CN107975731A - A kind of orientable laser illuminator system - Google Patents
A kind of orientable laser illuminator system Download PDFInfo
- Publication number
- CN107975731A CN107975731A CN201710971387.9A CN201710971387A CN107975731A CN 107975731 A CN107975731 A CN 107975731A CN 201710971387 A CN201710971387 A CN 201710971387A CN 107975731 A CN107975731 A CN 107975731A
- Authority
- CN
- China
- Prior art keywords
- housing
- lampshade
- handle
- illuminator system
- laser
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21S—NON-PORTABLE LIGHTING DEVICES; SYSTEMS THEREOF; VEHICLE LIGHTING DEVICES SPECIALLY ADAPTED FOR VEHICLE EXTERIORS
- F21S8/00—Lighting devices intended for fixed installation
- F21S8/04—Lighting devices intended for fixed installation intended only for mounting on a ceiling or the like overhead structures
- F21S8/06—Lighting devices intended for fixed installation intended only for mounting on a ceiling or the like overhead structures by suspension
- F21S8/063—Lighting devices intended for fixed installation intended only for mounting on a ceiling or the like overhead structures by suspension with a rigid pendant, i.e. a pipe or rod
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V19/00—Fastening of light sources or lamp holders
- F21V19/001—Fastening of light sources or lamp holders the light sources being semiconductors devices, e.g. LEDs
- F21V19/0015—Fastening arrangements intended to retain light sources
- F21V19/0025—Fastening arrangements intended to retain light sources the fastening means engaging the conductors of the light source, i.e. providing simultaneous fastening of the light sources and their electric connections
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V21/00—Supporting, suspending, or attaching arrangements for lighting devices; Hand grips
- F21V21/40—Hand grips
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V3/00—Globes; Bowls; Cover glasses
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V33/00—Structural combinations of lighting devices with other articles, not otherwise provided for
- F21V33/008—Leisure, hobby or sport articles, e.g. toys, games or first-aid kits; Hand tools; Toolboxes
- F21V33/0084—Hand tools; Toolboxes
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21Y—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES F21K, F21L, F21S and F21V, RELATING TO THE FORM OR THE KIND OF THE LIGHT SOURCES OR OF THE COLOUR OF THE LIGHT EMITTED
- F21Y2113/00—Combination of light sources
- F21Y2113/20—Combination of light sources of different form
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21Y—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES F21K, F21L, F21S and F21V, RELATING TO THE FORM OR THE KIND OF THE LIGHT SOURCES OR OF THE COLOUR OF THE LIGHT EMITTED
- F21Y2115/00—Light-generating elements of semiconductor light sources
- F21Y2115/30—Semiconductor lasers
Landscapes
- Engineering & Computer Science (AREA)
- General Engineering & Computer Science (AREA)
- Non-Portable Lighting Devices Or Systems Thereof (AREA)
Abstract
The present invention provides a kind of orientable laser illuminator system, including housing, housing upper end are connected with link, housing side is connected with lampshade, housing opposite side lower end is equipped with wire inlet-outlet, and housing lower end center is connected with handle, and enclosure interior is equipped with headlamp and laser generator.It is hangable that link has the function of the present apparatus, improves the present apparatus and fixes freedom；Lampshade has protective effect to the element of enclosure interior, and lampshade translucency is good, avoids the weakening to laser and illumination light；Equipped with wire inlet-outlet, electric wire involved by the present apparatus is discharged in order, improve device reliability.The present apparatus is easy to use, fixed form variation, accurate positioning and reliability height.
Description
Technical field
The invention belongs to a kind of laser illuminator system, and in particular to a kind of orientable laser illuminator system.
Background technology
Since laser was 20th century, after atomic energy, computer, semiconductor, the another invention of great significance of the mankind, is referred to as
" most fast knife ", " most accurate ruler ", " most bright light ".Just emitted from the atom of component, atom obtains energy
Play pendulum after amount（Namely excited state）, it can go out energy transmitting in the form of photon.And laser, it is exactly
It is attracted（Excitation）Photon queue out, the photons in this photon queue, optical characteristics is the same, and step is extremely consistent.
Illumination is that the measure of work and life area or item is illuminated using various light sources.Utilize the sun and skylight
Title " natural lighting "；Utilize the title " artificial light " of artificial light source.The primary and foremost purpose of illumination be create good visibility and
Comfortable pleasant environment.
With the increasing of pit mining intensity and scope, drift section continues to increase, and the security incident of appearance increases, not only
Personnel and equipment to roadway construction constitute direct threat, and influence construction speed, and in mining process, illumination is one
Particularly important factor.
Such as, Chinese invention patent mandate document, Authorization Notice No. is the prior art：102980154 B of CN, the invention carry
Go out a kind of laser illuminator system and mine equipment.The laser illuminator system, is arranged on mine equipment, the laser illuminator system
Including body and the headlamp being arranged in the body, the laser emitter for positioning bore position.The invention is provided
Laser illuminator system can mine equipment work during provide abundance light source, easy to construction operation.In addition, should
Also bore position can be accurately positioned by laser emitter in laser illuminator system, improve positioning accuracy and work efficiency, but should
The device of invention is not fixed easily during mining use, or is fixed built on the sand, phenomena such as rocking, shifting often occurs, so as to
It can influence being normally carried out for mining.
The content of the invention
Applied widely it is an object of the invention to provide a kind of headlamp good illumination effect, device can be used for positioning, and
Device fixed form itself is various, and device functional reliability is high, and stability is good, can effectively improve work efficiency under lighting condition
Orientable laser illuminator system.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of orientable laser illuminator system, including
Housing, housing upper end are connected with link, and housing side is connected with lampshade, and housing opposite side lower end is equipped with wire inlet-outlet, under housing
End center is connected with handle, and enclosure interior is equipped with headlamp and laser generator.It is hangable that link has the function of the present apparatus,
Improve the present apparatus and fix freedom；Lampshade has protective effect to the element of enclosure interior, and lampshade translucency is good, avoids to swashing
The weakening of light and illumination light；Equipped with wire inlet-outlet, electric wire involved by the present apparatus is discharged in order, improve device reliability；Hand
Handle makes the present apparatus to facilitate to pick and place and fixed, improves the diversity of device fixed form and convenience that device uses, shines
Bright lamp provides illumination for mining, and coordinates laser caused by laser generator so that the present apparatus has in mining process
The effect of positioning, the penetrability of laser is strong, and light beam is concentrated, and can be accurately positioned, and improves mining accuracy, improves in mining process
Security.The present apparatus is easy to use, fixed form variation, accurate positioning and reliability height.
Preferably, being connected with fixed plate on the inside of lampshade, fixed plate center is connected with laser generator, and fixed plate side is set
There is reflectance coating, headlamp is set around laser generator.Fixed plate, to be threadedly coupled, is threadedly coupled not only with laser generator
It can be easy to the dismounting and change of laser generator, can also make laser generator that there is cushion space when device collides, reduce
Damage to laser generator；The reflectance coating that fixed plate is equipped with causes the loss of laser and illumination light in the device to reduce, to carry
The illumination of high device and locating effect；Headlamp is set around laser generator, can be improved the illuminating effect of headlamp, be made light
Homogeneous soft.
Preferably, handle is connected by telescopic rod with housing, handle side is equipped with the annular distance that caves in, and the annular distance inner wall that caves in is set
There is screw thread, the depth L1 for the annular distance that caves in and the radius R1 ratios of handle are 1:4.2~5.1.When handle is fixed, adjustable handle connects
The length of the telescopic rod connect, makes device reach effective illumination；The annular distance that caves in of handle is easy to the fixation of handle；Cave in annular distance
The screw thread of wall, can not only increase annular distance inner wall frictional force of caving in, the fixed effect of lifting handle, can also be only suitable for being screwed
When the effective position that is screwed is provided, stealthy increase fixed form, is obviously improved device convenience；Cave in annular distance and handle
The ratio being equipped with so that the annular distance that caves in does not influence handle strength, can also improve handle fixed effect, mitigates the quality of handle, just
In carrying.
Preferably, headlamp surface is equipped with lampshade, lampshade is made of polylith vane plate, vane plate outer edge
Upper end is equipped with slideway, and vane plate outer edge lower end is equipped with sliding block, and vane plate forms horn shape by slideway and sliding block.Reflector lamp
Cover is made of polylith vane plate, and the slideway and sliding block of blade plate surface to be connected between each vane plate, and have sliding function；
Vane plate with sliding function make it that lampshade is scalable, and scalable lampshade can control what headlamp was sent
The poly- scattered property of light, available for large-scale illumination, it can also be used to the irradiation of focusing, increases the applicable situation of the present apparatus, and not
The lampshade of transparent adjustable size can adjust lamps and lanterns shielding angle, it is possible to increase prevent the scope of dazzle, lampshade it is collapsible
Property causes the changeable working status of the present apparatus, significantly improves illuminating effect and the scope of application.
Preferably, vane plate inward flange is connected to rotation axis, vane plate medial surface is equipped with reflector layer.Rotation axis makes reflective
The control of lampshade precisely facilitates, and reflector layer reduces loss of the light inside lampshade, not only improves utilization rate of electrical, also
Light intensity is improved, lifts illuminating effect.Axis connection control motor is rotated, by the button control motor rotation positioned at surface of shell
To adjust the poly- scattered property of light, control mode is simply accurate.
Preferably, wiring frame is divided into two layers up and down, drier built in upper-layer wirings frame, upper-layer wirings frame surface is evenly equipped with
Air hole, the built-in connection electric wire of lower-layer wiring frame.Drier built in upper-layer wirings frame can keep the dry environment of enclosure interior,
Avoiding device from making moist influences work, is also prevented from electronic component because short circuit phenomenon occurs for steam, improves device functional reliability；Under
Layer wiring frame places electric wire set in order, is repaired easy to device, also improves device reliability.
Preferably, link is divided into vertical ring and inclined ring, vertical ring is connected to housing side, and inclined ring is connected to housing
Opposite side, the length of vertical ring and the length ratio of inclined ring are 1:1.8~2.6.Link can be used for hanging the present apparatus, vertical ring and
Inclined ring makes device fixing-stable, avoids rocking rotation, the length ratio of vertical ring and inclined ring makes device after hanging have
Suitable range of exposures, and make both stress more uniform, improve fixed effect.
Compared with prior art, beneficial effects of the present invention are:1）The present apparatus is easy to use, fixed form variation, fixed
Level is true and reliability is high；2）The reflectance coating that fixed plate is equipped with causes the loss of laser and illumination light in the device to reduce, to carry
The illumination of high device and locating effect；3）Handle strength is high, can multimode fix, and good fixing effect, light weight；4）Reflector lamp
The contractility of cover causes the changeable working status of the present apparatus, significantly improves illuminating effect and the scope of application.
Present invention employs above-mentioned technical proposal to provide a kind of orientable laser illuminator system, compensate for the prior art
Deficiency, design is reasonable, easy to operate.
Brief description of the drawings
Fig. 1 is the sectional view of apparatus of the present invention；
Fig. 2 is the right view of apparatus of the present invention；
Fig. 3 is schematic diagram when lampshade of the present invention is unfolded；
Fig. 4 is schematic diagram when lampshade of the present invention is shunk；
Fig. 5 is the structure diagram of vane plate of the present invention；
Fig. 6 is the connection diagram of lampshade of the present invention and rotation axis；
Fig. 7 is the structure diagram of handle of the present invention.
Description of reference numerals：1 housing；2 links；3 headlamps；301 lampshades；302 sliding blocks；303 reflector layers；304 slide
Road；305 rotation axis；4 laser generators；5 lampshades；6 wiring frames；7 wire inlet-outlets；8 handles；9 fixed plates.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 7, a kind of orientable laser illuminator system, including housing 1,1 upper end of housing are connected with link 2, housing 1
Side is connected with lampshade 5, and 1 opposite side lower end of housing is equipped with wire inlet-outlet 7, and 1 lower end center of housing is connected with handle 8, in housing 1
Portion is equipped with headlamp 3 and laser generator 4.The inner side of lampshade 5 is connected with fixed plate 9, and 9 center of fixed plate is connected with laser generator
4,9 side of fixed plate is equipped with reflectance coating, and headlamp 3 is set around laser generator 4.Handle 8 is connected by telescopic rod and housing 1
Connect, 8 side of handle is equipped with the annular distance that caves in, and the annular distance inner wall that caves in is equipped with screw thread, the depth L1 for the annular distance that the caves in and radius R1 of handle 8
Than for 1:4.5.3 surface of headlamp is equipped with lampshade 301, and lampshade 301 is made of polylith vane plate, vane plate outer edge
Upper end is equipped with slideway 304, and vane plate outer edge lower end is equipped with sliding block 302, and vane plate forms loudspeaker by slideway 304 and sliding block 302
Shape.Vane plate inward flange is connected to rotation axis 305, and vane plate medial surface is equipped with reflector layer 303.Wiring frame 6 divides to be upper and lower
Two layers, drier built in upper-layer wirings frame 6,6 surface of upper-layer wirings frame is evenly equipped with air hole, the built-in connection electricity of lower-layer wiring frame 6
Line.Link 2 divides is connected to 1 side of housing for vertical ring and inclined ring, vertical ring, and inclined ring is connected to 1 opposite side of housing, vertically
The length of ring and the length ratio of inclined ring are 1:2.
The present apparatus is easy to use, fixed form variation, accurate positioning and reliability height；The reflectance coating that fixed plate 9 is equipped with
So that the loss of laser and illumination light in the device reduces, to improve the illumination of device and locating effect；Handle Final 8 degree is high, can
Multimode is fixed, and good fixing effect, light weight；The contractility of lampshade 301 causes the changeable working status of the present apparatus,
Significantly improve illuminating effect and the scope of application.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 2：
As shown in Fig. 1 ~ 7, a kind of orientable laser illuminator system, including housing 1,1 upper end of housing are connected with link 2, housing 1
Side is connected with lampshade 5, and 1 opposite side lower end of housing is equipped with wire inlet-outlet 7, and 1 lower end center of housing is connected with handle 8, in housing 1
Portion is equipped with headlamp 3 and laser generator 4.It is hangable that link 2 has the function of the present apparatus, improves the present apparatus and fixes freely
Property；Lampshade 5 has the element inside housing 1 protective effect, and 5 translucency of lampshade is good, avoids cutting laser and illumination light
It is weak；Equipped with wire inlet-outlet 7, electric wire involved by the present apparatus is discharged in order, improve device reliability；Handle 8 makes the present apparatus can
It is convenient to pick and place and fixed, improve the diversity of device fixed form and convenience that device uses, headlamp 3 carry for mining
For illumination, and coordinating laser caused by laser generator 4 so that the present apparatus has the function that positioning in mining process,
The penetrability of laser is strong, and light beam is concentrated, and can be accurately positioned, and improves mining accuracy, improves the security in mining process.This
Device is easy to use, fixed form variation, accurate positioning and reliability height.
The inner side of lampshade 5 is connected with fixed plate 9, and 9 center of fixed plate is connected with laser generator 4, and 9 side of fixed plate is equipped with anti-
Film is penetrated, headlamp 3 is set around laser generator 4.Fixed plate 9, to be threadedly coupled, is threadedly coupled not only with laser generator 4
It can be easy to the dismounting and change of laser generator 4, can also make laser generator 4 that there is cushion space when device collides, drop
The low damage to laser generator 4；The reflectance coating that fixed plate 9 is equipped with causes the loss of laser and illumination light in the device to reduce,
To improve the illumination of device and locating effect；Headlamp 3 is set around laser generator 4, can improve the illumination effect of headlamp 3
Fruit, makes light homogeneous soft.
Handle 8 is connected by telescopic rod with housing 1, and 8 side of handle is equipped with the annular distance that caves in, and the annular distance inner wall that caves in is equipped with spiral shell
Line, the depth L1 for the annular distance that caves in are 1 with the radius R1 ratios of handle 8:5.When handle 8 is fixed, adjustable handle 8 connects flexible
The length of bar, makes device reach effective illumination；The annular distance that caves in of handle 8 is easy to the fixation of handle 8；Cave in the spiral shell of annular distance inner wall
Line, can not only increase annular distance inner wall frictional force of caving in, the fixed effect of lifting handle 8, can also carry when being only suitable for being screwed
For the effective position that is screwed, stealthy increase fixed form, is obviously improved device convenience；The annular distance that caves in is equipped with handle
Ratio so that the annular distance that caves in does not influence handle Final 8 degree, can also improve 8 fixed effect of handle, mitigates the quality of handle 8, is easy to
Carry.
3 surface of headlamp is equipped with lampshade 301, and lampshade 301 is made of polylith vane plate, on vane plate outer edge
End is equipped with slideway 304, and vane plate outer edge lower end is equipped with sliding block 302, and vane plate forms loudspeaker by slideway 304 and sliding block 302
Shape.Lampshade 301 is made of polylith vane plate, and the slideway 304 and sliding block 302 of blade plate surface are so that between each vane plate
It is connected, and there is sliding function；Vane plate with sliding function make it that lampshade 301 is scalable, scalable reflector lamp
The poly- of light that cover 301 can control headlamp 3 to be sent dissipates property, available for large-scale illumination, it can also be used to the irradiation of focusing,
The applicable situation of the present apparatus is increased, and the lampshade of opaque adjustable size can adjust lamps and lanterns shielding angle, it is possible to increase prevent
The scope of dazzle, the contractility of lampshade 301 cause the changeable working status of the present apparatus, significantly improve illuminating effect and fit
Use scope.
Vane plate inward flange is connected to rotation axis 305, and vane plate medial surface is equipped with reflector layer 303.Rotation axis 305 makes reflective
The control of lampshade 301 precisely facilitates, and reflector layer 303 reduces loss of the light inside lampshade 301, not only improves electric energy
Utilization rate, also improves light intensity, lifts illuminating effect.The connection control motor of rotation axis 305, by pressing positioned at 1 surface of housing
Button control motor is rotated to adjust the poly- scattered property of light, and control mode is simply accurate.
Wiring frame 6 divides for upper and lower two layers, and drier built in upper-layer wirings frame 6,6 surface of upper-layer wirings frame is evenly equipped with ventilative
Hole, the built-in connection electric wire of lower-layer wiring frame 6.Drier built in upper-layer wirings frame 6 can keep the dry environment inside housing 1,
Avoiding device from making moist influences work, is also prevented from electronic component because short circuit phenomenon occurs for steam, improves device functional reliability；Under
Layer wiring frame 6 places electric wire set in order, is repaired easy to device, also improves device reliability；The component of drier and its again
Measuring part is：2 ~ 6 parts of anhydrous calcium chloride, 6 ~ 9 parts of calcium chloride dihydrate, 0.5 ~ 1.4 part of polyacrylamide, 0.9 ~ 1.2 part of plant amylum,
The preparation method of this drier is to mix mentioned component, adds 0.3 ~ 0.6 part of adhesive, is suppressed using sheet mold, obtain piece
Shape drier.This drier is sheet, and the inner space of maximizing land productivity upper strata wiring frame, its drying effect is good, dry
Time is grown, wherein, adhesive is bentonite and active peptides, both mass ratioes are 1:0.2 ~ 0.4, the amino acid of active peptides
Sequence is：TDHQMAQSACIGVSQDNAYASAPRDCHGGKTCEGICDATATMDRYSDTGGPLSTARCVNAFHFYKRRGEE
NVSYKPFVVSWKYGVAGCFYTHCGPNFCCCIS, the addition of active peptides is so that the effect of adhesive is far superior to single make
Bonding effect during with bentonite, the active peptides of addition can increase permeability of the bentonite to bonding substrates, improve and bond base
Stable connection between material, make between bonding substrates can long-acting bonding, lift the mechanical performance of drier, extend drier
Service life.
Link 2 divides is connected to 1 side of housing for vertical ring and inclined ring, vertical ring, and it is another that inclined ring is connected to housing 1
Side, the length of vertical ring and the length ratio of inclined ring are 1:2.3.Link 2 can be used for hanging the present apparatus, and vertical ring and inclined ring make
Device fixing-stable, avoids rocking rotation, the length ratio of vertical ring and inclined ring makes device have suitable photograph after hanging
Scope is penetrated, and makes both stress more uniform, improves fixed effect.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, can also make a variety of changes and modification.Therefore, it is all equivalent
Technical solution fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Sea salt sends Mortopl Science and Technology Ltd.
<120>A kind of orientable laser illuminator system
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 102
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
Thr Asp His Gln Met Ala Gln Ser Ala Cys Ile Gly Val Ser Gln Asp
1 5 10 15
Asn Ala Tyr Ala Ser Ala Pro Arg Asp Cys His Gly Gly Lys Thr Cys
20 25 30
Glu Gly Ile Cys Asp Ala Thr Ala Thr Met Asp Arg Tyr Ser Asp Thr
35 40 45
Gly Gly Pro Leu Ser Thr Ala Arg Cys Val Asn Ala Phe His Phe Tyr
50 55 60
Lys Arg Arg Gly Glu Glu Asn Val Ser Tyr Lys Pro Phe Val Val Ser
65 70 75 80
Trp Lys Tyr Gly Val Ala Gly Cys Phe Tyr Thr His Cys Gly Pro Asn
85 90 95
Phe Cys Cys Cys Ile Ser
100
Claims (7)
1. a kind of orientable laser illuminator system, including housing（1）, it is characterised in that the housing（1）Upper end is connected with
Link（2）, the housing（1）Side is connected with lampshade（5）, the housing（1）Opposite side lower end is equipped with wire inlet-outlet
（7）, the housing（1）Lower end center is connected with handle（8）, the housing（1）It is internally provided with headlamp（3）Sent out with laser
Raw device（4）.
A kind of 2. orientable laser illuminator system according to claim 1, it is characterised in that the lampshade（5）It is interior
Side is connected with fixed plate（9）, the fixed plate（9）Center is connected with laser generator（4）, the fixed plate（9）Side
Equipped with reflectance coating, the headlamp（3）Around laser generator（4）Set.
A kind of 3. orientable laser illuminator system according to claim 1, it is characterised in that the handle（8）It is logical
Cross telescopic rod and housing（1）Connection, the handle（8）Side is equipped with the annular distance that caves in, and the annular distance inner wall that caves in is equipped with spiral shell
Line, the depth L1 and handle of the annular distance that caves in（8）Radius R1 ratios be 1:4.2~5.1.
A kind of 4. orientable laser illuminator system according to claim 1, it is characterised in that the headlamp（3）
Surface is equipped with lampshade（301）, the lampshade（301）It is made of polylith vane plate, the vane plate outer edge
Upper end is equipped with slideway（304）, the vane plate outer edge lower end is equipped with sliding block（302）, the vane plate passes through slideway
（304）And sliding block（302）Form horn shape.
A kind of 5. orientable laser illuminator system according to claim 4, it is characterised in that the vane plate inner edge
Edge is connected to rotation axis（305）, the vane plate medial surface is equipped with reflector layer（303）.
A kind of 6. orientable laser illuminator system according to claim 1, it is characterised in that the wiring frame（6）
It is divided into two layers up and down, the upper-layer wirings frame（6）Built-in drier, the upper-layer wirings frame（6）Surface is evenly equipped with ventilative
Hole, the lower-layer wiring frame（6）Built-in connection electric wire.
A kind of 7. orientable laser illuminator system according to claim 1, it is characterised in that the link（2）Point
For vertical ring and inclined ring, the vertical ring is connected to housing（1）Side, the inclined ring are connected to housing（1）It is another
Side, the length of the vertical ring and the length ratio of inclined ring are 1:1.8~2.6.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710971387.9A CN107975731A (en) | 2017-10-18 | 2017-10-18 | A kind of orientable laser illuminator system |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710971387.9A CN107975731A (en) | 2017-10-18 | 2017-10-18 | A kind of orientable laser illuminator system |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107975731A true CN107975731A (en) | 2018-05-01 |
Family
ID=62012506
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710971387.9A Withdrawn CN107975731A (en) | 2017-10-18 | 2017-10-18 | A kind of orientable laser illuminator system |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107975731A (en) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102980154A (en) * | 2012-10-22 | 2013-03-20 | 三一重型装备有限公司 | Laser lighting device and mining machine |
| CN203771335U (en) * | 2014-03-17 | 2014-08-13 | 宁波唯嘉电子科技有限公司 | Telescopic working lamp |
| CN105841093A (en) * | 2016-04-29 | 2016-08-10 | 汤志生 | Dimmable lamp and installation method thereof |
| CN205824854U (en) * | 2016-05-26 | 2016-12-21 | 深圳市雷焱照明科技有限公司 | A kind of Projecting Lamp with expansion link |
-
2017
- 2017-10-18 CN CN201710971387.9A patent/CN107975731A/en not_active Withdrawn
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102980154A (en) * | 2012-10-22 | 2013-03-20 | 三一重型装备有限公司 | Laser lighting device and mining machine |
| CN203771335U (en) * | 2014-03-17 | 2014-08-13 | 宁波唯嘉电子科技有限公司 | Telescopic working lamp |
| CN105841093A (en) * | 2016-04-29 | 2016-08-10 | 汤志生 | Dimmable lamp and installation method thereof |
| CN205824854U (en) * | 2016-05-26 | 2016-12-21 | 深圳市雷焱照明科技有限公司 | A kind of Projecting Lamp with expansion link |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2016201597A1 (en) | Head-sensing headlamp device | |
| CN207279328U (en) | A kind of portable multi-function moves lighting device | |
| CN107975731A (en) | A kind of orientable laser illuminator system | |
| CN205579436U (en) | Solar energy LED landscape lamp of angle modulation can carry out | |
| CN107975706A (en) | A kind of mine laser lighting device | |
| CN208381925U (en) | A kind of tracing type stage searchlight | |
| CN106322166A (en) | Head induction head lamp device | |
| CN207849207U (en) | A kind of High-Pole Lamp being conveniently replaceable headlamp | |
| JP2006049283A (en) | Luminous body | |
| CN205101971U (en) | Anti -dazzle lamps and lanterns of LED | |
| CN209745283U (en) | Novel forward-looking light-emitting prism | |
| RU2014130251A (en) | EXTERIOR LIGHTING LAMP | |
| CN206831306U (en) | A kind of big long lifespan LED floodlight of coverage rate | |
| CN208566449U (en) | A kind of portable Projecting Lamp showing electricity | |
| CN202884739U (en) | Police vehicle-mounted lighting, glare and directional strong voice stopping system | |
| RU179983U1 (en) | The lamp for illumination of road crosswalks | |
| CN2637895Y (en) | Lighting lamps and lanterns made of natural rock | |
| CN206300066U (en) | A kind of Outdoor wall lamp | |
| CN209101218U (en) | Luminaire | |
| CN208817199U (en) | A kind of lamps and lanterns with not specification curved-surface structure | |
| CN213746362U (en) | LED projecting lamp of illumination angularly adjustable | |
| CN215096716U (en) | Handicraft with fountain light source | |
| CN208025255U (en) | A kind of special stage lighting of high-power concert | |
| CN211597242U (en) | Building curtain wall | |
| CN213577165U (en) | Sealed effectual projecting lamp shell |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20180501 |