CN107975706A - A kind of mine laser lighting device - Google Patents
A kind of mine laser lighting device Download PDFInfo
- Publication number
- CN107975706A CN107975706A CN201710972894.4A CN201710972894A CN107975706A CN 107975706 A CN107975706 A CN 107975706A CN 201710972894 A CN201710972894 A CN 201710972894A CN 107975706 A CN107975706 A CN 107975706A
- Authority
- CN
- China
- Prior art keywords
- housing
- lighting device
- lampshade
- laser
- headlamp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21S—NON-PORTABLE LIGHTING DEVICES; SYSTEMS THEREOF; VEHICLE LIGHTING DEVICES SPECIALLY ADAPTED FOR VEHICLE EXTERIORS
- F21S8/00—Lighting devices intended for fixed installation
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V14/00—Controlling the distribution of the light emitted by adjustment of elements
- F21V14/04—Controlling the distribution of the light emitted by adjustment of elements by movement of reflectors
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V19/00—Fastening of light sources or lamp holders
- F21V19/001—Fastening of light sources or lamp holders the light sources being semiconductors devices, e.g. LEDs
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V21/00—Supporting, suspending, or attaching arrangements for lighting devices; Hand grips
- F21V21/14—Adjustable mountings
- F21V21/22—Adjustable mountings telescopic
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V31/00—Gas-tight or water-tight arrangements
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21V—FUNCTIONAL FEATURES OR DETAILS OF LIGHTING DEVICES OR SYSTEMS THEREOF; STRUCTURAL COMBINATIONS OF LIGHTING DEVICES WITH OTHER ARTICLES, NOT OTHERWISE PROVIDED FOR
- F21V7/00—Reflectors for light sources
- F21V7/0025—Combination of two or more reflectors for a single light source
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F21—LIGHTING
- F21Y—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES F21K, F21L, F21S and F21V, RELATING TO THE FORM OR THE KIND OF THE LIGHT SOURCES OR OF THE COLOUR OF THE LIGHT EMITTED
- F21Y2115/00—Light-generating elements of semiconductor light sources
- F21Y2115/30—Semiconductor lasers
Landscapes
- Engineering & Computer Science (AREA)
- General Engineering & Computer Science (AREA)
- Non-Portable Lighting Devices Or Systems Thereof (AREA)
Abstract
The present invention provides a kind of mine laser lighting device, including housing, housing upper end are connected with link, and housing side is connected with lampshade, and housing opposite side is connected with collapsible rod, and housing lower end is connected with wire inlet-outlet, and enclosure interior is equipped with headlamp and laser generator.Headlamp provides illumination for mining, and coordinates laser caused by laser generator so that the present apparatus has the function that positioning in mining process, the penetrability of laser is strong, and light beam is concentrated, and can be accurately positioned, mining accuracy is improved, improves the security in mining process.The present apparatus is easy to use, and fixed form variation, illumination zone is big, and accurately and securely property is high for positioning stablity.
Description
Technical field
The invention belongs to a kind of laser illuminator system, and in particular to a kind of mine laser lighting device.
Background technology
Since laser was 20th century, after atomic energy, computer, semiconductor, the another invention of great significance of the mankind, is referred to as
" most fast knife ", " most accurate ruler ", " most bright light ".Just emitted from the atom of component, atom obtains energy
Play pendulum after amount（Namely excited state）, it can go out energy transmitting in the form of photon.And laser, it is exactly
It is attracted（Excitation）Photon queue out, the photons in this photon queue, optical characteristics is the same, and step is extremely consistent.
Illumination is that the measure of work and life area or item is illuminated using various light sources.Utilize the sun and skylight
Title " natural lighting "；Utilize the title " artificial light " of artificial light source.The primary and foremost purpose of illumination be create good visibility and
Comfortable pleasant environment.
With the increasing of pit mining intensity and scope, drift section continues to increase, and the security incident of appearance increases, not only
Personnel and equipment to roadway construction constitute direct threat, and influence construction speed, and in mining process, illumination is one
Particularly important factor.
Such as, Chinese invention patent mandate document, Authorization Notice No. is the prior art：102980154 B of CN, the invention carry
Go out a kind of laser illuminator system and mine equipment.The laser illuminator system, is arranged on mine equipment, the laser illuminator system
Including body and the headlamp being arranged in the body, the laser emitter for positioning bore position.The invention is provided
Laser illuminator system can mine equipment work during provide abundance light source, easy to construction operation.In addition, should
Also bore position can be accurately positioned by laser emitter in laser illuminator system, improve positioning accuracy and work efficiency, but should
The device of invention is not fixed easily during mining use, or is fixed built on the sand, phenomena such as rocking, shifting often occurs, so as to
It can influence being normally carried out for mining.
The content of the invention
It is an object of the invention to provide a kind of headlamp good illumination effect, illumination zone is wide, and device can be used for positioning, and
Device fixed form itself is various, and fixed validity and freedom are high, and device functional reliability is high, can effectively improve getter
Make the mine laser lighting device of efficiency.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of mine laser lighting device, including housing,
Housing upper end is connected with link, and housing side is connected with lampshade, and housing opposite side is connected with collapsible rod, and housing lower end is connected with
Wire inlet-outlet, enclosure interior are equipped with headlamp and laser generator.It is hangable that link has the function of the present apparatus, improves this dress
Put fixed freedom；Lampshade has protective effect to the element of enclosure interior, and lampshade translucency is good, avoids to laser and illumination
The weakening of light；Equipped with wire inlet-outlet, electric wire involved by the present apparatus is discharged in order, improve device reliability；Collapsible rod makes
Device after fixation can have left and right and the scope slided up and down, and device is it also avoid while present apparatus illumination zone is expanded
Frequent dismounting；Headlamp provides illumination for mining, and coordinates laser caused by laser generator so that in mining process
The middle present apparatus has the function that positioning, and the penetrability of laser is strong, and light beam is concentrated, and can be accurately positioned, and improves mining accuracy, lifting
Security in mining process.The present apparatus is easy to use, and fixed form variation, illumination zone is big, positioning stablity it is accurate and
Reliability is high.
To optimize above-mentioned technical proposal, the measure taken further includes：Fixed plate, fixed plate center are connected with the inside of lampshade
Laser generator is connected with, fixed plate side is equipped with reflectance coating, and headlamp is set around laser generator.Fixed plate is sent out with laser
Raw device is threadedly coupled the dismounting and change that may not only facilitate laser generator, can also make laser generator in device to be threadedly coupled
There is cushion space when colliding, reduce the damage to laser generator；The reflectance coating that fixed plate is equipped with causes laser and photograph
The loss of Mingguang City in the device reduces, to improve the illumination of device and locating effect；Headlamp is set around laser generator, can
The illuminating effect of headlamp is improved, makes light homogeneous soft.
Preferably, collapsible rod both ends are equipped with mounting hole, collapsible rod side is equipped with foldable slideway, in collapsible rod
Embedding to be connected with fixing piece, collapsible rod is divided into three sections by two shafts.Collapsible rod by shaft foldable, is reduced when not in use
The space hold of collapsible rod, carries easy to device；When using collapsible rod, collapsible rod is unfolded and is fixed on suitable position
Put, then device can be realized without dismounting, you can change fixed position, not only increase the utilization rate in mining space, and avoid
The frequent dismounting of device, improves service using life, and moves left and right, can advantageously expansion instrument illumination zone.
Preferably, fixing piece includes support slipper, support slipper is embedded in foldable slideway, the connection of support slipper upper end
There is telescopic rod, telescopic rod upper end is connected with fixed block.The support slipper back side is equipped with convex block, and convex block is embedded in foldable slideway, real
Existing device moves left and right, and housing is fixed on, and the flexible of telescopic rod may be implemented in when need not dismantle, and lifting device height, changes
Become illumination zone to suitable scope.Collapsible rod is once fixed, and device can be made to realize that position up and down is moved, its is right
It is unexpected that convenience is brought using work, greatly improves mining activity efficiency, and the structure of collapsible rod is simple, carries
It is convenient, there is preferable prospect of the application in terms of fixation, can significant increase fixation validity and freedom.
Preferably, headlamp surface is equipped with lampshade, lampshade is made of polylith vane plate, vane plate outer edge
Upper end is equipped with slideway, and vane plate outer edge lower end is equipped with sliding block, and vane plate forms horn shape by slideway and sliding block.Reflector lamp
Cover is made of polylith vane plate, and the slideway and sliding block of blade plate surface to be connected between each vane plate, and have sliding function；
Vane plate with sliding function make it that lampshade is scalable, and scalable lampshade can control what headlamp was sent
The poly- scattered property of light, available for large-scale illumination, it can also be used to the irradiation of focusing, increases the applicable situation of the present apparatus, and not
The lampshade of transparent adjustable size can adjust lamps and lanterns shielding angle, it is possible to increase prevent the scope of dazzle, lampshade it is collapsible
Property causes the changeable working status of the present apparatus, significantly improves illuminating effect and the scope of application.
Preferably, vane plate inward flange is connected to rotation axis, vane plate medial surface is equipped with reflector layer.Rotation axis makes reflective
The control of lampshade precisely facilitates, and reflector layer reduces loss of the light inside lampshade, not only improves utilization rate of electrical, also
Light intensity is improved, lifts illuminating effect.Axis connection control motor is rotated, by the button control motor rotation positioned at surface of shell
To adjust the poly- scattered property of light, control mode is simply accurate.
Preferably, wiring frame is divided into two layers up and down, drier built in upper-layer wirings frame, upper-layer wirings frame surface is evenly equipped with
Air hole, the built-in connection electric wire of lower-layer wiring frame.Drier built in upper-layer wirings frame can keep the dry environment of enclosure interior,
Avoiding device from making moist influences work, is also prevented from electronic component because short circuit phenomenon occurs for steam, improves device functional reliability；Under
Layer wiring frame places electric wire set in order, is repaired easy to device, also improves device reliability.
Preferably, link is divided into vertical ring and inclined ring, vertical ring is connected to housing side, and inclined ring is connected to housing
Opposite side, the length of vertical ring and the length ratio of inclined ring are 1:1.8~2.6.Link can be used for hanging the present apparatus, vertical ring and
Inclined ring makes device fixing-stable, avoids rocking rotation, the length ratio of vertical ring and inclined ring makes device after hanging have
Suitable range of exposures, and make both stress more uniform, improve fixed effect.
Compared with prior art, beneficial effects of the present invention are:1）The present apparatus is easy to use, and fixed form variation, shines
Bright scope is big, and accurately and securely property is high for positioning stablity；2）The reflectance coating that fixed plate is equipped with causes laser and illumination light in the device
Loss reduce, to improve the illumination of device and locating effect；3）Collapsible rod is once fixed, and device can be made to realize upper bottom left
Right position movement, greatly improves mining activity efficiency, and can the validity fixed of significant increase and freedom；4）Reflector lamp
The contractility of cover causes the changeable working status of the present apparatus, significantly improves illuminating effect and the scope of application.
Present invention employs above-mentioned technical proposal to provide a kind of mine laser lighting device, compensate for the prior art not
Foot, design is reasonable, easy to operate.
Brief description of the drawings
Fig. 1 is the sectional view of apparatus of the present invention；
Fig. 2 is the right view of apparatus of the present invention；
Fig. 3 is collapsible rod front view of the present invention；
Fig. 4 is collapsible rod rearview of the present invention；
Fig. 5 is the schematic diagram after collapsible rod of the present invention folds；
Fig. 6 is the front view of fixing piece of the present invention；
Fig. 7 is the side view of fixing piece of the present invention；
Fig. 8 is schematic diagram when lampshade of the present invention is unfolded；
Fig. 9 is schematic diagram when lampshade of the present invention is shunk；
Figure 10 is the structure diagram of vane plate of the present invention；
Figure 11 is the connection diagram of lampshade of the present invention and rotation axis.
Description of reference numerals：1 housing；2 links；3 headlamps；301 lampshades；302 sliding blocks；303 reflector layers；304 slide
Road；305 rotation axis；4 laser generators；5 lampshades；6 wiring frames；7 wire inlet-outlets；8 collapsible rods；801 mounting holes；802 shafts；
803 fixing pieces；803a fixed blocks；803b telescopic rods；803c support slippers；804 foldable slideways；9 fixed plates.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 11, a kind of mine laser lighting device, including housing 1,1 upper end of housing are connected with link 2, housing 1 one
Side is connected with lampshade 5, and 1 opposite side of housing is connected with collapsible rod 8, and 1 lower end of housing is connected with wire inlet-outlet 7, is set inside housing 1
There are headlamp 3 and laser generator 4.The inner side of lampshade 5 is connected with fixed plate 9, and 9 center of fixed plate is connected with laser generator 4, Gu
9 side of fixed board is equipped with reflectance coating, and headlamp 3 is set around laser generator 4.8 both ends of collapsible rod are equipped with mounting hole 801, can
8 side of folding rod is equipped with foldable slideway 804, and collapsible rod 8 is embedded to be connected with fixing piece 803, and collapsible rod 8 is by two shafts
802 points are three sections.Fixing piece 803 includes support slipper 803c, and support slipper 803c is embedded in foldable slideway 804, and support is slided
Block 803c upper ends are connected with telescopic rod 803b, and telescopic rod 803b upper ends are connected with fixed block 803a.3 surface of headlamp is equipped with reflective
Lampshade 301, lampshade 301 are made of polylith vane plate, and vane plate outer edge upper end is equipped with slideway 304, vane plate outer edge
Lower end is equipped with sliding block 302, and vane plate forms horn shape by slideway 304 and sliding block 302.Vane plate inward flange is connected to rotation
Axis 305, vane plate medial surface are equipped with reflector layer 303.Wiring frame 6 divides for upper and lower two layers, drier built in upper-layer wirings frame 6, on
6 surface of layer wiring frame is evenly equipped with air hole, the built-in connection electric wire of lower-layer wiring frame 6.
The present apparatus is easy to use, and fixed form variation, illumination zone is big, and accurately and securely property is high for positioning stablity；It is fixed
The reflectance coating that plate is equipped with causes the loss of laser and illumination light in the device to reduce, to improve the illumination of device and locating effect；
Collapsible rod is once fixed, and device can be made to realize that position up and down is moved, greatly improve mining activity efficiency, and can
The validity and freedom that significant increase is fixed；The contractility of lampshade causes the changeable working status of the present apparatus, significantly
Improve illuminating effect and the scope of application.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment 2：
As shown in Fig. 1 ~ 11, a kind of mine laser lighting device, including housing 1,1 upper end of housing are connected with link 2, housing 1 one
Side is connected with lampshade 5, and 1 opposite side of housing is connected with collapsible rod 8, and 1 lower end of housing is connected with wire inlet-outlet 7, is set inside housing 1
There are headlamp 3 and laser generator 4.It is hangable that link 2 has the function of the present apparatus, improves the present apparatus and fixes freedom；Lamp
Element inside 5 pairs of housings 1 of cover has protective effect, and 5 translucency of lampshade is good, avoids the weakening to laser and illumination light；If
There is wire inlet-outlet 7, electric wire involved by the present apparatus is discharged in order, improve device reliability；Collapsible rod 8 makes the dress after fixing
Left and right and the scope slided up and down can be had by putting, and frequently tearing open for device is it also avoid while present apparatus illumination zone is expanded
Dress；Headlamp 3 provides illumination for mining, and coordinates laser caused by laser generator 4 so that this dress in mining process
Putting has the function that positioning, and the penetrability of laser is strong, and light beam is concentrated, and can be accurately positioned, and improves mining accuracy, improves mining
During security.The present apparatus is easy to use, and fixed form variation, illumination zone is big, positioning stablity accurately and securely property
It is high.
The inner side of lampshade 5 is connected with fixed plate 9, and 9 center of fixed plate is connected with laser generator 4, and 9 side of fixed plate is equipped with anti-
Film is penetrated, headlamp 3 is set around laser generator 4.Fixed plate 9 with laser generator 4 to be threadedly coupled, not only may be used by threaded connection
It easy to the dismounting and change of laser generator 4, can also make laser generator 4 that there is cushion space when device collides, reduce
Damage to laser generator 4；The reflectance coating that fixed plate 9 is equipped with causes the loss of laser and illumination light in the device to reduce, with
Improve illumination and the locating effect of device；Headlamp 3 is set around laser generator 4, can improve the illuminating effect of headlamp 3,
Make light homogeneous soft.
8 both ends of collapsible rod are equipped with mounting hole 801, and 8 side of collapsible rod is equipped with foldable slideway 804, in collapsible rod 8
Embedding to be connected with fixing piece 803, collapsible rod 8 is divided for three sections by two shafts 802.Collapsible rod 8 passes through shaft when not in use
802 fold, and reduce the space hold of collapsible rod 8, are carried easy to device；When using collapsible rod 8, collapsible rod 8 is unfolded
And being fixed on suitable position, then device can be realized without dismounting, you can changed fixed position, not only increased mining space
Utilization rate, and avoid the frequent dismounting of device, improves service using life, and move left and right, can advantageously expansion instrument
Illumination zone.
Fixing piece 803 includes support slipper 803c, and support slipper 803c is embedded in foldable slideway 804, support slipper
803c upper ends are connected with telescopic rod 803b, and telescopic rod 803b upper ends are connected with fixed block 803a.The support slipper 803c back sides are equipped with
Convex block, convex block are embedded in foldable slideway 804, and realization device moves left and right, and housing 1 is fixed on 803a, telescopic rod 803b
It is flexible may be implemented in when need not dismantle, lifting device height, changes illumination zone to suitable scope.The one of collapsible rod 8
Secondary fixation, can make device realize that position up and down is moved, it using work to bringing unexpected convenience, greatly
Mining activity efficiency is improved, and the structure of collapsible rod 8 is simple, it is easy to carry, there is preferable prospect of the application in terms of fixation,
Can significant increase fix validity and freedom.
3 surface of headlamp is equipped with lampshade 301, and lampshade 301 is made of polylith vane plate, on vane plate outer edge
End is equipped with slideway 304, and vane plate outer edge lower end is equipped with sliding block 302, and vane plate forms loudspeaker by slideway 304 and sliding block 302
Shape.Lampshade 301 is made of polylith vane plate, and the slideway 304 and sliding block 302 of blade plate surface are so that between each vane plate
It is connected, and there is sliding function；Vane plate with sliding function make it that lampshade 301 is scalable, scalable reflector lamp
The poly- of light that cover 301 can control headlamp 3 to be sent dissipates property, available for large-scale illumination, it can also be used to the irradiation of focusing,
The applicable situation of the present apparatus is increased, and the lampshade of opaque adjustable size can adjust lamps and lanterns shielding angle, it is possible to increase prevent
The scope of dazzle, the contractility of lampshade 301 cause the changeable working status of the present apparatus, significantly improve illuminating effect and fit
Use scope.
Vane plate inward flange is connected to rotation axis 305, and vane plate medial surface is equipped with reflector layer 303.Rotation axis 305 makes reflective
The control of lampshade 301 precisely facilitates, and reflector layer 303 reduces loss of the light inside lampshade 301, not only improves electric energy
Utilization rate, also improves light intensity, lifts illuminating effect.The connection control motor of rotation axis 305, by pressing positioned at 1 surface of housing
Button control motor is rotated to adjust the poly- scattered property of light, and control mode is simply accurate.
Wiring frame 6 divides for upper and lower two layers, and drier built in upper-layer wirings frame 6,6 surface of upper-layer wirings frame is evenly equipped with ventilative
Hole, the built-in connection electric wire of lower-layer wiring frame 6.Drier built in upper-layer wirings frame 6 can keep the dry environment inside housing 1,
Avoiding device from making moist influences work, is also prevented from electronic component because short circuit phenomenon occurs for steam, improves device functional reliability；Under
Layer wiring frame 6 places electric wire set in order, is repaired easy to device, also improves device reliability.The component of drier and its again
Measuring part is：2 ~ 6 parts of anhydrous calcium chloride, 6 ~ 9 parts of calcium chloride dihydrate, 0.5 ~ 1.4 part of polyacrylamide, 0.9 ~ 1.2 part of plant amylum,
The preparation method of this drier is to mix mentioned component, adds 0.3 ~ 0.6 part of adhesive, is suppressed using sheet mold, obtain piece
Shape drier.This drier is sheet, and the inner space of maximizing land productivity upper strata wiring frame, its drying effect is good, dry
Time is grown, wherein, adhesive is bentonite and active peptides, both mass ratioes are 1:0.2 ~ 0.4, the amino acid of active peptides
Sequence is：TDHQMAQSACIGVSQDNAYASAPRDCHGGKTCEGICDATATMDRYSDTGGPLSTARCVNAFHFYKRRGEE
NVSYKPFVVSWKYGVAGCFYTHCGPNFCCCIS, the addition of active peptides is so that the effect of adhesive is far superior to single make
Bonding effect during with bentonite, the active peptides of addition can increase permeability of the bentonite to bonding substrates, improve and bond base
Stable connection between material, make between bonding substrates can long-acting bonding, lift the mechanical performance of drier, extend drier
Service life.
Link 2 divides is connected to 1 side of housing for vertical ring and inclined ring, vertical ring, and it is another that inclined ring is connected to housing 1
Side, the length of vertical ring and the length ratio of inclined ring are 1:1.8~2.6.Link 2 can be used for hanging the present apparatus, vertical ring and inclination
Ring makes device fixing-stable, avoids rocking rotation, the length ratio of vertical ring and inclined ring makes device after hanging have suitably
Range of exposures, and make both stress more uniform, improve fixed effect.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, can also make a variety of changes and modification.Therefore, it is all equivalent
Technical solution fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Sequence table
<110>Sea salt sends Mortopl Science and Technology Ltd.
<120>A kind of mine laser lighting device
<160> 1
<170> SIPOSequenceListing 1.0
<210> 1
<211> 102
<212> PRT
<213>Artificial synthesized (Mytilus coruscus)
<400> 1
Thr Asp His Gln Met Ala Gln Ser Ala Cys Ile Gly Val Ser Gln Asp
1 5 10 15
Asn Ala Tyr Ala Ser Ala Pro Arg Asp Cys His Gly Gly Lys Thr Cys
20 25 30
Glu Gly Ile Cys Asp Ala Thr Ala Thr Met Asp Arg Tyr Ser Asp Thr
35 40 45
Gly Gly Pro Leu Ser Thr Ala Arg Cys Val Asn Ala Phe His Phe Tyr
50 55 60
Lys Arg Arg Gly Glu Glu Asn Val Ser Tyr Lys Pro Phe Val Val Ser
65 70 75 80
Trp Lys Tyr Gly Val Ala Gly Cys Phe Tyr Thr His Cys Gly Pro Asn
85 90 95
Phe Cys Cys Cys Ile Ser
100
Claims (7)
1. a kind of mine laser lighting device, including housing（1）, it is characterised in that the housing（1）Upper end is connected with link
（2）, the housing（1）Side is connected with lampshade（5）, the housing（1）Opposite side is connected with collapsible rod（8）, it is described
Housing（1）Lower end is connected with wire inlet-outlet（7）, the housing（1）It is internally provided with headlamp（3）And laser generator（4）.
A kind of 2. mine laser lighting device according to claim 1, it is characterised in that the lampshade（5）Inner side connects
It is connected to fixed plate（9）, the fixed plate（9）Center is connected with laser generator（4）, the fixed plate（9）Side is equipped with
Reflectance coating, the headlamp（3）Around laser generator（4）Set.
A kind of 3. mine laser lighting device according to claim 1, it is characterised in that the collapsible rod（8）Two
End is equipped with mounting hole（801）, the collapsible rod（8）Side is equipped with foldable slideway（804）, the collapsible rod（8）
It is embedded to be connected with fixing piece（803）, the collapsible rod（8）By two shafts（802）It is divided into three sections.
A kind of 4. mine laser lighting device according to claim 3, it is characterised in that the fixing piece（803）Bag
Include support slipper（803c）, the support slipper（803c）It is embedded in foldable slideway（804）, the support slipper
（803c）Upper end is connected with telescopic rod（803b）, the telescopic rod（803b）Upper end is connected with fixed block（803a）.
A kind of 5. mine laser lighting device according to claim 1, it is characterised in that the headlamp（3）Surface
Equipped with lampshade（301）, the lampshade（301）It is made of polylith vane plate, the vane plate outer edge upper end
Equipped with slideway（304）, the vane plate outer edge lower end is equipped with sliding block（302）, the vane plate passes through slideway（304）With
Sliding block（302）Form horn shape.
6. a kind of mine laser lighting device according to claim 5, it is characterised in that the vane plate inward flange connects
It is connected to rotation axis（305）, the vane plate medial surface is equipped with reflector layer（303）.
A kind of 7. mine laser lighting device according to claim 1, it is characterised in that the wiring frame（6）It is divided into
Upper and lower two layers, the upper-layer wirings frame（6）Built-in drier, the upper-layer wirings frame（6）Surface is evenly equipped with air hole, institute
The lower-layer wiring frame stated（6）Built-in connection electric wire.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710972894.4A CN107975706A (en) | 2017-10-18 | 2017-10-18 | A kind of mine laser lighting device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710972894.4A CN107975706A (en) | 2017-10-18 | 2017-10-18 | A kind of mine laser lighting device |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107975706A true CN107975706A (en) | 2018-05-01 |
Family
ID=62012510
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710972894.4A Withdrawn CN107975706A (en) | 2017-10-18 | 2017-10-18 | A kind of mine laser lighting device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107975706A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108119828A (en) * | 2017-12-29 | 2018-06-05 | 陈爱军 | A kind of Sickbed lamp and limit light shield |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102980154A (en) * | 2012-10-22 | 2013-03-20 | 三一重型装备有限公司 | Laser lighting device and mining machine |
| CN105841093A (en) * | 2016-04-29 | 2016-08-10 | 汤志生 | Dimmable lamp and installation method thereof |
| CN206539991U (en) * | 2017-03-13 | 2017-10-03 | 中山威斯汀灯饰有限公司 | A kind of LED track spotlight of carrying portable |
-
2017
- 2017-10-18 CN CN201710972894.4A patent/CN107975706A/en not_active Withdrawn
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102980154A (en) * | 2012-10-22 | 2013-03-20 | 三一重型装备有限公司 | Laser lighting device and mining machine |
| CN105841093A (en) * | 2016-04-29 | 2016-08-10 | 汤志生 | Dimmable lamp and installation method thereof |
| CN206539991U (en) * | 2017-03-13 | 2017-10-03 | 中山威斯汀灯饰有限公司 | A kind of LED track spotlight of carrying portable |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108119828A (en) * | 2017-12-29 | 2018-06-05 | 陈爱军 | A kind of Sickbed lamp and limit light shield |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN100366976C (en) | Vehicle headlight | |
| CN206989088U (en) | Simulated flame lamp holder and Simulated flame lamp of wafting and flashing | |
| CN106931380B (en) | The bulb device of vehicle | |
| CN107975706A (en) | A kind of mine laser lighting device | |
| WO2013189187A1 (en) | Simulation candle | |
| CN207569643U (en) | A kind of adjustable focus lamps and lanterns for connecting mobile phone control | |
| CN209558224U (en) | One kind can rain cover landscape spotlight | |
| ES2392354T3 (en) | Performance optimization method of LED lighting devices | |
| CN107975731A (en) | A kind of orientable laser illuminator system | |
| WO2016201597A1 (en) | Head-sensing headlamp device | |
| CN208381925U (en) | A kind of tracing type stage searchlight | |
| CN206055492U (en) | A kind of illuminator of combination desk lamp and pocket lamp | |
| CN106871067A (en) | The projecting lamp of the lamp that waves effect | |
| CN207702238U (en) | A kind of LED projector lamp of capable assembling | |
| US3175078A (en) | Illuminated room divider | |
| CN206600764U (en) | A kind of machine top optically focused long drive device | |
| CN206470476U (en) | A kind of light modulating device of aerophare | |
| CN206300066U (en) | A kind of Outdoor wall lamp | |
| CN206419775U (en) | A kind of folding Projecting Lamp | |
| CN210951063U (en) | Projecting lamp of adjustable luminescent color | |
| CN213746362U (en) | LED projecting lamp of illumination angularly adjustable | |
| CN204647979U (en) | A kind of LED earth building shaped street lamp | |
| CN215096716U (en) | Handicraft with fountain light source | |
| CN208475147U (en) | A kind of street lighting luminaire | |
| CN209605009U (en) | A kind of underground lamp of adjustable crevice projection angle |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20180501 |