CN108822210B

CN108822210B - Chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 protein and application

Info

Publication number: CN108822210B
Application number: CN201810691316.8A
Authority: CN
Inventors: 叶恭银; 杨蕾; 王嘉乐; 金虹霞; 方琦
Original assignee: Zhejiang University ZJU
Current assignee: Zhejiang University ZJU
Priority date: 2018-06-28
Filing date: 2018-06-28
Publication date: 2020-04-17
Anticipated expiration: 2038-06-28
Also published as: CN108822210A

Abstract

The invention discloses a pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24, which has the amino acid sequence shown in SEQ ID NO: 2, or a pharmaceutically acceptable salt thereof. The invention also discloses a gene for coding the pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24, which has the nucleotide sequence shown in SEQ ID NO: 1 at positions 70-231. The inhibitor can be used for inhibiting the activation of the cabbage butterfly or the butterfly mandarin orange haemolymph PPO. The invention also discloses a method for improving the prevention of lepidopteran pests by cruciferous vegetables, which comprises the following steps of: 1, and then culturing the transformed cruciferous vegetable cells into plants.

Description

Chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 protein and application

Technical Field

The present invention relates to the fields of molecular biology, genetic engineering and protein engineering. In particular to a Kazal-type serine protease inhibitor protein PpSPI24 expressed in pteromalus puparum venom, a coded nucleic acid sequence and application thereof.

Background

The pests are a serious threat to the safe production of global crops, the yield of the global crops is reduced by about 1/4 every year, and the economic loss is huge. In China, agricultural pests are also important restriction factors which always restrict agricultural yield increase and quality improvement of agricultural products, and statistics show that the national pest and disease occurrence area in 2014 is about 55 hundred million mu/time. The grain loss recovered by preventing and controlling plant diseases and insect pests accounts for 15-20% of the total yield every year, and even so, the grain loss can still reach 300-500 billion jin every year.

Since the introduction of chemical pesticide DDT, pest control has been mainly dependent on chemical pesticides, with the consequences of pest resurgence, pest resistance to drugs, pesticide poisoning, excessive pesticide residue, and serious pollution. People are always exploring and searching for a new effective, safe and low-toxicity pest control method, and with the emergence of transgenic technology, a new idea is provided to solve the pest problem. Since the middle of the 90 s of the 20 th century, the cultivation and application of insect-resistant transgenic crops are successful, and a new machine for effectively controlling pests appears. Statistically, the global transgenic planting area has increased dramatically from about 170 million hectares in 1996 to 1.8 million hectares in 2014 (where the insect-resistant accounts for 43%), with obvious economic and ecological effects also arising.

However, with the continued planting of only a single Bt gene resistant to insect Bt crops, the problem of resistance to the target pests has also become increasingly interesting, and this concern has shown evidence on the cotton bollworm helioera zea of Bt cotton fields. Therefore, on one hand, many scholars search and discover new Bt insect-resistant genes, and on the other hand, protein/peptide genes with insecticidal activity are mined from microorganisms, plants and animals (mainly scorpions and spiders), and novel insect-resistant transgenic plants are cultivated by means of multiple genes or fusion genes and the like, so that the problem of resistance generation of pests is delayed or overcome. Parasitic wasps, as an important biological pest control agent, are well established in the traditional biological control, and play an important role in reducing the use of chemical pesticides and environmental pollution. Parasitic wasps can utilize various parasitic factors (venoms), multi-component DNA viruses (PDVs), viroid particles (VLPs), viroid fibrils (VLFs), Ovarian Proteins (OPs), malformed cells (teratocytes) carried by the parasitic wasps to destroy host immune response, regulate host growth and development, regulate and control host hemolymph nutrient components, disturb host reproductive and endocrine systems and the like so as to ensure that progeny of the parasitic wasps normally develop in or on the blood cavity or body surface of the host. If the parasitic factors of parasitic wasps can be combined with modern biotechnology, the method is expected to be used for developing novel biocontrol agents or transgenic crops, and a new way for biological pest control is developed. For example, the secretory protein gene of the teratocyte of the hamstring scolecularis crocea (Micropliis crocipes) is successfully transferred into the tobacco, and the growth of the tobacco hornworm (Manduca sexta) is obviously slowed down, the harm degree is obviously lower than that of a non-transgenic control, and the tobacco has insect resistance. Rodriguez-Andres and the like transfer Egf1.0 protein in parasitic factor PDV of lateral-destroying swarms (Microplitis demolite) into Semliki Forest virus, can remarkably promote the increment of the virus and enhance the lethal effect of the Rodriguez-Andes aegypti on Aedes aegypti.

Disclosure of Invention

The technical problem to be solved by the invention is to provide a chrysalid pteromalid venom Kazal-type serine protease inhibitor protein PpSPI24 with an immunosuppressive effect (inhibition of hemolymph blackening) on common agricultural pests, and a coding gene and application thereof.

In order to solve the technical problems, the invention provides a pteromalus puparum venom serine protease inhibitor PpSPI24, which has the amino acid sequence shown in SEQ ID NO: 2, or a pharmaceutically acceptable salt thereof.

Remarks explanation: SEQ ID NO: 2 comprises a signal peptide.

MAKSMLIVAFLLVACMMFMHVSAFTDQDGNNCPCATTDDLRYVCGSDGVTYDNESELNCENKCKRSNIQVRFEGKC。

The improvement of the pupa pteromalus venom Kazal-type serine protease inhibitor protein PpSPI24 is as follows: is a protein, a conservative variant thereof, an active fragment thereof or an active derivative thereof.

The invention also provides a gene for coding the pteromalus puparum venom Kazal-type1 serine protease inhibitor protein PpSPI24, which has the nucleotide sequence shown in SEQ ID NO: 1 at positions 70-231; or to SEQ ID NO: 1, the nucleotide sequence from the 70 th to the 231 th nucleotide has at least 70 percent of homology; or the nucleotide sequence of the polypeptide can be matched with the nucleotide sequence shown in SEQ ID NO: 1 from nucleotide positions 70-231.

As an improvement of the gene of the present invention: the sequence of PpSPI24 contains 8-76 continuous nucleotides (namely 8-76 continuous nucleotides in the nucleotide sequence from 70 th to 231 th positions in SEQ ID NO: 1).

The invention also provides the application of the chrysalid pteromalid venom Kazal-type serine protease inhibitor protein PpSPI 24: the protein is used for preparing the pteromalus puparum venom Kazal-type serine protease inhibitor protein, and the inhibitor protein can be used for inhibiting the activation of the pieris rapae hemolymph PPO.

The invention also provides a method for improving the prevention of lepidopteran pests by cruciferous vegetables, which comprises the following steps of: 1, and then culturing the transformed cruciferous vegetable cells into plants.

The chrysalid pteromalid venom Kazal-type serine protease inhibitor protein PpSPI24 and the nucleic acid sequence coded by the same can be applied to the amino acid sequence and the coding sequence of the chrysalid pteromalid venom, and can be developed into insect-resistant crops and biological pesticides with application values and applied to multiple fields of agricultural pest control and the like.

The invention utilizes the genome sequencing of chrysalis to obtain the full-length sequence of venom Kazal-type serine protease inhibitor protein PpSPI24, and obtains the target gene through gene synthesis. After the amino acid sequence of the pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24 is obtained, the pteromalus puparum venom protein PpSPI24 is purified under a non-denaturing condition after prokaryotic expression, and the expressed PpSPI24 can inhibit the activation of a Prophenoloxidase Precursor (PPO) of the pteromalus brassicae pupae of agricultural pests, prevent the prophenoloxidase (PPO) from forming active phenol oxidase, and has the function of inhibiting the humoral immunity of a host.

The invention is realized by the following technical scheme: the DNA molecules isolated in the present invention include: the nucleotide sequence of the protein PpSPI24 with the pteromalus puparum venom Kazal-type serine protease inhibitor is coded, and the nucleotide sequence is similar to the nucleotide sequence shown in SEQ ID NO: 1, the nucleotide sequence from the 70 th to the 231 th nucleotide has at least 70 percent of homology; or the nucleotide sequence can be matched with the nucleotide sequence shown in SEQ ID NO: 1 from nucleotide positions 70-231. Preferably, the sequence encodes a polypeptide having the sequence of SEQ ID NO: 2 in sequence shown in the specification. More preferably, the sequence has the sequence shown in SEQ ID NO: 1 from nucleotide positions 70-231.

The pteromalus puparum venom serine protease inhibitor protein PpSPI24 separated by the invention comprises: has the sequence shown in SEQ ID NO: 2, or a conservative variant thereof, or an active fragment thereof, or an active derivative thereof. Preferably, the protein is a polypeptide having the sequence of SEQ ID NO: 2, or a pharmaceutically acceptable salt thereof.

The DNA molecule of the invention comprises 8-76 consecutive nucleotides in said DNA molecule.

The host cell transformed with the DNA molecule of the invention is a prokaryotic cell.

In the present invention, "isolated", "purified" DNA means that the DNA or fragment has been isolated from the sequences which flank it in the natural state, and that the DNA fragment has been separated from the components which accompany the nucleotides in the natural state, and from the proteins which accompany it in the cell.

In the present invention, the nucleic acid sequence encoded by the pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24 refers to: the nucleotide sequence of the protein with the activity of the pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24 is shown as SEQ ID NO: 1 at positions 70-231 and degenerate sequences thereof. The degenerate sequence is defined as being located in SEQ ID NO: 1 sequence coding box, nucleotide 70-231, having one or more codons substituted by degenerate codons encoding the same amino acid. Due to the degeneracy of the code, the sequence shown in SEQ ID NO: 1. degenerate sequences with nucleotide sequence homologies as low as about 70% at positions 70-231 also encode the amino acid sequence shown in SEQ ID NO: 1.

Also included are compositions that hybridize under moderately stringent conditions, more preferably under highly stringent conditions, to the nucleotide sequence of SEQ ID NO: 1 from the nucleotide sequence at positions 70-231 of the nucleotide. Also included are the sequences substantially identical to SEQ ID NO: 1 from nucleotide 70-231, preferably at least 70%, more preferably at least 80%, still more preferably at least 90%, most preferably at least 95%. Also included are SEQ ID NOs: 1 open variations of the reading frame sequence. These variants include (but are not limited to): deletion, insertion and/or substitution of several (usually 1 to 90, preferably 1 to 60, more preferably 1 to 20, most preferably 1 to 10) nucleotides, and addition of several (usually less than 60, preferably less than 30, more preferably less than 10, most preferably less than 5) nucleotides at the 5 'and/or 3' end.

In the invention, the pupa pteromalus venom Kazal-type serine protease inhibitor PpSPI24 or protein refers to: SEQ ID NO: 2, or a pharmaceutically acceptable salt thereof. The term also includes SEQ ID NO: 2 variant forms of the sequence. These variants include (but are not limited to): deletion, insertion and/or substitution of several (usually 1 to 50, preferably 1 to 30, more preferably 1 to 20, most preferably 1 to 10) amino acids, and addition of one or several (usually up to 20, preferably up to 10, more preferably up to 5) amino acids at the C-terminal and/or N-terminal. For example, in the art, substitutions with amino acids of similar or similar properties will not generally alter the function of the protein. For example, addition of one or several amino acids at the C-terminus and/or N-terminus does not generally alter the function of the protein. The term also includes active fragments and active derivatives of the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI 24.

The pupa pteromalus venom Kazal-type serine protease inhibitor PpSPI24 conservative variant protein in the invention refers to: and SEQ ID NO: 2, or a protein formed by substituting at most 10, preferably at most 8, and more preferably at most 5 amino acids with similar or similar properties.

The present invention also includes analogs of the pteromalus puparum venom Kazal-type serine protease inhibitor PpSPI24 or proteins that differ from the native Kazal-type serine protease inhibitor either by amino acid sequence differences, by modifications that do not affect the sequence, or by both.

Modified (generally without altering primary structure) forms include: chemically derivatized forms of the protein such as acetylation or carboxylation, in vivo or in vitro. Modifications also include glycosylation, such as those proteins that result from glycosylation modifications during synthesis and processing of the protein or during further processing steps. Such modification may be accomplished by exposing the protein to an enzyme that performs glycosylation, such as mammalian glycosylating or deglycosylating enzymes. Modified forms also include sequences having phosphorylated amino acid residues (e.g., phosphotyrosine, phosphoserine, phosphothreonine). Also included are proteins that have been modified to improve their proteolytic properties or to optimize their solubility properties.

In the present invention, various vectors known in the art, such as commercially available vectors, including plasmids, cosmids, and the like, can be used. When the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 protein is produced, the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 coding sequence can be operably connected with an expression regulatory sequence, so that a chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 expression vector is formed.

"operably linked" as used in the present invention refers to the situation where certain parts of a linear DNA sequence are capable of affecting the activity of other parts of the same linear DNA sequence. For example, if the signal peptide DNA is expressed as a precursor and is involved in secretion of the protein, the signal peptide (secretory leader) DNA is operably linked to the protein DNA; a promoter is operably linked to a coding sequence if it controls the transcription of that sequence; a ribosome binding site is operably linked to a coding sequence if it is placed in a position that enables translation. Generally, "operably linked" means adjacent, and for secretory leaders means adjacent in reading frame.

In the present invention the host cell is a prokaryotic cell. A commonly used prokaryotic host cell is referred to as an E.coli cell.

Northern blotting technique or fluorescent quantitative PCR can also be used to analyze the expression of gene product of Kazal-type serine protease inhibitor PpSPI24 in the venom of pteromalus puparum, i.e. to analyze the existence and quantity of RNA transcript of the Kazal-type serine protease inhibitor PpSPI24 in cells.

In addition, the nucleic acid molecules useful as probes in the present invention generally have 8 to 76 consecutive amino acids, preferably 15 to 50 consecutive nucleotides, of the nucleotide coding sequence of the pteromalus puparum venom Kazal-type serine protease inhibitor PpSPI 24. The probe can be used for detecting whether a nucleic acid molecule encoding the pteromalus puparum venom Kazal-type serine protease inhibitor PpSPI24 exists in a sample.

The invention relates to a method for detecting whether a pteromalus puparum venom Kazal-type serine protease inhibitor PpSPI24 nucleotide sequence exists in a sample, which comprises the steps of hybridizing the probe and the sample, and then detecting whether the probe is combined. Preferably, the sample is a product after PCR amplification, wherein the PCR amplification primer corresponds to the nucleotide coding sequence of Kazal-type serine protease inhibitor PpSPI24 of pteromalus puparum venom, and can be positioned at two sides or in the middle of the coding sequence. Primers are typically 15-50 nucleotides in length.

In addition, according to the nucleotide sequence and the amino acid sequence of the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24, the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 homologous gene or homologous protein can be screened on the basis of nucleic acid homology or expression protein homology.

The pteromalus puparum venom Kazal-type serine protease inhibitor PpSPI24 nucleotide full-length sequence or the fragment thereof can be obtained by a PCR amplification method, a recombination method or an artificial synthesis method. For PCR amplification, primers can be designed based on the nucleotide sequences disclosed herein, particularly open reading frame sequences, and amplified using a commercially available cDNA library or a cDNA library prepared by conventional methods known to those skilled in the art as a template to obtain the sequence.

Once the sequence of interest has been obtained, it can be obtained in large quantities by recombinant methods. This is usually done by cloning it into a vector, transferring it into a cell, and isolating the relevant sequence from the propagated host cell by conventional methods.

Furthermore, mutations can also be introduced into the protein sequences of the invention by chemical synthesis. By utilizing the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24, substances or receptors and the like with interaction of the chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 can be screened out through various conventional screening methods.

Other aspects of the invention will be apparent to those skilled in the art in view of the disclosure herein. The invention has obvious inhibition effect in the activation test of important pests of cabbage butterfly hemolymph phenol oxidase of cruciferous vegetables and has obvious inhibition effect on the humoral immunity of cabbage butterfly. The harm of agricultural pests in China is very serious, the negative effect of using chemical pesticides is great, and the chrysalid pteromalid hornet venom Kazal-type serine protease inhibitor PpSPI24 is a new protein with an immunosuppressive effect on the agricultural pests, so that the chrysalid pteromalid hornet venom PpSPI24 has a great application value.

Drawings

The following describes embodiments of the present invention in further detail with reference to the accompanying drawings.

FIG. 1 is a diagram showing the separation and purification of PpSPI24 prokaryotic expression according to the present invention;

note: m is standard protein, lane 1 is colibacillus BL21 uninduced whole protein containing pGEX-4T-2-PpSPI24 plasmid, lane 2 is supernatant after induction of colibacillus BL21 containing pGEX-4T-2-PpSPI24 plasmid, lane 3 is purified chrysalis wasp venom Kazal-type serine protease inhibitor PpSPI24 protein fused with GST tag, and lane 4 is purified GST tag protein.

FIG. 2 is a diagram showing the inhibitory effect of the prokaryotic expression pteromalus puparum venom Kazal-type serine protease inhibitor PpSPI24 gene expression on activation of pieris rapae puparum hemolymph phenol oxidase;

note: M.luteus/GST-PpSPI24 represents 0.5. mu.g of PpSPI24 protein added to M.luteus.

Negative control was TBS buffer added m.luteus; adding 0.5 mu g of tag protein GST of M.luteus; add 0.5 μ g bsa standard protein m.luteus; positive control was TBS buffer without m.luteus.

Detailed Description

The invention is further illustrated below with reference to laboratory specific test data and with reference to specific examples. These examples are intended to illustrate the invention and are not intended to limit the scope of the invention. Experimental procedures without specific conditions noted in the following examples, generally followed by conventional conditions, such as molecular cloning in Sambrook et al: the conditions described in the Laboratory Manual (New York: Cold spring harbor Laboratory Press, 1989), or according to the manufacturer's recommendations.

Example 1:

1. synthesizing chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 gene:

a gene sequence obtained according to the pteromalus puparum genome data-SEQ ID NO: 1, and using SignalP 4.1 to predict the signal peptide on line. The gene sequence is designed and synthesized into single-stranded oligo, and the synthesized oligo is spliced into a complete gene sequence by PCR. Connecting with a vector PGEM-Teasy (Promega), screening by blue white spots, picking out positive clones, and sending the positive clones to Shanghai Boshang company for sequencing inspection.

2. PpSPI24 prokaryotic expression and purification

After the obtained PpSPI24 is full-length, primers for constructing a prokaryotic expression vector are designed by using full-length ORF (signal peptide is removed):

the forward primer pGEX-4T-2-PpSPI 24-SP:

5'-GATCTGGTTCCGCGTGGATCCTTTACCGACCAGGACGGCA-3'，

the reverse primer pGEX-4T-2-PpSPI24-AP:

5'-ACGATGCGGCCGCTCGAGTCAGCATTTGCCTTCGAACC-3'。

using a gene fragment plasmid connected to a vector PGEM-T easy (Promega) as a template, and performing PCR amplification by using all gold high fidelity Pfu enzymes, wherein the PpSPI24PCR amplification system is as follows: 3min at 94 ℃, 30sec at 94 ℃, pre-denaturation 30sec at 51 ℃, annealing 30sec at 72 ℃, extension 30sec at 72 ℃, and extension 8min at 72 ℃ after 35 cycles. And after the PCR is finished, carrying out gel cutting and recovery for later use after 1% agarose gel electrophoresis verification. Extracting pGEX-4T-2 plasmid, and carrying out double enzyme digestion on the pGEX-4T-2 plasmid by using BamH I and Xhol I;

the enzyme digestion steps are as follows:

1) enzyme digestion reaction liquid:

2) and (3) after centrifugal mixing, reacting for 2h at 37 ℃, heating for 20min at 37 ℃ to inactivate the enzyme, carrying out gel cutting recovery after enzyme digestion product agarose gel electrophoresis verification, and obtaining the linear pGEX-4T-2 vector. Homologous recombination was performed using the Clonexpress Entry one Cloning Kit. The recombination steps are as follows:

homologous recombination reaction solution:

3) and the mixture is blown up and down for several times by using a pipette, the components are gently mixed and react for 30min at 37 ℃. Immediately after the reaction was completed, the reaction tube was placed in an ice bath and cooled for 5 min. The recombinant plasmid was then transformed into E.coli BL21 E.coli, and added to non-resistant LB liquid medium, cultured at 37 ℃ for 1 hour in an incubator 200r, and then 100. mu.L of the recombinant plasmid was inoculated to LB plates containing 100. mu.g/ml Amp + and cultured overnight. Picking single colony in the next dayAmp + LB liquid medium (Amp + concentration of 100 u g/ml) culture and sequencing detection expression vector success construction. And (3) selecting a single colony containing an expression plasmid (after the single colony plasmid is extracted, the sequence is verified to contain an inserted PpSPI24 sequence in the plasmid, and the plasmid externally shows that the plasmid can grow on an LB solid culture medium containing Amp +), inoculating the single colony containing the inserted PpSPI24 sequence to 5ml of LB solid culture medium (containing 100 mu g/ml Amp +), performing shake culture at 37 ℃ overnight, taking 100 mu l of the bacterial liquid to culture in a fresh 5ml of LB culture medium until the OD is 0.6-0.8 (about 2-3 h), adding 10 mu l of 500mM IPTG to the final concentration of 0.5mM, performing induced expression culture at 37 ℃ for 4-5 h, and collecting cells. Purification of GST-tag-containing fusion PpSPI24 (expressed in E.coli using pGEX-4T-2 expression vector) according to Invitrogen^TMThe instructions for the GST Spin Purification Kit were performed. The specific results of expression and purification are shown in FIG. 1.

From fig. 1, it can be seen that: plasmid Escherichia coli BL21 containing pGEX-4T-2-PpSPI24 is expressed in large amount in supernatant after induction, and the purified band is single and about 38 kDa.

3. Determination of PPSPI24 synthesized and expressed on activation inhibition of PPO of Pieris rapae and Papilio citri

Taking the cabbage butterfly pupa hemolymph from one end of the cabbage butterfly pupa hemolymph on ice into a 1.5ml precooling centrifuge tube, immediately placing the centrifuge tube on ice, centrifuging the centrifuge tube for 5 minutes at 3300g at 4 ℃, taking the supernatant into a new precooling 1.5ml centrifuge tube, removing blood cells and using the supernatant for measuring the phenol oxidase background.

The experiments were loaded as follows:

effect on PPO activation:

10 μ l TBS (containing 2 μ l of pupal hemolymph),

10 μ l TBS (2 μ l pupal hemolymph and 0.5 μ g M.luteus),

10 μ l TBS (containing 2 μ l of pupal hemolymph, 0.5 μ g BSA and 0.5 μ g M.luteus),

10 μ l TBS (containing 2 μ l of pupal hemolymph, 0.5 μ g GST and 0.5 μ g M.luteus),

10 μ l TBS (containing 2 μ l of pupal hemolymph, 1 μ l PTU and 0.5 μ g M.luteus),

10ul TBS (containing 2. mu.l of pupal hemolymph, 0.5. mu.g GST-PpSPI expressed by GST fusion and 0.5. mu.g M.luteus);

after 20min at 25 ℃ 200. mu. l L-Dopa (20mM in PBS) was added and the assay was performed once per minute at 470nm absorbance for a total of 30 min. Each sample was repeated a minimum of 3 times. The unit U of phenoloxidase activity means 0.001OD per minute₄₇₀The value of (c). Data were statistically analyzed using DPS data analysis software (both cheque and von leuton, 2007). The specific results are shown in FIG. 2. The test results prove that: the PpSPI24 protein disclosed by the invention has an inhibitory effect on the PPO activation of Pieris rapae and Papilio citrina.

Example 2

1. Construction of PpSPI24 gene plant binary expression vector

The promoter of Cauliflower mosaic virus CaMV 35S and the NOS terminator on both sides of GUS gene in a plant binary expression vector pBI121 are inserted into PpSPI24 gene to form a complete expression frame. In the experiment, BamH I and Sac I are selected as enzyme cleavage sites to replace GUS gene with PpSPI24, so that expression of PpSPI24 gene in Arabidopsis plants is controlled by using expression frames on two sides of GUS gene.

Designing primers with BamH I and Sac I enzyme cutting sites according to ORF of pteromalus puparum venom serine protease inhibitor, and performing PCR amplification by using pteromalus puparum venom gland cDNA as a template to construct a plant expression vector. The primer sequence is as follows:

PpSPI24-SP:5'-ACGCGTCGACTTTACCGACCAGGACGGCA-3'，

PpSPI24-AP:5'-CGCGGATCCTCAGCATTTGCCTTCGAACC-3'，

wherein GGATCC is a BamH I cleavage site, and GTCGAC is a Sac I cleavage site. The primers were synthesized by Shanghai Bioengineering Co.

The PCR reaction conditions and system were identical to those of example 1-2 (i.e., the forward primer and the reverse primer were replaced with "PpSPI 24-SP and PpSPI 24-AP", respectively, in the reaction system). And recovering and connecting the PCR product to a pMD18-T vector, transforming escherichia coli Trans T1 competent cells, screening Amp + resistance, and selecting clones to be sent to Shanghai Boshang company for sequencing. Extracting pMD18-PpSPI24 plasmid, carrying out double enzyme digestion on pMD18-PpSPI24 plasmid by using restriction enzymes BamH I and Sac I, cutting glue and recovering small fragments.

The pBI121 plasmid is extracted from overnight cultured bacterial liquid by using a small amount of plasmid extraction kit (Axygen), the pBI121 plasmid is subjected to double enzyme digestion by using restriction enzymes BamHI and SacI, and a large fragment is recovered by gel cutting. The digested pBI121 plasmid and pMD18-PpSPI24 plasmid are connected by T4DNA ligase at 16 ℃ overnight, transformed into escherichia coli Trans T1 competent cells, screened by Kan + resistance, and cloned pBI121-PpSPI24 (the sequence obtained by sequencing is shown as SEQ ID NO: 1) is selected and sent to Shanghai Boshang company for sequencing to verify the correctness of the inserted fragment.

2. Transformation of Agrobacterium with pBI121-PpSPI24

(1) Preparation of Agrobacterium-infected competent cells

a. Streak-culturing the EHA105 strain on a YEP solid culture medium containing 50mg/L Rif, and culturing at 28 ℃ for 24-48 h;

b. selecting monoclonal strain, and shake culturing in 5ml YEP liquid culture medium containing 50mg/L Rif at 28 deg.C for 24-48 h;

c. adding 5ml of the above bacterial solution into 100ml of YEP liquid culture medium containing 50mg/L Rif, and performing shake culture at 28 deg.C for 5-6 h until OD₆₀₀＝0.8。

d. Centrifuging at 5000rpm for 15min at 4 deg.C, and collecting cell precipitate. Adding 50ml of ice-cold sterile water, and suspending the bacterial precipitate;

e. centrifuging at 4 deg.C and 5000rpm for 15min, and repeating with 10ml ice-cold sterile water;

f. adding 10ml of precooled 10% sterile glycerol, and resuspending the precipitate;

g. centrifuging, discarding the supernatant, suspending the precipitate with 2ml of pre-cooled 10% sterile glycerol, packaging and storing at-70 ℃.

(2) Electroporation transformation of Agrobacterium

Taking out the electric shock cup, washing twice with double-distilled water, washing 1-2 times with 75% ethanol (adding 75% ethanol, and shaking twice), placing in a super clean bench, blow-drying (about 10-20 min) from the mouth inwards, covering the blow-dried electric shock cup with a cover, and placing on ice.

From a refrigerator at-70 ℃, an agrobacterium competent cell is taken and placed on ice, when the agrobacterium competent cell is melted into liquid, 2ul of plasmid pBI121-PpSPI24 is added into the competent cell in a super clean bench, the competent cell is flicked by hand, mixed evenly and placed on the ice, and then transferred to a middle gap of an electric shock cup by a pipette. And (4) turning on the electric shock instrument, wiping water outside the electric shock cup by using absorbent paper, putting the electric shock cup into the electric shock cup, and rotating the gear to be tight. The parameters of the electric shock were adjusted (1440HV, 125 Ω, 50uF), and after the electric shock was completed, the cell was placed on ice for 2-3 minutes, then 800ul of LB medium was gently added to the electric shock cup, gently blown down several times with a pipette, and then transferred to an EP tube.

The plate was incubated at 28 ℃ for 48 hours, centrifuged at 4000rpm for 5 minutes, and then plated with Kan + antibiotics. The colonies that grew out were streaked on another plate and then grown for another 24 hours, and then verified by PCR, since Agrobacterium contained a low copy number of plasmid and the number of PCR cycles was set to 40 cycles.

3. Agrobacterium transformation of Arabidopsis thaliana

Transformation of Arabidopsis thaliana was performed by the pollen tube channel method (Clough and Bent 1998). The specific process is as follows:

a single colony of Agrobacterium containing pBI121-PpSPI24 on LB solid medium was picked up, cultured overnight in 4ml LB liquid medium, and expanded at a ratio of 1: 500. OD of bacterial liquid₆₀₀When the absorption value reaches 0.6-1.0, centrifuging at 4000rpm for 5 minutes and collecting the agrobacterium.

Resuspending Agrobacterium with 5% sucrose solution, and diluting the bacterial solution to OD₆₀₀About 0.5 to about 0.8, and 0.03% of a surfactant Silvet L-77 is added before use. And selecting arabidopsis thaliana with good growth state, and soaking the flower bud of arabidopsis thaliana in the agrobacterium liquid for 20 seconds. And (4) shading and moisturizing the mixture for 24 hours by using opaque plastic cloth, and then transferring the mixture to a light incubator for continuous culture. The transformation was repeated once a week later.

The transformed Arabidopsis thaliana can be placed under the long-day condition, so that the Arabidopsis thaliana can grow fast to form seeds, and T is collected₀And (5) seed generation.

4. Identification of transgenic Arabidopsis thaliana

(1) Kanamycin resistance selection of transgenic plants

a. Taking the harvested T₀Seeds of Arabidopsis thaliana (about 100 mg) are placed in a 1.5ml centrifuge tube；

b. Sterilizing with 70% ethanol for 5s, centrifuging for a short time, and removing supernatant;

c. with 10% NaHClO₃Disinfecting for 2-3 minutes, centrifuging for a short time, and then discarding the supernatant;

d. adding sterilized distilled water, re-suspending, centrifuging, removing supernatant, and washing for several times;

e. add l ml sterile 0.1% agarose solution to suspend the seeds;

f. spreading Arabidopsis seeds on L/2MS culture medium containing 50mg/L Kan +;

g. vernalizing at a low temperature of 4 ℃ for 2-5 days;

h. transplanting to Arabidopsis thaliana, culturing under normal condition, transplanting Kan + resistant Arabidopsis thaliana seedling to flowerpot with soil, bombax 1, growing in culture room, and collecting T₁And (5) seed generation.

(2) PCR identification of Arabidopsis thaliana

Get T₁The method for extracting the plant genome DNA from the young leaves of the arabidopsis seedlings comprises the following steps:

a. collection T₁Putting 1 young leaf into a centrifugal tube of 1.5ml, injecting liquid nitrogen, and grinding the sample into powder;

b. adding 750 mu l of extraction buffer solution into a centrifuge tube filled with a sample, quickly shaking and uniformly mixing, and placing the centrifuge tube at 65 ℃ for heat preservation for 8-10 min;

c. adding 150 mu l of 5M LiAc, slowly and uniformly mixing, and carrying out ice bath for 15-20 min;

d. centrifuging at 13000rpm for 10min at 4 ℃;

e. transferring 800 μ l of the supernatant into a new centrifuge tube, adding equal volume of isopropanol, reversing, mixing, and precipitating at-20 deg.C for 10 min;

f. centrifuging at 13000rpm for 10min at 4 ℃;

g. washing the precipitate with 75% ethanol, and air drying;

h. the pellet was dissolved in 10. mu.l of TE buffer;

i. diluting the extracted DNA sample by 5-10 times to be used as a PCR reaction template, carrying out PCR reaction according to the method of example 1-1, and identifying the transgenic condition of T1 generation.

70 wild type Arabidopsis plants were transformed by Agrobacterium pollen tube method carrying the recombinant plasmid pBI121-PpSPI24, and several thousand seeds were harvested per plant. Seeds into which foreign genes have been introduced are preliminarily selected by expression of the kanamycin resistance gene, about 3.5 ten thousand seeds are sown, and 72 seeds having kanamycin resistance are finally obtained. The plants are self-pollinated by wrapping the plants with plastic bags to obtain T₁Seed generation, and backcross culture to T₃And (4) generating homozygotes for subsequent analysis.

5. Insect-resistant analysis of PpSPI24 transgenic Arabidopsis plants

SEQ ID the cabbage caterpillar of about 10 and 2 years old is put into a 15cm culture dish, and soaked cotton balls are placed in the culture dish for moisture preservation. The leaf of 8 leaf stages of adding equivalent lotus throne commentaries on classics PpSPI24 arabidopsis and wild type arabidopsis in every culture dish is given it to eat, and every is handled and is set up 3 and repeat, records each and handles survival and die forget worm number and larva growth situation, in time changes fresh leaf, statistics cabbage worm's death rate. After the cabbage worms are fed for 5 days, the mortality rate of the cabbage worms fed with the transgenic PpSPI24 Arabidopsis leaves is 22 percent and is obviously higher than the mortality rate of a control by 4.2 percent, which indicates that the transgenic PpSPI24 Arabidopsis can inhibit the survival of the cabbage worms and has toxic killing effect on the cabbage worms. The pteromalus puparum venom protein PpSPI24 is expected to have control effect on lepidoptera pests such as cabbage caterpillars and the like when being transferred into other cruciferous vegetables such as cabbage and the like.

Finally, it should also be noted that the above list is only a specific implementation example of the present invention. It is obvious that the invention is not limited to the above embodiment examples, but that many variations are possible. All modifications which can be derived or suggested by a person skilled in the art from the disclosure of the present invention are to be considered within the scope of the invention.

Sequence listing

<110> Zhejiang university

<120> chrysalid pteromalid venom Kazal-type serine protease inhibitor PpSPI24 protein and application

<160>2

<170>SIPOSequenceListing 1.0

<210>1

<211>231

<212>DNA

<213> Pteromalus puparum (Pteromalus puprum)

<400>1

atggccaagt ctatgctcat cgttgctttc ctcctcgtcg cctgcatgat gttcatgcac 60

gtgagcgcgt ttaccgacca ggacggcaac aactgtccct gtgccaccac tgacgatctc 120

agatatgttt gcggcagcga cggcgtcacc tacgacaacg agtctgagct caactgcgag 180

aacaagtgca aacgatccaa catccaggtt aggttcgaag gcaaatgctg a 231

<210>2

<211>76

<212>PRT

<213> Pteromalus puparum (Pteromalus puprum)

<400>2

Met Ala Lys Ser Met Leu Ile Val Ala Phe Leu Leu Val Ala Cys Met

1 5 10 15

Met Phe Met His Val Ser Ala Phe Thr Asp Gln Asp Gly Asn Asn Cys

2025 30

Pro Cys Ala Thr Thr Asp Asp Leu Arg Tyr Val Cys Gly Ser Asp Gly

35 40 45

Val Thr Tyr Asp Asn Glu Ser Glu Leu Asn Cys Glu Asn Lys Cys Lys

50 55 60

Arg Ser Asn Ile Gln Val Arg Phe Glu Gly Lys Cys

65 70 75

Claims

1. The pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24 is characterized in that: the amino acid sequence is shown as SEQ ID NO: 2, respectively.

2. The gene encoding the pteromalus puparum venom Kazal-type serine protease inhibitor protein PpSPI24 of claim 1, wherein: the nucleotide sequence is shown as SEQ ID NO: 1 is shown.

3. The use of the chrysalid pteromalid venom Kazal-type serine protease inhibitor protein PpSPI24 as claimed in claim 1, wherein: the PpSPI24 protein is used for inhibiting activation of haemolymph PPO of Pieris rapae or Papilio citri.

4. A method for improving the prevention of lepidopteran pests in cruciferous vegetables, comprising: transforming arabidopsis thaliana with agrobacterium carrying recombinant plasmid pBI121-PpSPI24, wherein the nucleotide sequence of PpSPI24 is shown as SEQ ID NO: 1, the lepidoptera pests are cabbage caterpillars.