CN107692789B - Quick garlic peeler based on change bucket - Google Patents
Quick garlic peeler based on change bucket Download PDFInfo
- Publication number
- CN107692789B CN107692789B CN201711037167.5A CN201711037167A CN107692789B CN 107692789 B CN107692789 B CN 107692789B CN 201711037167 A CN201711037167 A CN 201711037167A CN 107692789 B CN107692789 B CN 107692789B
- Authority
- CN
- China
- Prior art keywords
- garlic
- garlic peeling
- barrel
- shell
- upper shell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A47—FURNITURE; DOMESTIC ARTICLES OR APPLIANCES; COFFEE MILLS; SPICE MILLS; SUCTION CLEANERS IN GENERAL
- A47J—KITCHEN EQUIPMENT; COFFEE MILLS; SPICE MILLS; APPARATUS FOR MAKING BEVERAGES
- A47J17/00—Household peeling, stringing, or paring implements or machines
- A47J17/14—Machines for peeling
Abstract
The invention provides a quick garlic peeling machine based on a rotary barrel, which comprises an upper shell and a garlic peeling barrel positioned in the upper shell, wherein the upper end of the garlic peeling barrel is provided with a rotary cover, the lower end of the upper shell is connected with a lower shell, a horizontal partition plate is connected at the joint of the upper shell and the lower shell, the garlic peeling barrel is positioned at the upper end of the horizontal partition plate, the lower end of the horizontal partition plate is provided with a speed reducer, the lower end of the speed reducer is provided with a motor, and the lower end of. The upper shell and the lower shell enable the whole appearance of the garlic peeling machine to be clean and tidy, are convenient to take and use, protect internal parts and prolong the service life of the garlic peeling machine; the internal part of the integrated garlic peeling machine is provided with two spaces when the partition plate is horizontally arranged, so that power equipment and garlic peeling equipment are separately arranged, mutual influence is avoided, and later maintenance is facilitated; the garlic peeling barrel is driven to rotate by the motor, so that garlic peeling treatment is performed, the overall treatment time is short, the garlic peeling effect is good, and great convenience is brought to garlic peeling in a kitchen.
Description
Technical Field
The invention belongs to the technical field of kitchen utensils, and particularly relates to a quick garlic peeling machine based on a rotary barrel.
Background
Garlic is a daily necessity in a kitchen, and is essential for a cook, so that a long preparation time is usually spent for peeling the garlic, strong garlic pungent gas is emitted during peeling the garlic, and garlic water is hot to the hands, so that peeling treatment of the garlic by many people is very painful. There are also many types of garlic peeler on the market today.
For example, the patent of the invention of China is granted literature, the publication number is CN 101889814B, the invention discloses a hemispherical garlic peeling machine, which comprises a motor, a rotating shaft and a garlic peeling barrel, and is characterized in that: the garlic peeling barrel is hemispherical, a garlic blocking cover is arranged above the garlic peeling barrel, a gap is arranged between the garlic peeling barrel and the garlic blocking cover, a material inlet and a material outlet are arranged at the top of the garlic blocking cover, the lower part of the garlic peeling barrel is fixedly connected with the rotating shaft, through holes are arranged on the walls of the garlic peeling barrel and the garlic blocking cover, a garlic peeling barrel shield is arranged outside the garlic peeling barrel and the garlic blocking cover, a motor shield is arranged below the garlic peeling barrel shield, and a garlic skin outlet is arranged on the lower wall of the garlic peeling barrel shield. Compared with the existing garlic peeling machine, the hemispherical garlic peeling machine has the following advantages: firstly, the garlic peeling effect of the hemispherical garlic peeling machine is far superior to that of the existing garlic peeling machine; secondly, the hemispherical garlic peeler successfully realizes the separation of the garlic cloves and the garlic skins, reduces the labor for separating the garlic cloves and the garlic skins, and has popularization value. However, in practical use of the garlic peeling machine of the present invention, the garlic cloves may be damaged and discolored during repeated rising and falling of the garlic cloves, which may affect the subsequent use of the garlic cloves. A garlic peeling machine.
Disclosure of Invention
The invention aims to provide a quick garlic peeling machine based on a rotary barrel, which can realize friction and centrifugal peeling of garlic cloves, has high peeling speed and small damage to the garlic cloves, can automatically remove the garlic cloves and has long service life of the garlic peeling barrel.
The scheme adopted by the invention for solving the technical problems is as follows: quick garlic peeler based on change bucket, including the upper housing with be located the inside garlic bucket of shelling of upper housing, shell the garlic bucket upper end and be equipped with rotatory lid, the upper housing lower extreme is connected with down the casing, upper housing and lower casing junction are connected with horizontal baffle, shell the garlic bucket and be located horizontal baffle upper end, horizontal baffle lower extreme is equipped with the reduction gear, the reduction gear lower extreme is equipped with the motor, the motor lower extreme is equipped with the air pump. The upper shell and the lower shell enable the whole appearance of the garlic peeling machine to be clean and tidy, the garlic peeling machine is convenient to take and use, internal parts are protected, and the service life of the garlic peeling machine is prolonged; when the partition plate is horizontally arranged, two spaces are formed in the integrated garlic peeling machine, so that the power equipment and the garlic peeling equipment are separately arranged, mutual influence is avoided, and later maintenance is facilitated; the garlic peeling barrel is driven to rotate by the motor, so that garlic peeling treatment is performed, the overall treatment time is short, the garlic peeling effect is good, and great convenience is brought to garlic peeling in a kitchen.
Preferably, a garlic inlet is formed between the garlic peeling barrel and the rotary cover, the rotary cover is connected with the upper shell through a rotary shaft, the upper surface of the rotary cover is connected with a handle, and the surface of the rotary shaft is also connected with a baffle. When the rotating shaft enables the rotating cover to be opened to throw garlic, the baffle is connected with the garlic inlet, the garlic can conveniently enter the garlic peeling barrel, when the rotating cover is closed, the baffle is separated from the garlic inlet, the garlic skin discharging space is connected with the garlic peeling barrel, the garlic skin can be conveniently removed in the garlic peeling process, the rotating shaft is ingeniously utilized to realize conversion of different spaces, great convenience is provided for peeling the garlic, and the utilization rate of the inner space of the garlic peeling machine is effectively improved.
Preferably, the garlic peeling barrel comprises an upper top cover, hollow holes are formed in the surface of the upper top cover, the lower end of the upper top cover is connected with a cylindrical barrel body, the top of the cylindrical barrel body is connected with a rubber ring, the inner wall of the cylindrical barrel body is connected with a fixed rubber ring, the inner side of the fixed rubber ring is connected with a movable rubber ring which is vertically arranged through elastic materials, and the hollow holes are formed in the bottom surface of the cylindrical barrel body. The upper top cover is in a round platform shape, so that garlic cloves can be prevented from jumping out of the garlic peeling barrel in the rotating process, the hollow holes are formed in the surface of the upper top cover, the garlic cloves which are subjected to centrifugal action can be discharged out of the garlic peeling barrel through the hollow holes, the rubber ring can prevent the garlic cloves from rising to the upper top cover along the wall of the garlic peeling barrel, the hollow holes are prevented from being blocked, and unexpected promoting effects on discharging the garlic cloves and preventing the garlic cloves from falling out of the garlic peeling barrel are achieved; the movable rubber ring connected through the elastic material gradually moves towards the fixed rubber ring arranged on the barrel wall after receiving the centrifugal action, and the bottom of the movable rubber ring is not connected with the garlic peeling barrel, so that garlic cloves can move towards the garlic peeling barrel wall from the lower end of the movable rubber ring under the centrifugal action and rise along the barrel wall under the centrifugal action, and the movable rubber ring close to the fixed rubber ring can generate friction action on the garlic cloves, so that the garlic cloves can be rubbed between the movable rubber ring and the fixed rubber ring, the garlic skins can be quickly removed, the garlic skin removing time is reduced, the rubber ring has no damage to the garlic cloves, the garlic cloves after the garlic skins are removed are still complete and free from pressure loss, the garlic skins can be quickly removed by the garlic peeling barrel with the design, the garlic cloves are complete, pressure loss and color change are avoided, the garlic skins can be automatically and effectively removed, and the working efficiency is high.
Preferably, the output end of the air pump is connected with a hose, the hose penetrates through the horizontal partition plate and is connected with an air outlet pipe, the air outlet pipe is positioned at the lower end of the garlic peeling barrel, and the upper surface of the air outlet pipe is provided with an air outlet hole. The air pump presses air into the hose in the garlic peeling process, the air in the hose is transmitted to the air outlet pipe, the air holes in the surface of the air outlet pipe discharge air with higher flow velocity, and the air outlet pipe is arranged at the lower end of the garlic peeling barrel, so that the air discharged by the air outlet pipe enters the garlic peeling barrel from bottom to top, garlic skins falling off from the inside of the garlic peeling barrel enter the garlic skin discharging space from the outlet of the opening of the baffle plate, and then are discharged out of the garlic peeling machine, and the garlic skin removal rate is improved; the garlic cloves move upwards in the garlic peeling barrel due to centrifugal force, fall to the barrel bottom again when the centrifugal force is smaller than gravity, the arrangement of the air outlet pipe can also provide upward thrust for the garlic cloves in the process of falling the garlic cloves again, the impact force between the garlic cloves and the inner wall of the garlic peeling barrel is reduced, the damage of the garlic cloves is avoided, and effective peeling treatment can be realized.
Preferably, one side of the upper shell, which is connected with the baffle, is a space for discharging the garlic skins, and the bottom of the space for discharging the garlic skins is provided with a garlic skin outlet. The baffle can control the on-off between the space for discharging the garlic skins and the garlic peeling barrel, the design is favorable for automatically discharging the garlic skins, the peeled garlic is convenient to recycle, and the manual workload is reduced.
Preferably, the upper shell is made of plastic, the lower shell is made of stainless steel or rustproof iron material, and the ratio of the width of the upper shell to the maximum width of the garlic peeling barrel is 1: 0.66 to 0.82. Because the garlic peeler is small in size, the material arrangement of the upper shell and the lower shell can effectively reduce the gravity center of the garlic peeler, the garlic peeling barrel is prevented from vibrating and shifting the garlic peeler in the rotating process, the working stability of the garlic peeler can be effectively improved, and the use experience can be improved.
Preferably, the output shaft of the motor is connected to the garlic peeling barrel through a speed reducer.
Compared with the prior art, the invention has the advantages that 1) the garlic peeling machine has short overall processing time and good garlic peeling effect, and brings great convenience to the garlic peeling in a kitchen; 2) the conversion of different spaces is realized by utilizing the rotating shaft, great convenience is provided for garlic peeling, and the utilization rate of the internal space of the garlic peeling machine is effectively improved; 3) the air outlet pipe can discharge the garlic skins, reduce the damage of the garlic cloves and effectively improve the garlic skin removing effect and efficiency; 4) the garlic peeling barrel can quickly remove garlic skins, complete garlic cloves, pressure loss removal, no color change, automatic and effective removal of the garlic skins, and high working efficiency.
The invention adopts the technical scheme to provide the quick garlic peeling machine based on the rotary barrel, overcomes the defects of the prior art, and has reasonable design and convenient operation.
Drawings
FIG. 1 is a schematic structural view of the present invention;
FIG. 2 is a schematic view of the construction of the debarker of the present invention with the rotary cover open;
fig. 3 is a schematic view of the garlic peeling barrel of the present invention.
Description of reference numerals: 1, an upper shell; 2, a lower shell; 3, a hose; 4, an air pump; 5, a motor; 6 an output shaft; 7, a garlic skin outlet; 8, peeling the garlic barrels; 9 rows of garlic skin spaces; 10 a handle; 11 rotating the cover; 12 air outlet pipe; 13 baffle plate; 14, feeding garlic into the garlic mouth; 15 a reducer; 81, a top cover is arranged; 82 a rubber ring; 83 a movable rubber ring; 84 fixing a rubber ring; 85 of an elastomeric material.
Detailed Description
The following is described in further detail with reference to the accompanying drawings and examples:
example 1:
as shown in fig. 1-3, quick garlic peeler based on changeing bucket, including last casing 1, and be located the inside garlic bucket 8 that shells of last casing 1, the garlic bucket 8 upper end of shelling is equipped with swivel cap 11, 1 lower extreme of last casing is connected with down casing 2, it is connected with horizontal baffle to go up casing 1 and lower casing 2 junction, garlic bucket 8 is located horizontal baffle upper end, the horizontal baffle lower extreme is equipped with reduction gear 15, 15 lower extremes of reduction gear are equipped with motor 5, 5 lower extremes of motor are equipped with air pump 4, output shaft 6 of motor 5 passes through reduction gear 15 and connects in garlic bucket 8 of shelling. A garlic inlet 14 is formed between the garlic peeling barrel 8 and the rotary cover 11, the rotary cover 11 is connected with the upper shell 1 through a rotary shaft, the upper surface of the rotary cover 11 is connected with a handle 10, and the surface of the rotary shaft is also connected with a baffle 13. The garlic peeling barrel 8 comprises an upper top cover 81, hollow holes are formed in the surface of the upper top cover 81, the lower end of the upper top cover 81 is connected with a cylindrical barrel body, the top of the cylindrical barrel body is connected with a rubber ring 82, the inner wall of the cylindrical barrel body is connected with a fixed rubber ring 84, the inner side of the fixed rubber ring 84 is connected with a movable rubber ring 83 which is vertically arranged through an elastic material 85, and the bottom surface of the cylindrical barrel body is provided with the hollow holes. The output end of the air pump 4 is connected with a hose 3, the hose 3 passes through the horizontal clapboard to be connected with an air outlet pipe 12, the air outlet pipe 12 is positioned at the lower end of the garlic peeling barrel 8, and the upper surface of the air outlet pipe 12 is provided with an air outlet hole. The inner side of the upper shell 1 is connected with a baffle 13, and a garlic skin discharging space 9 is arranged at one side of the upper shell, and a garlic skin outlet 7 is arranged at the bottom of the garlic skin discharging space 9. Hollowed holes are distributed on the surface of the garlic peeling barrel 8, an opening is arranged at the upper end of the garlic peeling barrel 8, the opening is connected with the garlic inlet 14, and the edge of the opening is connected with a rubber ring 81. The upper shell 1 is made of plastic, the lower shell 2 is made of stainless steel or rustproof iron material, and the ratio of the width of the upper shell 1 to the maximum width of the garlic peeling barrel 8 is 1: 0.82.
conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
Example 2:
as shown in fig. 1-3, based on quick garlic peeler of commentaries on classics bucket, including last casing 1 with be located the inside garlic bucket 8 that shells of last casing 1, the garlic bucket 8 upper end of shelling is equipped with swivel cap 11, the lower extreme of going up casing 1 is connected with lower casing 2, it is connected with horizontal baffle to go up casing 1 and lower casing 2 junction, the garlic bucket 8 of shelling is located horizontal baffle upper end, horizontal baffle lower extreme is equipped with reduction gear 15, reduction gear 15 lower extreme is equipped with motor 5, the motor 5 lower extreme is equipped with air pump 4. The upper shell 1 and the lower shell 2 ensure that the whole appearance of the garlic peeling machine is clean and tidy, the garlic peeling machine is convenient to take and use, internal parts are protected, and the service life of the garlic peeling machine is prolonged; the internal part of the integrated garlic peeling machine is provided with two spaces when the partition plate is horizontally arranged, so that power equipment and garlic peeling equipment are separately arranged, mutual influence is avoided, and later maintenance is facilitated; the garlic peeling barrel 8 is driven to rotate by the motor 5, so that garlic peeling treatment is performed, the overall treatment time is short, the garlic peeling effect is good, and great convenience is brought to the garlic peeling belt in a kitchen.
A garlic inlet 14 is formed between the garlic peeling barrel 8 and the rotary cover 11, the rotary cover 11 is connected with the upper shell 1 through a rotary shaft, the upper surface of the rotary cover 11 is connected with a handle 10, and the surface of the rotary shaft is also connected with a baffle 13. When the rotating shaft enables the rotating cover 11 to be opened for garlic putting in, the baffle 13 is connected with the garlic inlet 14, garlic can conveniently enter the garlic peeling barrel 8, when the rotating cover 11 is closed, the baffle 13 is separated from the garlic inlet 14, the garlic skin discharging space 9 is connected with the garlic peeling barrel 8, garlic skins can be conveniently removed in the garlic peeling process, the rotating shaft is ingeniously utilized to realize conversion of different spaces, great convenience is provided for garlic peeling, and the utilization rate of the inner space of the garlic peeling machine is effectively improved.
The garlic peeling barrel 8 comprises an upper top cover 81, hollow holes are formed in the surface of the upper top cover 81, the lower end of the upper top cover 81 is connected with a cylindrical barrel body, the top of the cylindrical barrel body is connected with a rubber ring 82, the inner wall of the cylindrical barrel body is connected with a fixed rubber ring 84, the inner side of the fixed rubber ring 84 is connected with a movable rubber ring 83 which is vertically arranged through an elastic material 85, and the bottom surface of the cylindrical barrel body is provided with the hollow holes. The upper top cover 81 is in a round table shape, so that garlic cloves can be prevented from jumping out of the garlic peeling barrel 8 in the rotating process, hollow holes are formed in the surface of the upper top cover 81, the garlic cloves which are subjected to centrifugal action can be discharged out of the garlic peeling barrel 8 through the hollow holes, the rubber ring 82 can prevent the garlic cloves from rising to the upper top cover 81 along the wall of the garlic peeling barrel 8, the hollow holes are prevented from being blocked, and unexpected promoting effects are achieved on discharging the garlic cloves and preventing the garlic cloves from falling out of the garlic peeling barrel; the movable rubber ring 83 connected by the elastic material 85 gradually moves towards the fixed rubber ring 84 arranged on the barrel wall after being subjected to the centrifugal action, because the bottom of the movable rubber ring 83 is not connected with the garlic peeling barrel 8, garlic cloves can move towards the wall of the garlic peeling barrel 8 from the lower end of the movable rubber ring 83 under the centrifugal action and rise along the barrel wall under the centrifugal action, at the moment, the movable rubber ring 83 close to the fixed rubber ring 84 can generate friction action on the garlic cloves, so that the garlic cloves can be rubbed between the movable rubber ring 83 and the fixed rubber ring 84, the garlic skins can be quickly removed, the garlic peeling time is reduced, the rubber ring has no damage to the garlic cloves, the garlic cloves after being peeled are still complete and not damaged by pressure, the garlic peeling barrel 8 designed above can not only quickly remove the garlic skins, but also complete garlic cloves, remove pressure loss and not discolor, and can also automatically and effectively remove the garlic skins, the working efficiency is high.
The surface of the garlic peeling barrel 8 is sprayed with an anticorrosive coating which comprises the following components in parts by weight: 30-34 parts of modified boron phenolic polymer, 3-7 parts of nano composite liquid, 5-8 parts of reinforced carbon fiber, 12-20 parts of rutile titanium dioxide, 4.5-8 parts of silicon carbide ceramic powder, 5-9 parts of nickel-based alloy powder and 0.04-0.045 part of dispersing agent. The anticorrosive coating is coated on the surface of the garlic peeling barrel 8 and forms an anticorrosive coating after drying treatment, the anticorrosive coating can effectively prevent the garlic inclusion from corroding the garlic peeling barrel 8, the molecular stability of the garlic peeling barrel 8 is improved, the garlic peeling barrel 8 is prevented from aging, the service life of the garlic peeling barrel 8 is prolonged, the spraying of the anticorrosive coating can also improve the anti-sticking viscosity of the surface of the garlic peeling barrel 8, the adhesion of garlic skins on the surface of the garlic peeling barrel 8 is avoided, the discharge rate of the garlic skins is improved, a dispersing agent in the anticorrosive coating is active polypeptide, and the amino acid sequence of the active polypeptide is as follows: TDHQMAQSACIGVSDNAYASAPRDHGKTCEGICDATATDRYSDGGPLSTARCVNAFHFYKRRGEENVSYKPFVVSWKYGVAGCFYTHCGPNFCCIS, the dispersant can effectively promote the molecular compatibility of each component in the coating preparation process, improve the mixing of each component, improve the mechanical property of the coating, effectively enhance the corrosion resistance of the garlic peeling barrel 8, improve the film forming property of the corrosion resistant coating, ensure that the coating is firmly attached to the surface of the garlic peeling barrel 8 and prolong the service life of the garlic peeling barrel 8.
The output end of the air pump 4 is connected with a hose 3, the hose 3 passes through the horizontal clapboard to be connected with an air outlet pipe 12, the air outlet pipe 12 is positioned at the lower end of the garlic peeling barrel 8, and the upper surface of the air outlet pipe 12 is provided with an air outlet hole. The air pump 4 presses air into the hose 3 in the garlic peeling process, the air in the hose 3 is transmitted to the air outlet pipe 12, the air holes on the surface of the air outlet pipe 12 discharge air with high flow velocity, the air outlet pipe 12 is arranged at the lower end of the garlic peeling barrel 8, so the air discharged from the air outlet pipe 12 enters the garlic peeling barrel 8 from bottom to top, garlic skins falling off from the inside of the garlic peeling barrel 8 enter the garlic skin discharging space 9 from the outlet of the opening of the baffle 13 and then are discharged out of the garlic peeling machine, and the garlic skin removing rate is improved; the garlic cloves move upwards in the garlic peeling barrel 8 due to centrifugal force, fall to the bottom of the barrel again when the centrifugal force is smaller than gravity, the arrangement of the air outlet pipe 12 can also provide upward thrust for the garlic cloves in the process of falling the garlic cloves again, the impact force between the garlic cloves and the inner wall of the garlic peeling barrel 8 is reduced, the damage of the garlic cloves is avoided, and effective peeling treatment can be realized.
The inner side of the upper shell 1 is connected with a baffle 13, and a garlic skin discharging space 9 is arranged at one side of the upper shell, and a garlic skin outlet 7 is arranged at the bottom of the garlic skin discharging space 9. The baffle 13 can control the on-off between the garlic skin discharging space 9 and the garlic peeling barrel 8, the design is favorable for automatically discharging the garlic skins, the peeled garlic is convenient to recycle, and the manual workload is reduced.
The upper shell 1 is made of plastic, the lower shell 2 is made of stainless steel or rustproof iron material, and the ratio of the width of the upper shell 1 to the maximum width of the garlic peeling barrel 8 is 1: 0.72. because the garlic peeler is small in size, the material arrangement of the upper shell 1 and the material arrangement of the lower shell 2 can effectively reduce the gravity center of the garlic peeler, avoid the garlic peeling barrel 8 from vibrating and shifting the garlic peeler in the rotating process, and effectively improve the working stability of the garlic peeler and improve the use experience.
An output shaft 6 of the motor 5 is connected with the garlic peeling barrel 8 through a speed reducer 15.
Conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
Example 3:
as shown in figures 1-3, the working principle of the quick garlic peeling machine based on the rotary barrel is as follows: opening the rotary cover 11, putting garlic cloves into the garlic inlet 14, closing the rotary cover 11, turning on the power supply, starting the motor 5, the reducer 15 and the air pump 4 to work, making the garlic cloves inside the garlic peeling barrel 8 centrifugally move, making the garlic skins separate, generating air by the air pump 4, blowing upward air from the air outlet pipe 12 to the garlic peeling barrel 8, making the garlic skins enter the garlic skin discharging space 9, and then discharging the garlic skins, when the garlic peeling machine operates for a period of time, automatically powering off the garlic peeling machine, stopping working, opening the rotary cover 11 at this moment, and taking out the peeled garlic cloves.
Conventional techniques in this embodiment are known to those skilled in the art and will not be described in detail here.
The above embodiments are merely illustrative, and not restrictive, and those skilled in the art can make various changes and modifications without departing from the spirit and scope of the invention. Therefore, all equivalent technical solutions also belong to the scope of the present invention, and the protection scope of the present invention should be defined by the claims.
Sequence listing
<110> Jinhua city Chuanpu agriculture science and technology Limited
<120> quick garlic peeler based on rotating barrel
<160>1
<170>SIPOSequenceListing 1.0
<210>1
<211>96
<212>PRT
<213> Artificial Synthesis (Mytilus corescuus)
<400>1
Thr Asp His Gln Met Ala Gln Ser Ala Cys Ile Gly Val Ser Asp Asn
1 5 10 15
Ala Tyr Ala Ser Ala Pro Arg Asp His Gly Lys Thr Cys Glu Gly Ile
20 25 30
Cys Asp Ala Thr Ala Thr Asp Arg Tyr Ser Asp Gly Gly Pro Leu Ser
35 40 45
Thr Ala Arg Cys Val Asn Ala Phe His Phe Tyr Lys Arg Arg Gly Glu
50 55 60
Glu Asn Val Ser Tyr Lys Pro Phe Val Val Ser Trp Lys Tyr Gly Val
65 70 75 80
Ala Gly Cys Phe Tyr Thr His Cys Gly Pro Asn Phe Cys Cys Ile Ser
85 90 95
Claims (1)
1. Quick garlic peeler based on change bucket includes casing (1) and lies in the inside garlic peeling barrel (8) of casing (1) of going up, its characterized in that: the garlic peeling machine is characterized in that a rotary cover (11) is arranged at the upper end of the garlic peeling barrel (8), the lower end of the upper shell (1) is connected with the lower shell (2), a horizontal partition plate is connected at the joint of the upper shell (1) and the lower shell (2), the garlic peeling barrel (8) is positioned at the upper end of the horizontal partition plate, a speed reducer (15) is arranged at the lower end of the horizontal partition plate, a motor (5) is arranged at the lower end of the speed reducer (15), and an air pump (4) is arranged at the lower end of the motor (5); a garlic inlet (14) is formed between the garlic peeling barrel (8) and the rotary cover (11), the rotary cover (11) is connected to the upper shell (1) through a rotary shaft, the upper surface of the rotary cover (11) is connected with a handle (10), and the surface of the rotary shaft is also connected with a baffle (13); the garlic peeling barrel (8) comprises an upper top cover (81), the upper top cover (81) is in a circular truncated cone shape, hollow holes are formed in the surface of the upper top cover (81), the lower end of the upper top cover (81) is connected with a cylindrical barrel body, a rubber ring (82) is connected to the top of the cylindrical barrel body, a fixed rubber ring (84) is connected to the inner wall of the cylindrical barrel body, the inner side of the fixed rubber ring (84) is connected with a vertically arranged movable rubber ring (83) through an elastic material (85), and hollow holes are formed in the bottom surface of the cylindrical barrel body; the output end of the air pump (4) is connected with a hose (3), the hose (3) penetrates through the horizontal partition plate to be connected with an air outlet pipe (12), the air outlet pipe (12) is positioned at the lower end of the garlic peeling barrel (8), and the upper surface of the air outlet pipe (12) is provided with an air outlet hole; one side of the upper shell (1) which is internally connected with a baffle (13) is provided with a garlic skin discharging space (9), and the bottom of the garlic skin discharging space (9) is provided with a garlic skin outlet (7); the garlic peeling machine is characterized in that the upper shell (1) is made of plastic, the lower shell (2) is made of stainless steel or rustproof iron material, and the ratio of the width of the upper shell (1) to the maximum width of the garlic peeling barrel (8) is 1: 0.66 to 0.82; an output shaft (6) of the motor (5) is connected with the garlic peeling barrel (8) through a speed reducer (15), and the baffle (13) can control the on-off between the garlic skin discharging space (9) and the garlic peeling barrel (8).
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711037167.5A CN107692789B (en) | 2017-10-30 | 2017-10-30 | Quick garlic peeler based on change bucket |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711037167.5A CN107692789B (en) | 2017-10-30 | 2017-10-30 | Quick garlic peeler based on change bucket |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107692789A CN107692789A (en) | 2018-02-16 |
| CN107692789B true CN107692789B (en) | 2020-05-22 |
Family
ID=61177228
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711037167.5A Expired - Fee Related CN107692789B (en) | 2017-10-30 | 2017-10-30 | Quick garlic peeler based on change bucket |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107692789B (en) |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN2838471Y (en) * | 2005-10-20 | 2006-11-22 | 张战修 | The garlic peeling machine |
| CN201036490Y (en) * | 2007-05-18 | 2008-03-19 | 陈晓 | Garlic stripping device |
| CN101889814A (en) * | 2010-07-28 | 2010-11-24 | 李联明 | Hemispherical garlic peeler |
| KR20140001308U (en) * | 2012-08-24 | 2014-03-05 | (주)일렉토피아 | Peeler ball for garlic peeler |
| CN203692485U (en) * | 2014-01-27 | 2014-07-09 | 张海兵 | Scratching prevention garlic peeling machine |
| CN104665558A (en) * | 2013-11-26 | 2015-06-03 | 陕西龙海工程建设有限公司 | Simple garlic peeling device |
-
2017
- 2017-10-30 CN CN201711037167.5A patent/CN107692789B/en not_active Expired - Fee Related
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN2838471Y (en) * | 2005-10-20 | 2006-11-22 | 张战修 | The garlic peeling machine |
| CN201036490Y (en) * | 2007-05-18 | 2008-03-19 | 陈晓 | Garlic stripping device |
| CN101889814A (en) * | 2010-07-28 | 2010-11-24 | 李联明 | Hemispherical garlic peeler |
| KR20140001308U (en) * | 2012-08-24 | 2014-03-05 | (주)일렉토피아 | Peeler ball for garlic peeler |
| CN104665558A (en) * | 2013-11-26 | 2015-06-03 | 陕西龙海工程建设有限公司 | Simple garlic peeling device |
| CN203692485U (en) * | 2014-01-27 | 2014-07-09 | 张海兵 | Scratching prevention garlic peeling machine |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107692789A (en) | 2018-02-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN100463619C (en) | Apparatus for peeling off | |
| CN107692789B (en) | Quick garlic peeler based on change bucket | |
| CN111928587A (en) | Centrifugal drying processing apparatus for chemical production | |
| CN109258755A (en) | Pig hair residual cleaning plant | |
| CN209348163U (en) | Ultrasonic extraction device is used in a kind of acquisition of traditional Chinese medicine ingredients | |
| CN108888220B (en) | Pressure cooker convenient to clean | |
| CN107716180A (en) | A kind of sewage disposal medicament flusher | |
| CN107928365A (en) | The automatic garlic peeler of centrifugal rotation | |
| US4290160A (en) | Rotary brush | |
| CN206482979U (en) | A kind of hand-held chemical sprayer of ear-nose-throat department | |
| CN216224003U (en) | Preparation equipment for water-based pressure-sensitive adhesive composite non-setting adhesive material | |
| CN208612840U (en) | A kind of spray-painting plant with cleaning function | |
| CN209509103U (en) | A kind of food waste discharge of wastewater refuse treatment plant | |
| CN207821029U (en) | A kind of pueraria lobata peeling machine | |
| CN204519224U (en) | A kind of cashew nut kernel peeling machine of the friction column with spiral setting | |
| CN207667901U (en) | A kind of sewage disposal medicament flusher | |
| KR100741666B1 (en) | Device to strip garlic by water pressure | |
| CN105053141A (en) | Trotter dehairer | |
| CN207011646U (en) | A kind of fresh walnut dejacketer | |
| CN208149582U (en) | A kind of protective device of propeller | |
| CN109366730B (en) | Efficient and environment-friendly concrete preparation equipment | |
| CN207721095U (en) | A kind of lobster device for fast cleaning of effective decontamination | |
| CN207635762U (en) | Segmented goose feather cleaning drying device | |
| CN207632926U (en) | A kind of goose feather Special cleaning drying unit | |
| CN208601691U (en) | A kind of ribs of the fan process equipment |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| TA01 | Transfer of patent application right |
Effective date of registration: 20200413 Address after: No.76-78-1, Xinchen Road, Donggang street, Putuo District, Zhoushan City, Zhejiang Province Applicant after: ZHOUSHAN FUSHENG FOOD TECHNOLOGY Co.,Ltd. Address before: 321000 room 3F08, No. 88 (new factory area), No. 88, Ya Shuai Road, Ya Fan Town, Wucheng District, Zhejiang Province Applicant before: JINHUA CHUANPU AGRICULTURAL TECHNOLOGY Co.,Ltd. |
|
| TA01 | Transfer of patent application right | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20200522 Termination date: 20211030 |
|
| CF01 | Termination of patent right due to non-payment of annual fee |