CN107621128A - A kind of simple multifunctional antecedent soil moisture device - Google Patents
A kind of simple multifunctional antecedent soil moisture device Download PDFInfo
- Publication number
- CN107621128A CN107621128A CN201710642434.5A CN201710642434A CN107621128A CN 107621128 A CN107621128 A CN 107621128A CN 201710642434 A CN201710642434 A CN 201710642434A CN 107621128 A CN107621128 A CN 107621128A
- Authority
- CN
- China
- Prior art keywords
- tube structure
- bull stick
- sieves
- parts
- soil moisture
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Abstract
The present invention provides a kind of simple multifunctional antecedent soil moisture device,Belong to antecedent soil moisture technical field,Including tube structure,Sieves,Air blast air flue,Ring-shaped step is provided among the inwall of tube structure,Ring-shaped step sieves provided with circular filter,Equipped with shake roller among sieves and ring-shaped step,Active bull stick is housed among tube structure bottom,Active bull stick top is connected with one end of driven bull stick,The other end shake roller of driven bull stick,Connector drum structure one end is higher than away from tube structure one end on air blast air flue,Air blast air flue is with level to gradient,The present invention is simple in construction,Design is unique,It can be very good to separate the stone and debris in soil,Soil can not allowed bulk,The soil separated is soft,Good permeability,Impurity can readily allow plant absorption nutrient less,Be provided with inside tube structure air pump can with it is easier make it is in-house it is air dried faster.
Description
Technical field
The present invention relates to a kind of antecedent soil moisture device, is directed primarily to a kind of simple multifunctional antecedent soil moisture device.
Background technology
At present, because harmful, noxious material caused by mankind's activity enters soil, accumulate to a certain extent, more than soil
The self-purification capacity of itself, causes soil property and mass change, forms the phenomenon of the influence and harm to crops and human body.Soil
Earth pollution is mainly derived from pollutant in the waste water and solid waste, air in industry and city（As sulfur dioxide, nitrogen oxides,
Particulate matter etc.）By settle and the precipitum that falls earthward of precipitation and agricultural chemicals, chemical fertilizer, livestock excreta etc..Soil due to
The characteristic of itself, or certain pollution is received, there is the self-purification capacity for relaxing and reducing pollution.But soil is not easy to flow, self-cleaning
Ability is extremely limited, so, soil protection is not contaminated particularly significant.
Prior art such as, Chinese invention granted patent document, Authorization Notice No. CN 105057197B, a kind of simple more work(
Can antecedent soil moisture device；Including tube structure, the inwall of tube structure is provided with ring-shaped step in one week, is set on ring-shaped step
Circular sieves；The one of setting active bull stick and driven bull stick in tube structure, one end of active bull stick and driven bull stick
End connects and is mutually perpendicular to, active bull stick other end connector drum structure inner bottom part center, is set on the driven bull stick other end
The shake roller of ellipse is put, shake roller is between ring-shaped step and sieves；Air blast air flue is set in tube structure.Should
Invention drives the convolution of driven bull stick to rotate by the radial rotating of active bull stick, so as to driving shake roller in ring-shaped step and
Rolling between sieves, vibrations and shake are realized, and it is chipping under strong vibrations to be placed on the soil block on sieves
As compared with small clod, the screening of soil is then formed；But the fan-drying system of air blast air flue is unable to horse in tube structure
On dry cylinder；The position long-term motion that critical piece active bull stick is connected with driven bull stick can produce abrasion, service life
It can reduce.
The content of the invention
It is an object of the invention to provide a kind of simple multifunctional antecedent soil moisture device；The present invention is simple in construction, and design is only
Spy, it can be very good to separate the stone and debris in soil, do not allow soil into bulk, the soil separated is soft, gas permeability
Good, impurity can readily allow plant absorption nutrient less, and critical piece active bull stick scribbles resistance to the position that driven bull stick is connected
Mill coating can make its working life become longer.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of simple multifunctional antecedent soil moisture device, bag
Tube structure, sieves, air blast air flue are included, ring-shaped step is provided among the inwall of tube structure；Ring-shaped step is provided with circle
Shape sieves；Equipped with shake roller between sieves one end and ring-shaped step；Limited bolt, cylinder are connected with the sieves other end
Active bull stick is housed at structural base center；Active bull stick top is connected with one end of driven bull stick；The other end of driven bull stick
Connection shake roller；The air blast air flue that tube structure is provided with inclination installation is simple in construction, easy to operate, easy to maintain, solves
Have stone in soil or have the problem of thick block soil is unfavorable for plant growth, using in device other smash to pieces impact tool will lump
Soil and rubble together hit fragmentation, can reach the purpose of soil and separated from impurities.
Preferably, the tube structure inwall upper right corner is provided with fixed plate；Fixed plate is located at the top of sieves；Fixed plate
Lower end is provided with wire brush；Wire brush is curly；Wire brush can be divided into fritter by blocking soil block to being smashed, can be with
Fine earth constantly in scraping soil on foreign matter, avoids being adhered the fine earth on foreign matter and is difficult to come off under vibrations and can not realize receipts
Collection；Wire brush for it is curly be in order to which the hole on sieves will not be caught on.
Preferably, the inwall upper left corner of tube structure is provided with limited bolt；One of limited bolt fixation sieves is longitudinal direction
Spring；Shake roller shake and drive sieves, limited bolt can prevent sieves from being rotated when shake, longitudinal spring
Two secure sieves and limited bolt respectively, sieves can only in the vertical direction move up and down.
Preferably, sieves is divided into the upper filtering table mutually covered and lower filtering table；Upper filtering table and lower filtering disk cover
Spring is provided with conjunction；Upper filtering table and lower filtering table are distributed with through hole；It is provided with the one side of upper filtering table and rolls post；Under
Filtering table contacts with shake roller；Secondary soil fragmentation area, upper filtering table and lower mistake are formed between upper filtering table and lower filtering table
Filter disc can mutually compress the space in secondary soil fragmentation area, coordinate and roll the fine earth that post enters secondary soil fragmentation area to filtering
Fragmentation is carried out again, reaches the effect of complete fragmentation soil block.
Preferably, at least two air blast air flues are set in tube structure；Two air blast air flues are located on different level；
Gas flow paths in air blast air flue are located at the cylindrical tangent position of tube structure, and air-flow rises flowing in convoluted.
Preferably, being connected with an air pump on the outside of tube structure, humidity sensor is connected with air pump；Tube structure outer wall
It is additionally provided with two apertures；When humidity sensor detects that humidity does not reach requirement in tube structure, air pump will be toward filling in cylinder
Gas, then allow cylinder to reach certain aridity so that soil is hardened, and easily breaks into pieces, the aperture of tube structure outer wall be in order to
Allow in cylinder gas flowing faster.
Preferably, active bull stick is provided with bevel gear set with driven bull stick；Bevel gear set surface scribbles wear-resistant coating；It is resistance to
Mill coating forms triethanolamine 1-2 parts, tetraphenolic ethane tetraglycidel ether epoxy resin 50-60 by following component and parts by weight
Part, polybenzimidazoles 2-5 parts, diacetanilide 2-3 parts, polyvinyl butyral resin 3-5 parts, TAC 0.2-
0.4 part, stabilizer 0.2-0.3 parts, cyclohexane diol 0.02-0.05 parts, poly- 4-methyl-1-pentene 2-3 parts, aluminum nitride powder 3-5
Part, compounded mix 10-20 parts, sorbitan monooleate 0.02-0.05 parts；This coating be coated to active bull stick with it is driven
Drying and processing is passed through on bull stick surface.Be advantageous to improve tack, the wearability for rising coating and substrate, preferably extend and actively turn
The service life of bar and driven bull stick；Addition cyclohexane diol and sorbitan monooleate further increase the resistance to of coating
Mill property, while this coating also has good thermal insulation, UV resistant performance so that whole device is more durable.
Compared with prior art, beneficial effects of the present invention are：The present apparatus is simple in construction, easy to operate, easy to maintain, solution
Certainly have stone in soil or have the problem of thick block soil is unfavorable for plant growth, using in device other smash to pieces impact tool will tie
Block soil and rubble together hit fragmentation, can reach the purpose of soil and separated from impurities.Wear-resistant coating make drive connecting rod with
Follower link is more durable, has added air pump on the outside of tube structure, humidity can be reduced into standard limits once at once.
Present invention employs above-mentioned technical proposal to provide a kind of simple multifunctional antecedent soil moisture device, compensate for prior art
Deficiency, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is a kind of structural representation of simple multifunctional antecedent soil moisture device of the present invention；
Fig. 2 is a kind of sieves structural representation of simple multifunctional antecedent soil moisture device of the present invention；
Fig. 3 is a kind of air blast air flue gas flow schematic diagram of simple multifunctional antecedent soil moisture device of the present invention.
Description of reference numerals：1 fixed plate；2 wire brushes；3 shake rollers；4 ring-shaped steps；5 driven bull sticks；6 humidity inductives
Device；7 air pumps；8 active bull sticks；9 tube structures；10 sieves；11 limited bolts；Filtering table on 12；13 roll post；14 times filterings
Disk；16 air blast air flues.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As Figure 1-3, a kind of simple multifunctional antecedent soil moisture device；Including tube structure 9, sieves 10, air blast air flue 16,
Ring-shaped step 4 is provided among the inwall of tube structure 9；Ring-shaped step 4 is provided with circular filter sieve 10；The one end of sieves 10 with
Equipped with shake roller 3 between ring-shaped step 4；Limited bolt 11 is connected with the other end of sieves 10, at the bottom centre of tube structure 9
Equipped with active bull stick 8；The top of active bull stick 8 is connected with one end of driven bull stick 5；The other end connection shake rolling of driven bull stick 5
Wheel 3；Tube structure 9 is provided with the air blast air flue 16 for tilting installation；The inwall upper right corner of tube structure 9 is provided with fixed plate 1；It is fixed
Plate 1 is located at the top of sieves 10；Wire brush 2 is provided below in fixed plate 1；Wire brush 2 is curly；Wire brush can will be into
The soil block of block is divided into fritter, can also constantly scrape the fine earth in soil on foreign matter, avoid being adhered thin on foreign matter to smashing
Soil is difficult to come off and can not realize collection under vibrations；Wire brush for it is curly be in order to which the hole on sieves will not be caught on.Cylinder
The inwall upper left corner of body structure 9 is provided with limited bolt 11；One of the fixation sieves 10 of limited bolt 11 is longitudinal spring；Shake roller
Shake drives sieves, and limited bolt can prevent sieves from being rotated when shake, and two of longitudinal spring is solid respectively
Determined sieves and limited bolt, sieves can only in the vertical direction move up and down.The upper mistake that sieves 10 divides mutually to cover
Filter disc 12 and lower filtering table 14；Upper filtering table 12 and the lower place of covering of filtering table 14 are provided with spring；Upper filtering table 12 and lower filtering
Disk 14 is distributed with through hole；It is provided with the one side of upper filtering table 12 and rolls post 13；Lower filtering table 14 contacts with shake roller 3；
Secondary soil fragmentation area is formed between upper filtering table and lower filtering table, upper filtering table and lower filtering table can mutually compress secondary soil
The space in earth fragmentation area, cooperation roll post and carry out fragmentation again to the fine earth filtered into secondary soil fragmentation area, reach complete
The effect of fragmentation soil block.At least two air blast air flues 16 are set in tube structure 9；Two air blast air flues 16 are located at different level
On；Gas flow paths in air blast air flue are located at the cylindrical tangent position of tube structure, and air-flow rises flowing in convoluted.Cylinder
The outside of body structure 9 is connected with an air pump 7, and humidity sensor 6 is connected with air pump 7；The outer wall of tube structure 9 is additionally provided with two small
Hole；When humidity sensor detects that humidity does not reach requirement in tube structure, then air pump will allow cylinder toward inflating in cylinder
Reach certain aridity so that soil is hardened, and easily breaks into pieces, and the aperture of tube structure outer wall is to allow gas flowing in cylinder
Faster.
Active bull stick 8 is provided with angular wheel group with the driven junction of bull stick 5；Angular wheel group surface scribbles wear-resisting painting
Layer；Wear-resistant coating forms 1 part of triethanolamine, tetraphenolic ethane tetraglycidel ether epoxy resin 60 by following component and parts by weight
Part, 2 parts of polybenzimidazoles, 3 parts of diacetanilide, 5 parts of polyvinyl butyral resin, 0.02 part of cyclohexane diol, stabilizer 0.24
Part, 0.4 part of TAC, 2 parts of poly- 4-methyl-1-pentene, 5 parts of aluminum nitride powder, 20 parts of compounded mix, dehydration mountain
0.05 part of pears alcohol monoleate；This coating is coated to active bull stick and passes through drying and processing with driven bull stick surface.Be advantageous to improve
Tack, the wearability of coating and substrate are risen, preferably extends the service life of active bull stick and driven bull stick；Add hexamethylene
0.02 part of alkane glycol, 0.03 part of sorbitan monooleate further increase the wearability of coating, while add this coating
Also there is good thermal insulation, UV resistant performance so that whole device is more durable.
Stabilizer in wear-resistant coating is active peptides, and the amino acid sequence of active peptides is
QSGFCTSYCSKFCGTAGCSLYNLTPGKICYCLHCSS, each component added in energy stable coatings of the active peptides, changes
The sag resistance of kind coating and anti-settling, increase thixotropy, prevent shrinkage cavity, scar, foaming, pin hole, tangerine peel occur during spraying
Or the defects of boiling trace, the wearability and Scratch Resistance of coating are further enhanced, improves the durability for resisting external environmental factor.
Embodiment 2：
As Figure 1-3, a kind of simple multifunctional antecedent soil moisture device；The inwall of tube structure is provided with ring-shaped step in one week,
The sieves of circle is set on ring-shaped step；Setting active bull stick and driven bull stick in tube structure, the one of active bull stick
End connects and is mutually perpendicular to one end of driven bull stick, active bull stick other end connector drum structure inner bottom part center, from
The shake roller of ellipse is set on the turn bar other end, and shake roller is between ring-shaped step and sieves；Tube structure
Upper setting air blast air flue.Compared with prior art, the present invention drives the convolution of driven bull stick by the radial rotating of active bull stick
Rotate, so as to drive rolling of the shake roller between ring-shaped step and sieves, realize vibrations and shake, and be placed on filtering
Soil block on sieve is fragmented under strong vibrations as the screening process compared with small clod, then formation soil.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, is not chatted in detail herein
State.
It will be apparent to those skilled in the art that technical scheme that can be as described above and design, make other various
Corresponding change and deformation, and all these changes and deformation should all belong to the protection domain of the claims in the present invention
Within.
SEQUENCE LISTING
<110>Pujiang County crystalline substance rich peasant's industry Science and Technology Ltd.
<120>A kind of simple multifunctional antecedent soil moisture device
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 36
<212> PRT
<213>It is artificial synthesized
<400> 1
Gln Ser Gly Phe Cys Thr Ser Tyr Cys Ser Lys Phe Cys Gly Thr Ala
1 5 10 15
Gly Cys Ser Leu Tyr Asn Leu Thr Pro Gly Lys Ile Cys Tyr Cys Leu
20 25 30
His Cys Ser Ser
35
Claims (7)
1. a kind of simple multifunctional antecedent soil moisture device, including tube structure（9）, sieves（10）, air blast air flue（16）, it is special
Sign is：The tube structure（9）Inwall among be provided with ring-shaped step（4）, the ring-shaped step（4）It is provided with circular mistake
Screen（10）, the sieves（10）One end and ring-shaped step（4）Between equipped with shake roller（3）, the sieves（10）Separately
Limited bolt is connected with one end（11）, the tube structure（9）Active bull stick is housed at bottom centre（8）, the active bull stick
（8）Top and driven bull stick（5）One end connection, the driven bull stick（5）The other end connection shake roller（3）, cylinder knot
Structure（9）It is provided with the air blast air flue for tilting installation（16）.
A kind of 2. simple multifunctional antecedent soil moisture device according to claim 1；It is characterized in that：The tube structure
（9）The inwall upper right corner is provided with fixed plate（1）, the fixed plate（1）Positioned at sieves（10）Top, the fixed plate（1）
Lower section is provided with wire brush（2）, the wire brush（2）To be curly.
A kind of 3. simple multifunctional antecedent soil moisture device according to claim 1；It is characterized in that：The tube structure
（9）The inwall upper left corner set limited bolt（11）, the limited bolt（11）Fixed sieves（10）One be longitudinal spring.
A kind of 4. simple multifunctional antecedent soil moisture device according to claim 1；It is characterized in that：The sieves（10）
It is divided into the upper filtering table mutually covered（12）With lower filtering table（14）, the upper filtering table（12）With lower filtering table（14）Cover place
It is provided with spring, the upper filtering table（12）With lower filtering table（14）It is distributed with through hole, the upper filtering table（12）Below
On be provided with and roll post（13）.
A kind of 5. simple multifunctional antecedent soil moisture device according to claim 1；It is characterized in that：The tube structure
（9）Upper setting at least two air blast air flues（16）, two air blast air flues（16）On different level.
A kind of 6. simple multifunctional antecedent soil moisture device according to claim 1；It is characterized in that：The tube structure
（9）Outside is connected with an air pump（7）, the air pump（7）On be connected with humidity sensor（6）, the tube structure（9）On outer wall
End is symmetrically arranged with two apertures.
A kind of 7. simple multifunctional antecedent soil moisture device according to claim 1；It is characterized in that：The active bull stick
（8）With driven bull stick（5）Provided with bevel gear set, bevel gear set surface scribbles wear-resistant coating, the wear-resistant coating by below into
Divide and parts by weight form triethanolamine 1-2 parts, tetraphenolic ethane tetraglycidel ether epoxy resin 50-60 parts, stabilizer 0.2-
0.3 part, polybenzimidazoles 2-5 parts, diacetanilide 2-3 parts, polyvinyl butyral resin 3-5 parts, polysiloxanes 0.01-0.03
Part, TAC 0.2-0.4 parts, poly- 4-methyl-1-pentene 2-3 parts, aluminum nitride powder 3-5 parts, compounded mix 10-
20 parts, sorbitan monooleate 0.02-0.05 parts.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710642434.5A CN107621128A (en) | 2017-07-31 | 2017-07-31 | A kind of simple multifunctional antecedent soil moisture device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710642434.5A CN107621128A (en) | 2017-07-31 | 2017-07-31 | A kind of simple multifunctional antecedent soil moisture device |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107621128A true CN107621128A (en) | 2018-01-23 |
Family
ID=61088458
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710642434.5A Pending CN107621128A (en) | 2017-07-31 | 2017-07-31 | A kind of simple multifunctional antecedent soil moisture device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107621128A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109530910A (en) * | 2018-11-30 | 2019-03-29 | 绵阳高新区天力机械有限责任公司 | A method of changing product surface roughness using laser |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102656205A (en) * | 2009-12-17 | 2012-09-05 | 埃西勒国际通用光学公司 | Heat-curable epoxy functional composition and transparent heat-cured caustic-resistant hard-coatings prepared therefrom |
| CN102788483A (en) * | 2012-08-23 | 2012-11-21 | 中国神华能源股份有限公司 | Dryness keeping box |
| CN105057197A (en) * | 2015-08-21 | 2015-11-18 | 无锡乐华自动化科技有限公司 | Drying and screening device used before soil improvement |
| CN106752923A (en) * | 2016-11-28 | 2017-05-31 | 复旦大学 | A kind of damage resistant high, abrasion-resistant coatings material and preparation method thereof |
| CN106839738A (en) * | 2017-02-27 | 2017-06-13 | 安徽广深机电设备有限公司 | One kind circulation batch crop dryer drying chamber |
-
2017
- 2017-07-31 CN CN201710642434.5A patent/CN107621128A/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102656205A (en) * | 2009-12-17 | 2012-09-05 | 埃西勒国际通用光学公司 | Heat-curable epoxy functional composition and transparent heat-cured caustic-resistant hard-coatings prepared therefrom |
| CN102788483A (en) * | 2012-08-23 | 2012-11-21 | 中国神华能源股份有限公司 | Dryness keeping box |
| CN105057197A (en) * | 2015-08-21 | 2015-11-18 | 无锡乐华自动化科技有限公司 | Drying and screening device used before soil improvement |
| CN106752923A (en) * | 2016-11-28 | 2017-05-31 | 复旦大学 | A kind of damage resistant high, abrasion-resistant coatings material and preparation method thereof |
| CN106839738A (en) * | 2017-02-27 | 2017-06-13 | 安徽广深机电设备有限公司 | One kind circulation batch crop dryer drying chamber |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109530910A (en) * | 2018-11-30 | 2019-03-29 | 绵阳高新区天力机械有限责任公司 | A method of changing product surface roughness using laser |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107282445A (en) | A kind of dustless grain cleaning screening machine | |
| CN206613593U (en) | Laboratory soil sample crushes screening plant | |
| CN207214676U (en) | A kind of portable apparatus for airing herbal medicine | |
| CN107621128A (en) | A kind of simple multifunctional antecedent soil moisture device | |
| CN104826592A (en) | Antibacterial mildew-resistant modified active carbon filter material and preparation method thereof | |
| CN106186771A (en) | A kind of strengthening treatment process of construction refuse regenerated aggregate | |
| CN105057197B (en) | Screening plant is dried before a kind of soil improvement | |
| CN107033846B (en) | A kind of haze inhibitor and preparation method thereof | |
| CN208194929U (en) | A kind of dry screening plant of rocking wet sand | |
| US7393402B2 (en) | Pure pearl powder preparation method | |
| CN208542527U (en) | The efficient Sand screen of architectural engineering | |
| CN208252372U (en) | A kind of exhaust fan of big wind-force | |
| CN109675399B (en) | A kind of ore processing dust collecting process | |
| CN103830965A (en) | Palm fiber toughened composite ceramic filter element and preparation method thereof | |
| CN103830964A (en) | Ceramic filter element added with polyvinyl chloride powder and preparation method for ceramic filter element | |
| KR20110010086U (en) | Hitting Apparatus To Prevent Vibration Screen For Aggregate Selection From Being Blocked | |
| CN216368975U (en) | Screening and stirring device for improving recovery rate of alfalfa silage | |
| CN208419430U (en) | Multi-purpose medical sterilization of instruments dries drying frame | |
| CN108307894A (en) | A kind of snow cleaning plant for branch | |
| CN108801728A (en) | Experiment ground particle producing device | |
| KR100765172B1 (en) | A rainwater undercurrent tank and manufacturing method for rainwater undercurrent tank | |
| CN106560235A (en) | Preparation method and application of organic isocyanate-and-isorhodanate modified attapulgite | |
| CN107177219A (en) | A kind of preparation method of attapulgite photo-catalytic coating | |
| CN208600129U (en) | Road and bridge construction aggregate screening device | |
| CN209254960U (en) | A kind of self-adjustable organic waste grinding device |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20180123 |
|
| RJ01 | Rejection of invention patent application after publication |