CN108396012A - Applications of the monoclonal antibody 1DB4 in detecting IrrE transgenic crops - Google Patents
Applications of the monoclonal antibody 1DB4 in detecting IrrE transgenic crops Download PDFInfo
- Publication number
- CN108396012A CN108396012A CN201810118344.0A CN201810118344A CN108396012A CN 108396012 A CN108396012 A CN 108396012A CN 201810118344 A CN201810118344 A CN 201810118344A CN 108396012 A CN108396012 A CN 108396012A
- Authority
- CN
- China
- Prior art keywords
- irre
- monoclonal antibody
- crops
- cell
- ala
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1267—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/577—Immunoassay; Biospecific binding assay; Materials therefor involving monoclonal antibodies binding reaction mechanisms characterised by the use of monoclonal antibodies; monoclonal antibodies per se are classified with their corresponding antigens
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Organic Chemistry (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention provides a kind of monoclonal antibodies, the antibody is secreted to obtain by the hybridoma that deposit number is CGMCC NO.12268, while providing purposes and a kind of method that detects the transgenic crop that turns IrrE of the antibody in detection turns the transgenic crop of IrrE.The monoclonal antibody of the present invention can be used in the WESTERN BLOT detections of drought resistance and salt tolerance stress regulatory protein I rrE, can detect recombination IrrE albumen and turns IrrE crop seeds;Cross reaction is not also presented to the various non-IrrE genetically modified crops of 7 kinds of separate sources.
Description
Technical field
The present invention relates to agricultural biological technical fields, and in particular, to a kind of hybridoma cell strain, a kind of monoclonal antibody
And its detection turn purposes in the transgenic crop of IrrE and detection turn IrrE transgenic crop method.
Background technology
What Deinococcus radiodurans (Deinococcus radiodurans) were acknowledged as finding so far has most forceful electric power
Bacterium bacterial strain from radioresistance.Activation reparation of the bacterium of this non-sporogenesis to its lesioned gene group, can be
Existence in Extreme dosages ionising radiation, and will not be by fatal damage and gene mutation.Deinococcus radiodurans are gathered around
Some repair mechanisms make its 200 times higher than Escherichia coli to the resistance of ionising radiation or more.Deinococcus radiodurans are not only
Passive protection cell resistance ionising radiation, while also there is thundering accurate DNA damage repair ability.Radiation hardness is abnormal
Coccus has very high resistance to the oxidative stress of diversified forms.Deinococcus radiodurans have pole for long-term drought stress
High resistance.Relative humidity is less than 5% drought environment and handles 6 weeks and can not generate shadow to the survival ability of Deinococcus radiodurans
It rings, Deinococcus radiodurans R1 only loses 15% by such Osmotic treatment cell survival.Even there is relevant report to point out
Deinococcus radiodurans are subjected to Osmotic treatment 6 years, thalline still retains 10% viability.This survival efficiency is not for forming
It is extraordinary for the bacterium of spore.
IrrE genes are located on No. 1 chromosome of Deinococcus radiodurans genome, and ORF numbers are DR0167.Full length gene
987-bp encodes the 35kDa albumen being made of 328 amino acid.IrrE albumen is not found in existing database
Albuminoid, identify that it is deinococcus differential protein.Recent study finds, irrE genes in Deinococcus radiodurans
It is the switch gene of a distinctive, extremely important DNA restoration and protection approach, plays an important role to DNA damage reparation.It grinds
Study carefully and think that irrE genes are a kind of promotor genes of novel responsible extreme radioresistance, in various DNA damage reparations and protection
It radiates in the approach of Stress responses and plays central regulator.Meanwhile the gene can be significantly improved it in expression in escherichia coli
The ability of radioresistance and scavenging activated oxygen, and irrE genes significantly improve the height of bacterial strain in expression in escherichia coli
The resistances such as ooze, be with high salt, is arid.Being transferred to the Escherichia coli of irrE genes and rape has high salt resistance ability, therefore the gene
It is with a wide range of applications on cultivating drought resistance and salt tolerance new varieties crop
With the development of the society, more and more based on the genetically modified crops commercial growth of non-transgenic elite characteristic by state
Family's approval, the food and environmental security that thus may be brought cause the great attention of people.To genetically modified crops or turn
The detection and identification of gene modified food is not only the inevitable requirement of relevant laws and regulations, and meets the necessary technology of public right to information.Cause
This, establishes effective, sensitivity, fast and accurately detection method, is both the important research content of transgenosis safe evaluation, and
Further strengthen important technology guarantee of the China in terms of genetically modified crops and product supervision.
In the development of genetically modified plants or when carrying out screening or safety evaluatio to transgenic product, generally require
Qualitative or semiquantitative determination is carried out to the allogenic gene being transferred to.And the use of monoclonal antibody is to implement immunology detection technology
Necessary condition, hypersensitivity and specificity monoclonal antibody be then to advanced optimize the important guarantee of reaction.
Invention content
The object of the present invention is to provide the monoclonal antibodies of a kind of higher susceptibility and the anti-IrrE albumen of specificity.
To achieve the goals above, on the one hand, the present invention provides a kind of hybridoma cell strain, the hybridoma cell strain
Deposit number is CGMCC NO.12268.
In another aspect, the present invention also provides a kind of monoclonal antibody, which is CGMCC by deposit number
The hybridoma cell strain of NO.12268 generates.
In another aspect, the present invention also provides monoclonal antibodies as described above to detect the transgenic crop for turning IrrE
In purposes.
On the other hand, the present invention also provides a kind of methods for the transgenic crop for detecting and turning IrrE, wherein this method
Include the following steps:S1, holoprotein is extracted from crops to be detected;S2, list as described above is used to the holoprotein
Clonal antibody carries out immuning hybridization;If there is the positive band of IrrE in S3, immuning hybridization result, it indicates that agriculture to be detected
Crop is the transgenic crop for turning IrrE.
Through the above technical solutions, the present invention can be detected IrrE albumen by WESTERN BLOT methods, and
And cross reaction is not also presented to the various non-IrrE genetically modified crops of 7 kinds of separate sources.
Other features and advantages of the present invention will be described in detail in subsequent specific embodiment part.
Biomaterial preservation
The hybridoma cell strain of secretion monoclonal antibody 1DB4 of the present invention is voluntarily merged what screening obtained by inventor, is protected
It is CGMCC NO.12268 to hide number, and the deposit date is on 04 07th, 2016, depositary institution was Chinese microorganism strain preservation
Administration committee's common micro-organisms center, address are located at Yard 1, BeiChen xi Road, Chaoyang District, Beijing City 3 Chinese Academy of Sciences microorganism
Research institute, Classification And Nomenclature are anti-IrrE monoclonal antibody hybridoma cells strain.
Description of the drawings
Attached drawing is to be used to provide further understanding of the present invention, an and part for constitution instruction, with following tool
Body embodiment is used to explain the present invention together, but is not construed as limiting the invention.In the accompanying drawings:
Fig. 1 is the expression and purification result figure of His-Tag IrrE fusion proteins in embodiment 1.
Fig. 2 is the result figure that monoclonal antibody affinity chromatography purifies in embodiment 2.
Fig. 3 is the result figure that the dilution of monoclonal antibody 1DB4 low powers applies in Western Blot detections in embodiment 2.
Specific implementation mode
The specific implementation mode of the present invention is described in detail below in conjunction with attached drawing.It should be understood that this place is retouched
The specific implementation mode stated is merely to illustrate and explain the present invention, and is not intended to restrict the invention.
On the one hand, the present invention provides a kind of hybridoma cell strains, and the deposit number of the hybridoma cell strain is CGMCC
NO.12268。
In another aspect, the present invention also provides a kind of monoclonal antibody, which is CGMCC by deposit number
The hybridoma cell strain of NO.12268 generates.
Wherein, the method for monoclonal antibody being generated by the hybridoma cell strain that deposit number is CGMCC NO.12268 can be with
For the method for this field routine, such as mouse ascites method.
In another aspect, the present invention also provides monoclonal antibodies as described above to detect the transgenic crop for turning IrrE
In purposes.
Wherein, the IrrE albumen refers to the albumen of IrrE coded by said gene, and IrrE genes refer to that NCBI Gene ID are
1798483 gene (number by gene:DR_0167).
Wherein it is possible to using the protein immunization detection method of this field routine by monoclonal antibody as described above for examining
Survey turns IrrE gene crops.For example, holoprotein can be extracted from crops to be detected, immuning hybridization is then used
The method of (WESTERN BLOT) is detected, if the holoprotein of crops to be detected monoclonal antibody as described above
There is the positive band of IrrE after carrying out immuning hybridization, it indicates that crops to be detected are the transgenic crop for turning IrrE.
Optionally, wherein the crops are cauliflower, rape, cotton, corn, rice or soybean.
On the other hand, the present invention also provides a kind of methods for the transgenic crop for detecting and turning IrrE, wherein this method
Include the following steps:S1, holoprotein is extracted from crops to be detected;S2, list as described above is used to the holoprotein
Clonal antibody carries out immuning hybridization;If there is the positive band of IrrE in S3, immuning hybridization result, it indicates that agriculture to be detected
Crop is the transgenic crop for turning IrrE.
In method as described above, optionally, the crops are cauliflower, rape, cotton, corn, rice or big
Beans.
Hereinafter, present invention will be further described in detail through examples.In following embodiment, reagent used is commercially available obtains
.
Embodiment 1
The induced expression of IrrE albumen and purifying.
According to the Deinococcus radiodurans Genomic sequence information announced, primer amplified target gene piece is designed
Section.Deinococcus radiodurans genomic DNA is extracted using Tiangeng bacterial genomes extracts kit.To extract and after purification resistance to
Radiation abnormal cocci genomic DNA is template, carries out PCR reactions using specific primer IrrE (F)/IrrE (R), expands resistance to spoke
Abnormal cocci IrrE gene orders are penetrated, are expanded using exo+ polymerase in PCR reactions, to ensure the accurate of DNA fragmentation
Property.Primer used in PCR is IrrE (F):5 '-CACAGGAGGACCCCATATGCCCAGTGC-3 ' (SEQ ID NO.1) and
IrrE(R):5'-ACCAAGCTTAGTTCACTGTG-3'(SEQ ID NO.2)。
PCR product upstream and downstream contains Nde I and Hind III restriction enzyme digestion sites respectively.By the PCR of acquisition
After product purification recycling, carried out using restriction enzyme Nde I and Hind III double digested.It similarly utilizes restricted
Restriction endonuclease Nde I and Hind III carry out double digested colibacillus high expression vector pET28a.By above-mentioned digestion products into
Row purifying recycling, is attached under T4DNA connection enzyme effects, and connection product enters common protein expression place by heat-shock transformed
In main bacterial strain BL21 (DE3), and recombinant bacterial strain is coated on the LB solid mediums containing kanamycins.Several single bacteriums of picking
Same resistant panel of transferring in order is fallen, and is cultivated in the LB liquid medium containing antibiotic of transferring simultaneously, thalline is extracted
In the Plasmid DNA that contains carry out digestion and PCR verifications;Recombinant bacterial strain is verified also with bacterium colony round pcr in experiment.
Obtained correct recombinant plasmid pET-IrrE does further verification by DNA sequencing.Sequencing result shows the coding of IrrE genes
Sequence is as shown in SEQ ID NO.3, and the protein amino acid sequence of coding is as shown in SEQ ID NO.4.
SEQ ID NO.4 are:MPSANVSPPCPSGVRGGGMGPKAKAEASKPHPQ
IPVKLPFVTAPDALAAAKARMRDLAAAYVAALPGRDTHSLMAGVPGVDLKFMPLGWRDGAFDPEHNVILINSAARPE
RQRFTLAHEIGHAILLGDDDL
LSDIHDAYEGERLEQVIETLCNVAAAAILMPEPVIAEMLERFGPTGRALAELAKRAEVSASSALYALTEQTPVPVIY
AVCAPGKPPREQAASDEDAGPSTEKVLTVRASSSTRGVKYTLASGTPVPADHPAALALATGMEVREESYVPFRSGRK
MKAEVDAYPSRGIVAVSFEFDPARLGRKDSEQADRDEPQDAAQ;Referring specifically to sequence table.
SEQ ID NO.3 are:ATGCCCAGTGCCAACGTCAGCCCCCCTTGCCC
CTCTGGGGTAAGGGGCGGGGGGATGGGGCCAAAAGCTAAAGCTGAAGCCTCCAAGCCCCACCCCCAAATCCCTGTTA
AGCTCCCATTCGTGACCGCCCCCGACGCCCTCGCCGCCGCCAAAGCCAGGATGCGCGACCTGGCGGCGGCCTACGTG
GCGGCCCTGCCCGGACGCGACACCCACAGCCTGATGGCGGGGGTGCCCGGCGTAGACCTCAAATTCATGCCGCTCGG
CTGGCGCGACGGGGCGTTCGACCCCGAGCACAACGTCATCCTCATCAACTCGGCGGCCCGCCCCGAACGCCAGCGCT
TCACCCTCGCCCACGAAATCGGGCACGCGATTTTACTCGGCGACGACGACCTGCTCTCCGACATCCACGACGCCTAC
GAGGGCGAGCGGCTCGAACAGGTCATCGAAACGCTGTGCAACGTGGCGGCGGCGGCGATTTTGATGCCCGAACCCGT
CATCGCGGAAATGCTGGAACGCTTCGGCCCCACCGGGCGCGCCCTCGCCGAACTCGCCAAGCGGGCCGAAGTCAGCG
CGTCGTCGGCGCTCTACGCCCTGACCGAGCAGACCCCGGTGCCCGTCATCTACGCGGTCTGTGCGCCGGGCAAGCCT
CCGCGTGAGCAGGCCGCAAGCGACGAGGACGCTGGCCCAAGCACAGAAAAAGTCCTGACGGTCCGCGCCAGCAGCTC
GACGCGGGGCGTCAAGTACACCCTGGCGAGCGGCACGCCGGTACCCGCCGACCACCCGGCGGCGCTTGCCCTCGCCA
CGGGCATGGAAGTGCGCGAGGAAAGCTACGTGCCCTTTCGCTCGGGCCGGAAAATGAAGGCGGAGGTGGACGCCTAC
CCGTCGCGCGGCATCGTGGCCGTCAGTTTCGAGTTCGACCCCGCCCGCCTGGGCCGCAAGGACAGCGAGCAGGCCGA
CCGGGACGAGCCGCAGGACGCTGCACAGTGA;Referring specifically to sequence table.
Gene in the carrier pET-IrrE of the high efficient expression IrrE albumen of structure contains terminator codon, the fusion of expression
The aminoterminal of IrrE albumen carries 6His-Tag and can be used for isolating and purifying for albumen.It will contain recombinant plasmid pET-IrrE's
Switching is in fresh culture medium after the activation of BL21 (DE3) bacterial strain.Strain growth is 0.6 or so to OD values, is added into culture medium
Enter the IPTG that final concentration is respectively 0.5mM, 16 DEG C of culture 12h, inducing cell expresses IrrE albumen.Utilize IrrE fusion protein ammonia
The His-Tag that base end is contained, using the NTA resins progress affinitive layer purification of the Ni-NTA couplings fusion protein.It collects
40mM imidazole elutions take off the destination protein in liquid, are detected by SDS-PAGE, the results are shown in Figure 1.In Fig. 1, swimming lane M is point
Son amount label, swimming lane 1 are control strain whole-cell protein;Swimming lane 2 is expression IrrE cell soluble proteins after IPTG inductions;Swimming
Road 3 is expression IrrE cell insoluble albumens after IPTG inductions;Swimming lane 4 is soluble protein loading efflux;Swimming lane 5 is NTA-0
Eluent;Swimming lane 6 is His-Tag IrrE fusion proteins after purification, it is seen that purity is higher.The IrrE albumen of purifying can be used for
Prepare its monoclonal antibody.
Embodiment 2
The preparation and identification of IrrE protein monoclonal antibodies
By 6-8W+The female mouse of BALB/c be according to dosage divided into four groups, according to dosage 50,100,150,200 μ g/ only (are implemented
The IrrE albumen that example 1 obtains) it is immunized, it is immunized 3 times altogether.Take blood as negative control before initial immunity, when initial immunity
Add the subcutaneous multi-point injection of isometric Freund's complete adjuvant;Primary immunization is carried out every surrounding later, is added with same dose recombinant antigen
The subcutaneous multi-point injection of isometric freund 's incomplete adjuvant.It is coated with ELISA with recombinant antigen within 10 days or so after third time is immune
Plate measures the antibody titer of mice serum with indirect ELISA;Merge first three day highest to antibody titer (1:105More than) small
50 μ g of tail vein injection recombinate IrrE albumen booster immunizations.Booster immunization carries out cell fusion after three days.
Cell fusion the previous day, feeder cells are prepared in accordance with the following methods:1) by 8W+Healthy male BALB/c mouse,
After drawing neck to put to death, 3-5min is impregnated in 75% ethyl alcohol;2) it moves in super-clean bench, skin is cut off with sterile scissors, expose peritonaeum, and
With its peritonaeum of 75% ethanol disinfection;3) with haemostatic clamp gently pull-up peritonaeum, 1640 fluid nutrient mediums of 10mL pre-temperatures are injected
Device injects abdominal cavity, and abdominal cavity 1-2min is gently rubbed with cotton balls, and cell suspension is sucked out, is put into centrifuge tube;4) it centrifuges:1000 × g,
5min abandons supernatant;5) with 10mL HAT containing serum culture mediums by cell mixing, cell count, adjustment cell density is in 2 × 105/
mL;6) 96 porocyte culture plates are added by 100 holes μ L/ in this cell suspension, then cell density is 2 × 104/ hole;7) 37 DEG C are set,
5%CO2Incubator culture, for next day fusion experiment.
The preparation of myeloma cell SP2/0:1) exponential phase SP2/0 cells are harvested, 3 are washed with 1640 fluid nutrient mediums
Secondary, 1000 × g centrifuges 5min, abandons supernatant;2) cell is resuspended with 1640 fluid nutrient mediums.100 μ L cell suspensions are taken, with 0.2%
Trypan Blue carries out cell count, it is desirable that cell viability>95%, and it is for use to adjust cell density.
The preparation of splenocyte suspension:1) BALB/c mouse being immunized through overbump before 3 days is extractd into eyeball bloodletting, at the neck that breaks
Extremely, 2min is impregnated in 75% ethyl alcohol;2) it moves in super-clean bench, abdominal cut skin is removed to both sides, exposure stomach wall;Change scissors,
Tweezers cut off peritonaeum, take out spleen, remove fat and connective tissue, are rinsed with 1640 culture mediums;3) spleen is placed in 200 mesh
Sieve on, lightly ground with piston on one side;It is rinsed on one side with culture solution, collection splenocyte suspension, centrifugation 1000 ×
G, 5min abandon supernatant;4) cell, centrifuge washing 2 times is resuspended with 1640 culture mediums:1000 × g, 5min abandon supernatant;5) 10mL is used
Incomplete culture medium is resuspended.100 μ L cell suspensions are taken, with 0.2% Trypan Blue, it is desirable that cell viability>95%, and count spleen
Cell.It is for use that remaining cell adjusts cell density.
Cell fusion and culture:1) by splenocyte and SP2/0 myeloma cell with 5:1 ratio is mixed in 50mL centrifuge tubes
In, 1000 × g centrifuges 5min, abandons supernatant, flicks centrifugation bottom of the tube, keeps cell precipitation loose;2) one side uniform rotation centrifuge tube,
The 50%PEG4000 1mL of 37 DEG C of pre-temperatures are added dropwise with suction pipe on one side, in being completed in 1min;3) add 1640 culture mediums of 37 DEG C of preheatings
1mL is completed in 1min;4) the 1640 culture medium 10mL for adding 37 DEG C of preheatings, are completed in 5min;5) 800 × g centrifuges 8min;
Cell precipitation is resuspended with 100mL HAT culture mediums;6) cell suspension is transferred to by 100 holes μ L/ and is vaccinated with the thin of feeder cells
In born of the same parents' culture plate, while staying 2 holes that not fused SP2/0 cells is added to compare, sensibility of the observation cell to HAT.Culture plate
It is placed in 37 DEG C, 5%CO2It is cultivated in incubator;7) after merging 3 days, the fresh HAT culture solutions of 100 μ L are added per hole.Later per 3-5
It is primary that its half amount replaces HAT culture solutions;8) after 2 weeks, HT culture mediums half, which are measured, changes liquid;9) it after 3-4 weeks, changes complete medium and maintains training
It supports.
ELISA screens positive hybridoma cell:1) merge after cell growth arrive culture hole floor space 1/4 when (cultivate
About 12-15 days or so), supernatant indirect elisa method detection specific reaction and cross reaction are taken, hybridoma is sieved
Choosing.Recombinant protein IrrE is envelope antigen, and 5 μ g/mL of peridium concentration are routinely coated with elisa plate.Add 100 μ into coating elisa plate
The cell culture supernatant in the holes L/, with PBS 1:100 diluted immune mouse serums are positive control, in SP2/0 cell hole cultures
It is negative control clearly.37 DEG C of incubation 30min of cell conditioned medium and coating elisa plate, are fully added the sheep anti mouse of HRP labels after washing
IgG antibody (1:10000 dilutions) 100 holes μ L/, 37 DEG C are incubated 30min, abandon secondary antibody.Add 100 μ L of TMB aobvious per hole after abundant board-washing
Color 15min adds 50 μ L 1N H per hole2SO4Terminate reaction.Measure OD450Value.2) ELISA screenings obtain 98 plants of secretion IrrE
The cell strain of monoclonal antibody;Monoclonal antibody secreted by the cell strain of above-mentioned 98 plants of IrrE monoclonal antibodies has sun to recombination IrrE albumen
Property reaction.The selection wherein strongest 37 plants of cells of positive reaction are further subcloned culture, remaining cell strain directly expands culture,
It freezes and produces ascites on a small quantity.
Limiting dilution assay carries out colonized culture:1) cell to be cloned is blown and beaten into mixing with pipettor, with containing 20% blood
Clear HT selection culture solutions are diluted to the density of 1 cells/well, and the cell plates for having feeder cells are added, set 5%CO2、37℃
Incubator in cultivated;2) when culture was to the 4th day, cell monoclonal growth hole is observed and recorded under inverted microscope;
Culture 1 week or so draws the cell culture supernatant that 100 μ L have turned yellow, with above-mentioned ELISA method detection cells and supernatant;3)
The hole inner cell for being detected as strong positive carries out 2-3 subclone, the training of to the last primary all only one cell colony growths
Until foster hole supernatant ELISA testing results are the positive;4) by best miscellaneous of ELISA testing results after last time limiting dilution
It hands over oncocyte clone to expand culture, and freezes.
The preparation of ascites:1) 10 week old BALB/c mouses are chosen, intraperitoneal injection atoleine 0.5mL/ is only;2) after 7 days, abdomen
Chamber inoculation is through the diluted cultures of PBS to the positive hybridoma cell of logarithmic phase, every mouse 5 × 105/ mL hybridomas;3)5
It is observed after it, when mouse web portion obviously expands, collects ascites with No. 12 injection needles, collected once, until mouse every 3 days
It is dead;4) ascites is centrifuged into 10min with 7 000 × g;- 80 DEG C of refrigerators preserve after staying supernatant to dispense.
The purifying (protein A affinity chromatographys) of monoclonal antibody:1) column is filled:With Equilibration Buffer
(50mM Tris-HCl, 150mM NaCl, pH8.6) moistens pillar, checks whether pillar blocks, and adds 5mL Protein
AAgarose is in column;2) the Equilibration Buffer that 10 times of column volumes are added balance pillar;It 3) slowly will be in ascites
Sample;4) the Equilibration Buffer of 10 times of column volumes are added, liquid is penetrated until OD by the collection of 4-5mL/ pipes280<0.1;5)
Prepare collecting pipe, neutralization buffer (20mM phosphate buffers, pH 7.7) is added by 500 μ L/ pipes in the test tube for collecting eluent;
6) it is eluted with the Elution Buffer of 5 times of column volumes (50mM glycine, 0.5M NaCl, pH 2.3), is received by 1.5mL/ pipes
Collect eluent until OD280<0.1;7) column and balance pillar are washed with the Equilibration Buffer of 5 times of column volumes.
It is adapted to the monoclonal antibody screening of WESTERN BLOT:
By obtained 37 plants of purified monoclonal antibodies, using WESTERN BLOT methods, by IrrE recombinant antigens and non-
The specificity screening of IrrE genetically modified crops finally filters out the monoclonal antibody just for IrrE high specific high sensitivities.
The operating procedure of WESTERN BLOT monoclonal antibodies screening:Albumen is separated by electrophoresis in 12%SDS-PAGE.Swimming lane 1 is
Albumen Marker;Swimming lane 2 is recombination IrrE albumen (1mg/mL);Swimming lane 3 is to turn IrrE rape seeds extract (0.2g/mL);
Swimming lane 4 is to turn NPTII rice paddy seeds extract (0.2g/mL);Swimming lane 5 is to turn BT Cry1Ac corn seed extracts (0.2g/
mL);Swimming lane 6 is to turn phy corn seeds extract (0.2g/mL);Swimming lane 7 is to turn CP4-EPSPS soya seeds extracts
(0.2g/mL);Swimming lane 8 is to turn G2-EPSPS corn seeds extract (0.2g/mL);Swimming lane 9 is to turn PAT/bar corn seeds pumping
Extract (0.2g/mL);Swimming lane 10 is to turn BT/CPTI cotton seeds extract (0.2g/mL);Albumen in half-dried transfer gel is extremely
Nitrocellulose membrane (NC films), 20 volts of constant pressure 1h;5% skimmed milk power will be added in PBST as with confining liquid, electricity takes after the completion of turning
Go out NC films to be put into confining liquid, overnight, PBST washs 5min × 3 time for 4 DEG C of closings;With 37 plants filtered out anti-IrrE monoclonal antibodies difference
For primary antibody, 1 is pressed respectively with confining liquid:200 dilution proportions, shaken at room temperature abandon reaction solution after being incubated 2h, and PBST washs NC films 5min
× 3 times;It marks sheep anti-mouse igg as secondary antibody using HRP, 1 is pressed with confining liquid:10000 dilution proportions are abandoned after shaking table incubation 2h at room temperature
Reaction solution, PBST wash 5min × 4 time;DAB developing solutions develop the color, and observe result.
The identification of monoclonal antibody subclass:Using immunoglobulin standard subgroup identification kit (Sigma companies) to each
Strain monoclonal antibody carries out subgroup identification, and specific test method is as follows:1 is separately added into ELISA Plate:1000 times of diluted sheep anti mouses of PBS
IgG(IgM、IgA、IgG1、IgG2a、IgG2bAnd IgG3), 100 holes μ L/, 37 DEG C of placement 1h;Liquid in ELISA Plate is discarded, PBST is used
Washing 3 times;The monoclonal antibody purification (antibody concentration 2-5 μ g/mL) after PBS dilutions is added in 100 holes μ L/, is incubated at room temperature 1h;
PBST is washed 3 times;The sheep anti-mouse igg antibody (1 of HRP labels is added:10000 dilutions) 100 holes μ L/, it is incubated at room temperature 30min;It fills
Add 100 μ L TMB after point board-washing per hole, develop the color 15min, adds 1N H2SO450 holes μ L/ terminate reaction.Measure OD450Value.
The qualification result of monoclonal antibody purity and subclass:Experiments have shown that monoclonal antibody 1DB4 is suitable for WESTERN
BLOT, monoclonal antibody 1DB4 purification result such as Fig. 2 show that purity is more than 95%.
Monoclonal antibody 1DB4 subgroup identification results are IgG1 hypotypes.
Monoclonal antibody specificity and sensitivity evaluation:WESTERN BLOT experiment screenings to monoclonal antibody 1DB4 press
1:200、1:500、1:1000、1:2000、1:When 5000 dilution, recombination IrrE albumen is detected.Testing result shows, no
Monoclonal antibody 1DB4 with extension rate is able to detect that recombination IrrE albumen, illustrates that monoclonal antibody 1DB4 has good detection spirit
Sensitivity.In table 1 ,+represent there is the positive band concentration of quantity representative band (+) ,-to represent band invisible, ± represent item
Band and background difference be not notable or has miscellaneous band, it is difficult to judge;It is same as below.
Table 1
The hybridoma cell strain for producing 1DB4 monoclonal antibodies is subjected to preservation, deposit number is CGMCC NO.12268.
Monoclonal antibody 1DB4 is pressed 1:200 dilutions to recombination IrrE albumen, turn IrrE crop seeds and 7 kinds of differences
The various non-IrrE genetically modified crops in source carry out WESTERN BLOT detections.As a result as shown in Table 2, monoclonal antibody 1DB4 can
Specific detection is to recombination IrrE albumen and turns IrrE crop seeds, as a result as Fig. 3 shows.To the various non-of 7 kinds of separate sources
Cross reaction is not also presented in IrrE genetically modified crops.Illustrate that monoclonal antibody 1DB4 has good detection sensitivity.
Table 2
1DB4(1:200 dilutions) | |
Recombinate IrrE albumen (1mg/mL) | +++ |
Turn IrrE rape seeds extract (0.2g/mL) | ++ |
Turn NPTII rice paddy seeds extract (0.2g/mL) | - |
Turn BT Cry1Ac corn seeds extracts (0.2g/mL) | - |
Turn phy corn seeds extract (0.2g/mL) | - |
Turn CP4-EPSPS soya seeds extract (0.2g/mL) | - |
Turn G2-EPSPS corn seed seed extracts (0.2g/mL) | - |
Turn PAT/bar maize seed extracts (0.2g/mL) | - |
Turn BT/CPTI cotton seeds extract (0.2g/mL) | - |
According to embodiment 2 as can be seen that the present invention has screened a kind of monoclonal antibody 1DB4, it can be used in WESTERN
BLOT is detected.It can detect recombination IrrE albumen and turn IrrE crop seeds;To the various non-IrrE transgenosis of 7 kinds of separate sources
Cross reaction is not also presented in crop.Monoclonal antibody 1DB4 has very excellent sensibility and specificity.
Comparative example 1
Remaining 10 plants in 37 plants of purified monoclonal antibodies that embodiment 2 is obtained in addition to 1DB4, use WESTERN BLOT
Method, by 1:200 dilutions, carry out the detection of specificity and sensitivity, the results are shown in Table 3.
Table 3
According to table 3 as can be seen that monoclonal antibody 1DB4 has very excellent sensibility compared to other monoclonal antibodies
And specificity.
The preferred embodiment of the disclosure is described in detail above in association with attached drawing, still, the disclosure is not limited to above-mentioned reality
The detail in mode is applied, in the range of the technology design of the disclosure, a variety of letters can be carried out to the technical solution of the disclosure
Monotropic type, these simple variants belong to the protection domain of the disclosure.
It is further to note that specific technical features described in the above specific embodiments, in not lance
In the case of shield, can be combined by any suitable means, in order to avoid unnecessary repetition, the disclosure to it is various can
The combination of energy no longer separately illustrates.
In addition, arbitrary combination can also be carried out between a variety of different embodiments of the disclosure, as long as it is without prejudice to originally
Disclosed thought equally should be considered as disclosure disclosure of that.
Sequence table
<110>Biological Technology institute, Chinese Academy of Agricultural Sciences
<120>Applications of the monoclonal antibody 1DB4 in detecting IrrE transgenic crops
<130> 8988CAAS_B
<160> 4
<170> SIPOSequenceListing 1.0
<210> 1
<211> 27
<212> DNA
<213>Artificial sequence (Artificial Sequence)
<400> 1
cacaggagga ccccatatgc ccagtgc 27
<210> 2
<211> 20
<212> DNA
<213>Artificial sequence (Artificial Sequence)
<400> 2
accaagctta gttcactgtg 20
<210> 3
<211> 987
<212> DNA
<213>Artificial sequence (Artificial Sequence)
<400> 3
atgcccagtg ccaacgtcag ccccccttgc ccctctgggg taaggggcgg ggggatgggg 60
ccaaaagcta aagctgaagc ctccaagccc cacccccaaa tccctgttaa gctcccattc 120
gtgaccgccc ccgacgccct cgccgccgcc aaagccagga tgcgcgacct ggcggcggcc 180
tacgtggcgg ccctgcccgg acgcgacacc cacagcctga tggcgggggt gcccggcgta 240
gacctcaaat tcatgccgct cggctggcgc gacggggcgt tcgaccccga gcacaacgtc 300
atcctcatca actcggcggc ccgccccgaa cgccagcgct tcaccctcgc ccacgaaatc 360
gggcacgcga ttttactcgg cgacgacgac ctgctctccg acatccacga cgcctacgag 420
ggcgagcggc tcgaacaggt catcgaaacg ctgtgcaacg tggcggcggc ggcgattttg 480
atgcccgaac ccgtcatcgc ggaaatgctg gaacgcttcg gccccaccgg gcgcgccctc 540
gccgaactcg ccaagcgggc cgaagtcagc gcgtcgtcgg cgctctacgc cctgaccgag 600
cagaccccgg tgcccgtcat ctacgcggtc tgtgcgccgg gcaagcctcc gcgtgagcag 660
gccgcaagcg acgaggacgc tggcccaagc acagaaaaag tcctgacggt ccgcgccagc 720
agctcgacgc ggggcgtcaa gtacaccctg gcgagcggca cgccggtacc cgccgaccac 780
ccggcggcgc ttgccctcgc cacgggcatg gaagtgcgcg aggaaagcta cgtgcccttt 840
cgctcgggcc ggaaaatgaa ggcggaggtg gacgcctacc cgtcgcgcgg catcgtggcc 900
gtcagtttcg agttcgaccc cgcccgcctg ggccgcaagg acagcgagca ggccgaccgg 960
gacgagccgc aggacgctgc acagtga 987
<210> 4
<211> 328
<212> PRT
<213>Artificial sequence (Artificial Sequence)
<400> 4
Met Pro Ser Ala Asn Val Ser Pro Pro Cys Pro Ser Gly Val Arg Gly
1 5 10 15
Gly Gly Met Gly Pro Lys Ala Lys Ala Glu Ala Ser Lys Pro His Pro
20 25 30
Gln Ile Pro Val Lys Leu Pro Phe Val Thr Ala Pro Asp Ala Leu Ala
35 40 45
Ala Ala Lys Ala Arg Met Arg Asp Leu Ala Ala Ala Tyr Val Ala Ala
50 55 60
Leu Pro Gly Arg Asp Thr His Ser Leu Met Ala Gly Val Pro Gly Val
65 70 75 80
Asp Leu Lys Phe Met Pro Leu Gly Trp Arg Asp Gly Ala Phe Asp Pro
85 90 95
Glu His Asn Val Ile Leu Ile Asn Ser Ala Ala Arg Pro Glu Arg Gln
100 105 110
Arg Phe Thr Leu Ala His Glu Ile Gly His Ala Ile Leu Leu Gly Asp
115 120 125
Asp Asp Leu Leu Ser Asp Ile His Asp Ala Tyr Glu Gly Glu Arg Leu
130 135 140
Glu Gln Val Ile Glu Thr Leu Cys Asn Val Ala Ala Ala Ala Ile Leu
145 150 155 160
Met Pro Glu Pro Val Ile Ala Glu Met Leu Glu Arg Phe Gly Pro Thr
165 170 175
Gly Arg Ala Leu Ala Glu Leu Ala Lys Arg Ala Glu Val Ser Ala Ser
180 185 190
Ser Ala Leu Tyr Ala Leu Thr Glu Gln Thr Pro Val Pro Val Ile Tyr
195 200 205
Ala Val Cys Ala Pro Gly Lys Pro Pro Arg Glu Gln Ala Ala Ser Asp
210 215 220
Glu Asp Ala Gly Pro Ser Thr Glu Lys Val Leu Thr Val Arg Ala Ser
225 230 235 240
Ser Ser Thr Arg Gly Val Lys Tyr Thr Leu Ala Ser Gly Thr Pro Val
245 250 255
Pro Ala Asp His Pro Ala Ala Leu Ala Leu Ala Thr Gly Met Glu Val
260 265 270
Arg Glu Glu Ser Tyr Val Pro Phe Arg Ser Gly Arg Lys Met Lys Ala
275 280 285
Glu Val Asp Ala Tyr Pro Ser Arg Gly Ile Val Ala Val Ser Phe Glu
290 295 300
Phe Asp Pro Ala Arg Leu Gly Arg Lys Asp Ser Glu Gln Ala Asp Arg
305 310 315 320
Asp Glu Pro Gln Asp Ala Ala Gln
325
Claims (7)
1. a kind of hybridoma cell strain, which is characterized in that the deposit number of the hybridoma cell strain is CGMCC NO.12268.
2. a kind of monoclonal antibody, which is characterized in that the monoclonal antibody is by the hybridization that deposit number is CGMCC NO.12268
Tumor cell strain generates.
3. purposes of the monoclonal antibody in detection turns the transgenic crop of IrrE described in claim 2.
4. purposes according to claim 3, wherein the crops are cauliflower, rape, cotton, corn, rice or big
Beans.
5. purposes according to claim 3 or 4, wherein if the holoprotein of crops to be detected claim 2 institute
There is the positive band of IrrE after carrying out immuning hybridization in the monoclonal antibody stated, it indicates that crops to be detected are to turn IrrE bases
The crops of cause.
6. a kind of method detecting the transgenic crop for turning IrrE, wherein this method includes:
S1, holoprotein is extracted from crops to be detected;
S2, immuning hybridization is carried out using the monoclonal antibody described in claim 2 to the holoprotein;
If there is the positive band of IrrE in S3, immuning hybridization result, it indicates that crops to be detected are to turn turning for IrrE
Gene crops.
7. according to the method described in claim 6, wherein, the crops are cauliflower, rape, cotton, corn, rice or big
Beans.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201810118344.0A CN108396012B (en) | 2018-02-06 | 2018-02-06 | Application of monoclonal antibody 1DB4 in detection of IrrE transgenic crops |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201810118344.0A CN108396012B (en) | 2018-02-06 | 2018-02-06 | Application of monoclonal antibody 1DB4 in detection of IrrE transgenic crops |
Publications (2)
Publication Number | Publication Date |
---|---|
CN108396012A true CN108396012A (en) | 2018-08-14 |
CN108396012B CN108396012B (en) | 2020-10-23 |
Family
ID=63095364
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810118344.0A Active CN108396012B (en) | 2018-02-06 | 2018-02-06 | Application of monoclonal antibody 1DB4 in detection of IrrE transgenic crops |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN108396012B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN108396013A (en) * | 2018-02-06 | 2018-08-14 | 中国农业科学院生物技术研究所 | A kind of gold label test strip detecting global regulation's factor IrrE albumen and its transgenic crop |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN201600373U (en) * | 2010-02-09 | 2010-10-06 | 中国农业科学院生物技术研究所 | Kit for joint inspection for IrrE protein and BT protein by one-step method |
CN201607443U (en) * | 2010-02-02 | 2010-10-13 | 中国农业科学院生物技术研究所 | Kit for quickly detecting salt resistant IrrE protein |
CN203849263U (en) * | 2013-11-19 | 2014-09-24 | 中国农业科学院生物技术研究所 | Gold immnnochromatography rapid combined measuring kit of global regulation and control factors IrrE, Csp (cold shock protein) and CarD proteins |
US20170016009A1 (en) * | 2014-04-16 | 2017-01-19 | Soochow University | Dna molecule used for recombinant pichia plasmid and recombinant pichia strain expressing ppri protein of deinococcus radiodurans |
-
2018
- 2018-02-06 CN CN201810118344.0A patent/CN108396012B/en active Active
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN201607443U (en) * | 2010-02-02 | 2010-10-13 | 中国农业科学院生物技术研究所 | Kit for quickly detecting salt resistant IrrE protein |
CN201600373U (en) * | 2010-02-09 | 2010-10-06 | 中国农业科学院生物技术研究所 | Kit for joint inspection for IrrE protein and BT protein by one-step method |
CN203849263U (en) * | 2013-11-19 | 2014-09-24 | 中国农业科学院生物技术研究所 | Gold immnnochromatography rapid combined measuring kit of global regulation and control factors IrrE, Csp (cold shock protein) and CarD proteins |
US20170016009A1 (en) * | 2014-04-16 | 2017-01-19 | Soochow University | Dna molecule used for recombinant pichia plasmid and recombinant pichia strain expressing ppri protein of deinococcus radiodurans |
Non-Patent Citations (4)
Title |
---|
HUIMING LU 等,: "DNA binding is essential for PprI function in response to radiation damage in Deinococcus radiodurans", 《DNA REPAIR》 * |
廖永强: "耐辐射奇球菌特有蛋白PprI的相互作用蛋白筛选", 《中国优秀硕士学位论文全文数据库基础科学辑》 * |
陈洁: "耐辐射球菌PprI蛋白对细胞增殖、毒性及动物免疫毒性的研究", 《中国优秀硕士学位论文全文数据库医药卫生科技辑》 * |
陈震: "耐辐射异常球菌全局调控蛋白IrrE的研究进展", 《生物技术进展》 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN108396013A (en) * | 2018-02-06 | 2018-08-14 | 中国农业科学院生物技术研究所 | A kind of gold label test strip detecting global regulation's factor IrrE albumen and its transgenic crop |
Also Published As
Publication number | Publication date |
---|---|
CN108396012B (en) | 2020-10-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN105154409B (en) | Hybridoma cell strain and its generate monoclonal antibody and they detection G2-EPSPS albumen in application | |
CN108486064B (en) | Hybridoma cell strain Anti-CLasMcAb1, monoclonal antibody secreted by hybridoma cell strain Anti-CLasMcAb1 and application of monoclonal antibody | |
CN108486063B (en) | Hybridoma cell strain Anti-CLas McAb2, monoclonal antibody secreted by hybridoma cell strain Anti-CLas McAb2 and application of monoclonal antibody | |
CN107099506A (en) | Porcine epidemic diarrhea virus double-antibody sandwich elisa immue quantitative detection reagent box and its application | |
CN107513521A (en) | Hybridoma cell strain, secreted monoclonal antibody and its application in bar/PAT albumen is detected | |
CN102453093A (en) | Screening and application of single-chain antibody against fumonisin | |
CN105154408B (en) | A kind of monoclonal antibody and application thereof of detection antiweed glyphosate albumen | |
CN105158475B (en) | For detect the monoclonal antibody of transgenic crop to and Double-antibody sandwich enzymelinked immunosorbent detection kit | |
CN108396012A (en) | Applications of the monoclonal antibody 1DB4 in detecting IrrE transgenic crops | |
CN110261606B (en) | Clostridium perfringens beta toxin antibody capture ELISA detection method | |
CN108414768B (en) | Gold-labeled detection test strip for glyphosate-resistant GAT transgenic crops | |
CN114280306B (en) | ELISA detection kit and detection method for eleusine indica EPSPS protein | |
CN110407939A (en) | A kind of anti-PSMA single-chain antibody of humanization and its application | |
CN110294803B (en) | Monoclonal antibody of Cry1Ah1 protein and application thereof | |
CN114280305A (en) | Eleusine indica EPSPS protein colloidal gold detection test paper and application thereof | |
CN107827981A (en) | The nano antibody of anti Bacillus pyocyaneu Flugge exotoxin A and its application | |
CN104231076B (en) | The therapeutic monoclonal antibodies of anti-coli-infection, produce hybridoma cell strain of the monoclonal antibody and application thereof | |
CN108395477A (en) | Purposes of the monoclonal antibody FB9b in detecting GAT transgenic crops | |
CN108047330B (en) | Monoclonal antibody of Cry2Ah1 protein | |
CN108396013B (en) | Gold-labeled test strip for detecting global regulatory factor IrrE protein and transgenic crops thereof | |
CN107964537A (en) | For detecting monoclonal antibody and its application of GR79 genetically modified plants | |
CA2160780C (en) | Cold-tolerant strains of rhizobium species | |
CN109970854B (en) | Tyrophagus putrescentiae Der p10 monoclonal antibody and preparation method and application thereof | |
CN110759988B (en) | Application of porcine NLRP3 truncated fragment as antigen structural protein | |
CN116178512B (en) | Polypeptide simulating common structure and function of Bt Cry toxins, and coding gene and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |