificial Sequence)
<400> 1
Met Asn His Lys Val His His His His His His Met Glu Ala Ile Lys
1 5 10 15
Lys Lys Met Gln Ala Met Lys Leu Glu Lys Asp Asn Ala Ile Asp Arg
20 25 30
Ala Glu Ile Ala Glu Gln Lys Ala Arg Asp Ala Asn Leu Lys Ser Glu
35 40 45
Lys Thr Glu Glu Glu Val Arg Ala Leu Gln Lys Lys Ile Gln Gln Ile
50 55 60
Glu Asn Glu Leu Asp Gln Val Gln Glu Asn Leu Thr Gln Ala Thr Thr
65 70 75 80
Lys Leu Glu Glu Lys Glu Lys Ala Leu Gln Thr Ala Glu Ala Asp Val
85 90 95
Ala Ala Leu Asn Arg Arg Ile Gln Leu Ile Glu Glu Asp Leu Glu Arg
100 105 110
Ser Glu Glu Arg Leu Lys Val Ala Thr Ala Lys Leu Glu Glu Ala Ser
115 120 125
His Ser Ala Asp Glu Ser Glu Arg Met Arg Lys Met Leu Glu His Arg
130 135 140
Ser Ile Thr Asp Glu Glu Arg Met Asp Gly Leu Glu Ser Gln Leu Lys
145 150 155 160
Glu Ala Arg Leu Met Ala Glu Asp Ala Asp Arg Lys Tyr Asp Glu Val
165 170 175
Ala Arg Lys Leu Ala Met Val Glu Ala Asp Leu Glu Arg Ala Glu Glu
180 185 190
Arg Ala Glu Thr Gly Glu Ser Lys Ile Val Glu Leu Glu Glu Glu Leu
195 200 205
Arg Val Val Gly Asn Asn Leu Lys Ser Leu Glu Val Ser Glu Glu Lys
210 215 220
Ala Gln Gln Arg Glu Glu Ala Tyr Glu Gln Gln Ile Arg Ile Met Thr
225 230 235 240
Ser Lys Leu Lys Glu Ala Glu Ala Arg Ala Glu Phe Ala Glu Arg Ser
245 250 255
Val Gln Lys Leu Gln Lys Glu Val Asp Arg Leu Glu Asp Glu Leu Val
260 265 270
His Glu Lys Glu Lys Tyr Glu Ser Ile Ser Asp Glu Leu Asp Gln Thr
275 280 285
Phe Ala Glu Leu Thr Gly Tyr
290 295
Claims (3)
1. a strain of hybridoma strain AntiTput-13, the monoclonal of the anti-tyrophagus putrescentiae allergen Der p10 of secretion that can be stable
Antibody, the bacterial strain are preserved in China Committee for Culture Collection of Microorganisms's common micro-organisms center, deposit number CGMCC
No.16298, preservation address are as follows: BeiChen West Road, Chaoyang District, BeiJing City institute number, Institute of Microorganism, Academia Sinica.
2. a kind of monoclonal antibody antiTPUT-DP10 of anti-tyrophagus putrescentiae allergen Der p10, which is characterized in that by right
It is required that hybridoma cell strain AntiTput-13 described in 1 secretes, sequence is as shown in SEQ ID NO:1.
3. the monoclonal antibody antiTPUT-DP10 of anti-tyrophagus putrescentiae allergen Der p10 described in claim 2 is preparing environment
The reagent of middle tyrophagus putrescentiae Der p10 diagnosis or the purposes in detection kit.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201910280947.5A CN109970854B (en) | 2019-04-09 | 2019-04-09 | Tyrophagus putrescentiae Der p10 monoclonal antibody and preparation method and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201910280947.5A CN109970854B (en) | 2019-04-09 | 2019-04-09 | Tyrophagus putrescentiae Der p10 monoclonal antibody and preparation method and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN109970854A true CN109970854A (en) | 2019-07-05 |
CN109970854B CN109970854B (en) | 2022-10-11 |
Family
ID=67083661
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201910280947.5A Active CN109970854B (en) | 2019-04-09 | 2019-04-09 | Tyrophagus putrescentiae Der p10 monoclonal antibody and preparation method and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN109970854B (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106350522A (en) * | 2016-11-02 | 2017-01-25 | 崔玉宝 | Gene cloning and expression purification for recently found allergen of tyrophagus putrescentiae and application thereof |
CN109134638A (en) * | 2018-10-10 | 2019-01-04 | 无锡市人民医院 | A kind of 22 gene recombinant protein of house dust mite allergen Der p and its application |
-
2019
- 2019-04-09 CN CN201910280947.5A patent/CN109970854B/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106350522A (en) * | 2016-11-02 | 2017-01-25 | 崔玉宝 | Gene cloning and expression purification for recently found allergen of tyrophagus putrescentiae and application thereof |
CN109134638A (en) * | 2018-10-10 | 2019-01-04 | 无锡市人民医院 | A kind of 22 gene recombinant protein of house dust mite allergen Der p and its application |
Non-Patent Citations (1)
Title |
---|
李启松等: "粉尘螨变应原第5组分单克隆抗体的制备与鉴定", 《现代免疫学》, no. 01, 31 January 2018 (2018-01-31), pages 8 - 12 * |
Also Published As
Publication number | Publication date |
---|---|
CN109970854B (en) | 2022-10-11 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN102659923B (en) | Epitope minimal motif peptides of human zona pellucida protein-4 and extended short peptides and application thereof | |
JPS60222429A (en) | Synthesis of protein by maker peptide | |
CN103992988B (en) | A kind of monoclonal antibody of the anti-canine distemper disease viral N proteins of hybridoma cell strain and generation thereof | |
CN106188281B (en) | The preparation and application of anti-norovirus GII.4 type source of mouse monoclonal antibody | |
CN105198990B (en) | Antibody and the preparation method and application thereof for the detection of Bt Cry1 toxoid wide spectrums | |
CN112940087A (en) | Common epitope peptide of SARS-CoV and SARS-CoV-2 and its application | |
CN106188282B (en) | The preparation and application of anti-norovirus GI.1 type source of mouse monoclonal antibody | |
Logan et al. | Epitope mapping of the alpha-toxin of Clostridium perfringens | |
CN109678945A (en) | A kind of preparation method of serum amyloid A protein epitope, its prediction and verification method and monoclonal antibody | |
JPH05505943A (en) | Collagen binding protein and its production method | |
CN109970854A (en) | Hybridoma cell strain AntiTput-13 and its AntiTput-DP10 monoclonal antibody of secretion | |
Stäger et al. | Giardia lamblia variant surface protein H7 stimulates a heterogeneous repertoire of antibodies displaying differential cytological effects on the parasite | |
CN104812773B (en) | Epitope tag antibody, hybridoma cell strain with and application thereof | |
KR100982064B1 (en) | Monoclonal antibody and diagnostic method of malaria parasites | |
CN110272494A (en) | The application of TIM-3 antigen, nano antibody and its screening and identification method, nano antibody | |
CN102690351A (en) | Preparation method of plasmodium vivax aldolase protein monoclonal antibody | |
Tzartos | Monoclonal antibodies as probes of the acetylcholine receptor and myasthenia gravis | |
CN108586611A (en) | Recombinate full humanized anti-spasmotoxin monoclone antibody | |
CN107916254A (en) | Homer1 monoclonal antibodies and its application | |
CN110117325B (en) | Pig CD127 polypeptide and encoding gene and application thereof | |
CN108047330B (en) | Monoclonal antibody of Cry2Ah1 protein | |
Kouguchi et al. | Characterization of various recombinant antigens from Echinococcus multilocularis for use in the immunodiagnosis | |
CN106543285B (en) | Anti- Ttyh1 monoclonal antibodies and its application | |
CN109182364A (en) | A kind of polyclonal antibody and its preparation method and application of specific recognition albumin A | |
CN104292333A (en) | Mouse anti-human PRRT2 monoclonal antibody, and preparation method and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |