CN107494373A - A kind of fish metal magnetic line mark - Google Patents
A kind of fish metal magnetic line mark Download PDFInfo
- Publication number
- CN107494373A CN107494373A CN201710538767.3A CN201710538767A CN107494373A CN 107494373 A CN107494373 A CN 107494373A CN 201710538767 A CN201710538767 A CN 201710538767A CN 107494373 A CN107494373 A CN 107494373A
- Authority
- CN
- China
- Prior art keywords
- fish
- inner casing
- shell
- line mark
- parts
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; CARE OF BIRDS, FISHES, INSECTS; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K61/00—Culture of aquatic animals
- A01K61/90—Sorting, grading, counting or marking live aquatic animals, e.g. sex determination
- A01K61/95—Sorting, grading, counting or marking live aquatic animals, e.g. sex determination specially adapted for fish
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D163/00—Coating compositions based on epoxy resins; Coating compositions based on derivatives of epoxy resins
- C09D163/10—Epoxy resins modified by unsaturated compounds
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D5/00—Coating compositions, e.g. paints, varnishes or lacquers, characterised by their physical nature or the effects produced; Filling pastes
- C09D5/08—Anti-corrosive paints
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L2205/00—Polymer mixtures characterised by other features
- C08L2205/02—Polymer mixtures characterised by other features containing two or more polymers of the same C08L -group
- C08L2205/025—Polymer mixtures characterised by other features containing two or more polymers of the same C08L -group containing two or more polymers of the same hierarchy C08L, and differing only in parameters such as density, comonomer content, molecular weight, structure
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L2205/00—Polymer mixtures characterised by other features
- C08L2205/03—Polymer mixtures characterised by other features containing three or more polymers in a blend
- C08L2205/035—Polymer mixtures characterised by other features containing three or more polymers in a blend containing four or more polymers in a blend
Abstract
The present invention provides a kind of fish metal magnetic line mark, belong to handmarking's technical field, this fish metal magnetic line mark includes inner casing, with the frequency core shooting piece disposed in inner casing, inner casing passes through support bar, adapter sleeve is connected with shell, thread plug is connected with adapter sleeve, fluid sealant is filled with the outside of thread plug, support ring is provided between inner casing middle part surface and shell, spherical pore is provided with support ring, balancing pole is mounted with spherical pore, this line mark is stayed in fish body by injecting in the fish body that the line mark of the present invention need to be marked by syringe insertion, design double Shell, which can effectively avoid inner casing from causing partially liq in fish body to enter in this line mark by fish body extruding rupture, makes it can not normal work, the balancing pole being provided with is advantageous to balance of the fish in water, teetertottered by balancing pole both ends and also help the travelling speed of fish.
Description
Technical field
The invention belongs to handmarking's technical field, and in particular to a kind of fish metal magnetic line mark.
Background technology
PIT marks are identified by radio-frequency identification system to animal, and label is glassware, nontoxic.
By injecting in implantation animal body each animal can be allowed to have a unique identity card.PIT technologies are applied to each
Field：Such as the tracking of mammal, fish, birds, reptile class, amphibian, trees and some unnamed valuable species
Monitoring, it is especially suitable for parent population mark, releasing mark, individual characters research.
The frequency core shooting piece of PIT marks of the prior art is by glass-encapsulated, but glass can moving about with fish in fish body
Be subjected to displacement, when being displaced on the bone side of fish, during fish swimming bone glass may be caused extruding cause glass rupture or
Crack, can penetrate into liquid in glass, frequency core shooting piece can not normal work, may be by fish after mark is expelled in fish body
Internal liquid corrosion, the sealing of mark is destroyed, although PIT of the prior art marks small volume, in implantation fish body
Activity that can be to fish after interior produces some small influences, such as may influence the travelling speed of fish, the balance in water
Property etc..
The content of the invention
The present invention provides a kind of fish metal magnetic line mark to solve problem present in background technology, using double Shell
Frequency core shooting piece is protected, line mark is not easy by liquid corrosion in fish body, can utilize balance to fish location tracking and storage biological information
Bar lifts the travelling speed of fish, is advantageous to improve the survival ability of mark fish.
The scheme taken to achieve the above object of the present invention is：A kind of fish metal magnetic line mark, including inner casing, and it is interior
The frequency core shooting piece of placement, inner casing are connected with shell by support bar, adapter sleeve, thread plug, screw thread are connected with adapter sleeve in shell
Side is filled with fluid sealant beyond the Great Wall, and support ring is provided between inner casing middle part surface and shell, spherical pore, spherical pore are provided with support ring
Balancing pole is inside mounted with, line mark of the invention is inserted in the fish body that need to be marked by syringe and this line mark is stayed in into fish by injecting
In vivo, design double Shell can effectively avoid inner casing from causing the partially liq in fish body to enter in this line mark by fish body extruding rupture
Make its can not normal work, the balancing pole being provided with is advantageous to balance of the fish in water, is teetertottered also by balancing pole both ends
Be advantageous to the travelling speed of fish.
Preferably, inner casing one end passes through adapter sleeve and cage connection, connection by support bar and cage connection, the other end
Put and be provided with locator, the endoporus of adapter sleeve is provided with screw thread, and the support bar and adapter sleeve of design can ensure the horizontal stroke of inner casing and shell
To being fixedly connected, by setting locator to keep, to marking fish real time location tracking, being provided with adapter sleeve on adapter sleeve
Screw thread can be connected with thread plug, avoid frequency core shooting piece from dropping.
Preferably, the balancing pole middle-end of placement is provided with the spheroid that interporal lacuna spherical with support ring coordinates in support ring, branch
The diameter of pushing out ring spherical pore and the sphere diameter ratio of balancing pole are 1：0.92 ~ 0.96, spheroid and the support czermak space of design coordinate
Spheroid can be made to be teetertottered with the travelling of fish, change the balance at spheroid both ends, be advantageous to lift this line and be marked in fish body
Balance so that lifted fish balance quality, when assemble balancing pole, can spherome surface coat lubricating oil, improve balance
The swing efficiency of bar.
Preferably, case surface is coated with erosion shield, erosion shield is made up of following component and parts by weight：Outside
Shell surface is coated with erosion shield, and erosion shield is made up of following component and parts by weight：Epoxy acrylic resin 36 ~ 48
Part, anilinomethyl trimethoxy silane 0.2-0.25 parts, stabilizer 0.2-0.3 parts, magnesium dimethacrylate 0.3-0.38 parts, benzene
It is formic acid dibutylester 3-6 parts, cyanacrylate 0.1-0.3 parts, hydroxy-ethyl acrylate 2-11 parts, polytetrafluoroethylene (PTFE) 2-3 parts, poly-
The weight ratio of vinyl alcohol 12.4-14 parts, p methoxy phenol 2-3 parts, epoxy acrylic resin and benzoic acid dibutylester is 6 ~ 12：
1, by controlling epoxy acrylic resin and the weight ratio of benzoic acid dibutylester effectively to strengthen erosion shield and case surface
Rate of drying and adhesive effect, erosion shield has excellent after case surface is coated through drying and processing, erosion shield
Anticorrosion effect, the acidic materials that can prevent from secreting in the flesh of fish cause its surface strength of corrosion and hard to case surface
Degree, by each in the anilinomethyl trimethoxy silane of addition, magnesium dimethacrylate, cyanacrylate and corrosion-inhibiting coating
Erosion shield antiseptic effect can be significantly increased in corrosion-inhibiting coating Surface Creation protective filmy layer after formula components combination, strengthens it
The ability of salt spray resistance, while this corrosion-inhibiting coating also has excellent heatproof, oil resistant, high pressure resistant, the low effect of deformation rate, incite somebody to action this
Line mark can coat one layer of micro anaesthetic powder before injecting fish body on erosion shield surface, can mitigate pain during injection as far as possible
It is bitter.
Preferably, the stabilizer in erosion shield formula is functional activity polypeptide, the amino acid of functional activity polypeptide
Sequence is：MVYKILTVCLVASLLETCLADYHTKYGKPSYGGYGGKGGRGGGGAVAHAHAHAHASAGAHGRARAHARAM
AHAHAGGGAHGHPGFAGSASAAARAARAGAVGGFGGGFGSASAAAAARAAAAAGGLGGGFGSAAANAAARAAAGGFG
, the stabilizer can significantly increase the chemical reaction stablizing effect of coating each composition in preparation process, be advantageous to lift anticorrosion
The salt tolerant fog effect of coating, while one layer of alienation layer is formed in coating most surface after coating is coated to case surface, it can avoid
Structure of fish muscle occurs to bond with line mark or liquid and case surface contact in fish, is advantageous to strengthen the antiseptic effect of corrosion-inhibiting coating
With anti-corrosion effective time.
Preferably, be spheroid among balancing pole, both ends are connected with balanced ball by connecting rod, among balanced ball and balancing pole
Sphere diameter ratio be 0.8 ~ 0.93:1, balancing pole both ends during fish swimming are made by the balanced ball and connecting rod of design
Balanced ball is swung up and down, and the balance and travelling speed, the sphere diameter ratio of design for contributing to lifting fish can strengthen balanced ball
Swing efficiency.
Preferably, shell and inner casing are spherocylinder, the thickness ratio of shell and inner casing is 1 ~ 1.4:1, using double Shell
Structure can avoid housing from causing mark can not normal work, the shell of design and the thickness of inner casing by the bone extruding rupture in fish body
Degree ratio can be remarkably reinforced the intensity and impact resistance of shell, be advantageous to protect the security seal of inner casing, avoid shell or inner casing table
Face cracks or ruptured, and ensures this line mark sealing and security.
Preferably, inner casing is close to provided with the angle that limiting plate, limiting plate and inwall are connected with the inwall of adapter sleeve one end
For 38 ° ~ 46 °, limiting plate can be provided with a parking space in inner casing, can place all kinds of small detectors or chip, limitation
Its displacement avoids occurring to hit damage, is advantageous to the detector or chip of protection storage, electronics is mounted with the inside of limiting plate
Chip, the electronic chip being provided with can store the biological information of mark fish, and electronic chip is taken out when capture mark fish again
Data therein can be contrasted, be not limited only in certain electronic chip store biological information can also be capture place, when
Between etc. other information.
Compared with prior art, beneficial effects of the present invention are：The line mark of the present invention need to be marked by syringe insertion
This line mark is stayed in fish body by injecting in fish body, using double-layer shell structure housing can be avoided to be extruded by the bone in fish body
Rupture cause mark can not normal work, the shell of design and the thickness ratio of inner casing can be remarkably reinforced intensity and the impact resistance of shell
Property, set locator to keep to marking fish real time location tracking on adapter sleeve, can be with screw thread provided with screw thread in adapter sleeve
Plug is connected, and avoids frequency core shooting piece from dropping, and the spheroid in the middle part of balancing pole coordinates with support czermak space can make spheroid with fish
The travelling balance for teetertottering, changing spheroid both ends, help to lift the balance of fish and travelling speed, be advantageous to carry
The survival ability of height mark fish, and this line mark is put simple in construction, and easily manufacture, mark is convenient, and cost is low, is adapted to individual amount
Big research, chip term of validity length, the research in cycle can be carried out to label life.
Present invention employs above-mentioned technical proposal to provide a kind of fish metal magnetic line mark, compensate for prior art not
Foot, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is a kind of fish metal magnetic line target sectional view of the present invention；
Fig. 2 is a kind of fish metal magnetic line target balancing pole schematic diagram of the present invention；
Fig. 3 is a kind of fish metal magnetic line target n portions of the invention partial enlarged drawing；
Fig. 4 is the schematic diagram of syringe.
Description of reference numerals：1 shell；2 inner casings；3 support bars；4 frequency core shooting pieces；5 balancing poles；6 support rings；7 limiting plates；8
Electronic chip；9 locators；10 thread plugs；11 fluid sealants；12 syringes；13 adapter sleeves.
Embodiment
It is described in further detail with reference to embodiments with accompanying drawing：
Embodiment 1：
As Figure 1-4, the frequency core shooting piece 4 of placement, inner casing 2 in a kind of fish metal magnetic line mark, including inner casing 2, and inner casing 2
Shell 1 is connected with by support bar 3, adapter sleeve 13, the one end of inner casing 2 is connected by support bar 3 with shell 1, and the other end passes through company
Female connector 13 is connected with shell 1, and the adapter sleeve 13 is provided with locator 9, and the endoporus of adapter sleeve 13 is provided with screw thread, the support of design
Bar 3 and adapter sleeve 13 can ensure that inner casing 2 and the transverse direction of shell 1 are fixedly connected, and thread plug 10, thread plug are connected with adapter sleeve 13
10 outsides be filled with fluid sealant 11, and shell 1 and inner casing 2 be spherocylinder, and the thickness ratio of shell 1 and inner casing 2 is 1.2:1, inner casing 2 leans on
Closely it is provided with one end inwall of adapter sleeve 13 and is connected with limiting plate 7, the angle of limiting plate 7 and inwall is 42 °, the middle part surface of inner casing 2
Support ring 6 is provided between shell 1, spherical pore is provided with support ring 6, balancing pole 5 is mounted with spherical pore, is pacified in support ring 6
The middle-end of balancing pole 5 put is provided with the spheroid coordinated with 6 spherical interporal lacuna of support ring, diameter and the balancing pole 5 of the spherical pore of support ring 6
Sphere diameter ratio be 1：0.94, the centre of balancing pole 5 is spheroid, and both ends are connected with balanced ball, balanced ball and balance by connecting rod
Sphere diameter ratio among bar 5 is 0.85:1.
The line mark of the present invention is inserted in the fish body that need to be marked by syringe 13 and is stayed in this line mark in fish body by injecting,
Design double Shell, which can effectively avoid inner casing from causing the partially liq in fish body to enter in this line mark by fish body extruding rupture, makes it
Can not normal work, the balancing pole 5 being provided with is advantageous to balance of the fish in water, teetertottered also by the both ends of balancing pole 5
Beneficial to the travelling speed of fish.
The surface of shell 1 is coated with erosion shield, and erosion shield is made up of following component and parts by weight：The surface of shell 1
Coated with erosion shield, erosion shield is made up of following component and parts by weight：36 parts of epoxy acrylic resin, anilinomethyl
0.22 part of trimethoxy silane, 0.24 part of stabilizer, 0.34 part of magnesium dimethacrylate, 4 parts of benzoic acid dibutylester, cyanoacrylate
0.2 part of acetoacetic ester, 8 parts of hydroxy-ethyl acrylate, 2 parts of polytetrafluoroethylene (PTFE), 13 parts of polyvinyl alcohol, 2 parts of p methoxy phenol, epoxy third
The weight ratio of olefin(e) acid resin and benzoic acid dibutylester is 9：1, by the weight for controlling epoxy acrylic resin and benzoic acid dibutylester
Amount is than can effectively strengthen erosion shield and the rate of drying and adhesive effect on the surface of shell 1, and erosion shield is in coating shell 1
Through drying and processing behind surface, erosion shield has excellent anticorrosion effect, can prevent the acidic materials pair secreted in the flesh of fish
Its surface strength of corrosion and hardness are caused in the surface of shell 1, pass through the anilinomethyl trimethoxy silane of addition, dimethyl propylene
Olefin(e) acid magnesium, cyanacrylate combined with each formula components in corrosion-inhibiting coating after in corrosion-inhibiting coating Surface Creation protective filmy layer
Erosion shield antiseptic effect can be significantly increased, strengthen the ability of its salt spray resistance, at the same this corrosion-inhibiting coating also have it is excellent resistance to
Temperature, oil resistant, high pressure resistant, the low effect of deformation rate, one can be coated on erosion shield surface before this line mark to be injected to fish body
The micro anaesthetic powder of layer, pain during injection can be mitigated as far as possible.
Stabilizer in erosion shield is functional activity polypeptide, and the amino acid sequence of functional activity polypeptide is：
MVYKILTVCLVASLLETCLADYHTKYGKPSYGGYGGKGGRGGGGAVAHAHAHAHASAGAHGRARAHARAMAHAHAGG
GAHGHPGFAGSASAAARAARAGAVGGFGGGFGSASAAAAARAAAAAGGLGGGFGSA AANAAARAAAGGFG, this is stable
Agent can significantly increase the chemical reaction stablizing effect of coating each composition in preparation process, be advantageous to lift the resistance to of erosion shield
Salt fog effect, while one layer of alienation layer is formed in coating most surface after coating is coated to the surface of shell 1, structure of fish muscle can be avoided
The liquid and case surface contact in bonding or fish occurs with line mark, the antiseptic effect and anti-corrosion for being advantageous to strengthen corrosion-inhibiting coating have
Imitate the time.
Embodiment 2：
As shown in Fig. 1 ~ 4, the frequency core shooting piece 4 of placement, inner casing 2 in a kind of fish metal magnetic line mark, including inner casing 2, and inner casing 2
One end is connected by support bar 3 with shell 1, and the other end is connected by adapter sleeve 13 with shell 1, and adapter sleeve 13 is provided with locator
9, the endoporus of adapter sleeve 13 is provided with screw thread, and the support bar 3 and adapter sleeve 13 of design can ensure that the transverse direction of inner casing 2 and shell 1 is fixed
Connection, shell 1 and inner casing 2 be spherocylinder, and the thickness ratio of shell 1 and inner casing 2 is 1.3:1, it can be avoided using double-layer shell structure
Housing by fish body bone extruding rupture cause mark can not normal work, the shell 1 of design can be bright with the thickness ratio of inner casing 2
The intensity and impact resistance of aobvious enhancing shell, be advantageous to protect the security seal of inner casing 2, avoid shell 1 or the surface of inner casing 2 from producing
Crackle or rupture, ensure this line mark sealing and security.By setting locator 9 to keep to marking fish on adapter sleeve 13
Class real time location tracking, the interior screw thread that is provided with of adapter sleeve 13 can be connected with thread plug 10, avoid frequency core shooting piece 4 from dropping.Connection
Thread plug 10 is connected with set 13, the outside of thread plug 10 is filled with fluid sealant 11, and inner casing 2 is close to be provided with one end inwall of adapter sleeve 13
On be connected with limiting plate 7, the angle of limiting plate 7 and inwall is 45 °, and limiting plate 7 can be provided with a parking space in inner casing 2,
All kinds of small detectors or chip can be placed, its displacement is limited and avoids occurring to hit damage, be advantageous to protection storage
Detector or chip, the inner side of limiting plate 7 are mounted with electronic chip 8, and the electronic chip 8 being provided with can store the biology letter of mark fish
Breath, when capture mark fish again, taking-up electronic chip 8 can be contrasted data therein, in certain electronic chip 8 not
It is only limitted to storage biological information and can also be the other informations such as capture place, time.Set between the middle part surface of inner casing 2 and shell 1
There is support ring 6, the middle-end of balancing pole 5 disposed in support ring 6 is provided with the spheroid coordinated with 6 spherical interporal lacuna of support ring, support ring 6
The diameter of spherical pore is 1 with the sphere diameter ratio of balancing pole 5：0.95, the spheroid of design coordinates with the gap of support ring 6 can make spheroid
Travelling with fish teetertotters, and changes the balance at spheroid both ends, is advantageous to lift the balance that this line is marked in fish body
And then the balance quality of fish is lifted, when assembling balancing pole 5, lubricating oil can be coated in spherome surface, improve the pendulum of balancing pole 5
Efficiency of movement, be spheroid among balancing pole 5, and both ends are connected with balanced ball by connecting rod, and the spheroid of balanced ball and the centre of balancing pole 5 is straight
Footpath ratio is 0.85:1, make balancing pole 5 during the fish swimming above and below the balanced ball at both ends by the balanced ball and connecting rod of design
Swing, help to lift the balance of fish and travelling speed, swing efficiency of the sphere diameter than balanced ball can be strengthened of design.
The line mark of the present invention is inserted in the fish body that need to be marked by syringe 13 and is stayed in this line mark in fish body by injecting,
Design double Shell, which can effectively avoid inner casing from causing the partially liq in fish body to enter in this line mark by fish body extruding rupture, makes it
Can not normal work, the balancing pole 5 being provided with is advantageous to balance of the fish in water, teetertottered also by the both ends of balancing pole 5
Beneficial to the travelling speed of fish.
The surface of shell 1 is coated with erosion shield, and erosion shield is made up of following component and parts by weight：Case surface applies
Erosion shield is covered with, erosion shield is made up of following component and preferred weight part：36 parts of epoxy acrylic resin, aniline first
0.22 part of base trimethoxy silane, 0.24 part of stabilizer, 0.35 part of magnesium dimethacrylate, 3 parts of benzoic acid dibutylester, cyano group third
0.16 part of olefin(e) acid ethyl ester, 8 parts of hydroxy-ethyl acrylate, 2 parts of polytetrafluoroethylene (PTFE), 12.8 parts of polyvinyl alcohol, p methoxy phenol 2.5
Part, the weight ratio of epoxy acrylic resin and benzoic acid dibutylester is 12：1, by controlling epoxy acrylic resin and benzoic acid
Rate of drying and adhesive effect of the weight of dibutylester than can effectively strengthen erosion shield and the surface of shell 1, erosion shield
Through drying and processing behind coating shell 1 surface, erosion shield has excellent anticorrosion effect, can prevent what is secreted in the flesh of fish
Acidic materials or other corrosive elements cause its surface strength of corrosion and hardness to the surface of shell 1, pass through the benzene of addition
Amine MTMS, magnesium dimethacrylate, cyanacrylate with after each formula components are combined in corrosion-inhibiting coating
Erosion shield antiseptic effect can be significantly increased in corrosion-inhibiting coating Surface Creation protective filmy layer, hence it is evident that improve the resistance to of corrosion-inhibiting coating
The ability of salt fog, while this corrosion-inhibiting coating also has excellent heatproof, oil resistant, high pressure resistant, the low effect of deformation rate, by this line
Mark can coat one layer of micro anaesthetic powder before injecting fish body on erosion shield surface, can mitigate pain during injection as far as possible.
Stabilizer in erosion shield is functional activity polypeptide, and the amino acid sequence of functional activity polypeptide is：
MVYKILTVCLVASLLETCLADYHTKYGKPSYGGYGGKGGRGGGGAVAHAHAHAHASAGAHGRARAHARAMAHAHAGG
GAHGHPGFAGSASAAARAARAGAVGGFGGGFGSASAAAAARAAAAAGGLGGGFGSA AANAAARAAAGGFG, this is stable
Agent can significantly increase the chemical reaction stablizing effect of coating each composition in preparation process, be advantageous to lift the resistance to of erosion shield
Salt fog effect, while one layer of alienation layer is formed in coating most surface after coating is coated to the surface of shell 1, structure of fish muscle can be avoided
The liquid and case surface contact in bonding or fish occurs with line mark, the antiseptic effect and anti-corrosion for being advantageous to strengthen corrosion-inhibiting coating have
Imitate the time.
Embodiment 3：
When this line is marked on real work, biological specimen collection is carried out after the fish of the invention that capture need to mark and deposits data
The inner side of limiting plate 7 is put into after storing up in electronic chip 8, limiting plate 7 can be provided with a parking space in inner casing 2, can place each
Class small detector or chip, limit its displacement and avoid occurring to hit damage, place into frequency core shooting piece 4, complete frequency and penetrate
Thread plug fine jade is entered in adapter sleeve 13 after the fixation of chip 4, and in the outside filling with sealant 11 of thread plug 10, completed to line target
Sealing, after metal magnetic line mark is by loading syringe 13, erosion shield, the pin of syringe 13 are coated with by the surface of shell 1
After in the fish body that pipe insertion need to mark, this line mark is stayed in fish body by injecting, the surface spraying of shell 1 has erosion shield,
And this line mark just can be used after being dried to it, erosion shield has excellent anticorrosion effect, can prevent from secreting in the flesh of fish
Acidic materials its surface strength of corrosion and hardness are caused to the surface of shell 1, can be this line mark is injected before fish body
Erosion shield surface coats one layer of micro anaesthetic powder, can mitigate pain during injection as far as possible, the specific dosage of anaesthetic point should
Used according to the ability to bear of the fish of mark, the fish body of mark can be carried out according to locator 9 after line mark is injected in fish body
Follow, is provided with support ring 6 between the middle part surface of inner casing 2 and shell 1, in support ring 6 middle-end of balancing pole 5 of placement be provided with
The spheroid that 6 spherical interporal lacuna of support ring coordinates, lubricating oil can be coated in spherome surface, improve the swing efficiency of balancing pole 5, design
Spheroid and the gap of support ring 6 coordinate spheroid can be made to be teetertottered with the travelling of fish, change the balance at spheroid both ends, have
It is marked on balance in fish body beneficial to this line is lifted and then lifts the balance quality of fish and travelling speed, improves the fish of mark
Survival rate, certainly in the fish body of location tracking mark, data therein can be directly read after fish body by code reader,
Line mark need not be taken, line mark of the invention can be not only used for the mark that fish can be also used for birds.
The diameter of the spherical pore of support ring 6 is not limited only to 1 with the sphere diameter ratio of balancing pole 5：0.92 ~ 0.96, it can also be
1:0.92 or 1:0.93 or 1:0.94 or 1:0.95 or 1:0.96；Sphere diameter ratio among balanced ball and balancing pole 5 not only limits
In 0.8 ~ 0.93:1, it can also be 0.8:1 or 0.81:1 or 0.82:1 or 0.83:1 ... or 0.92:1 or 0.93:1；Shell 1
1 ~ 1.4 is not limited only to the thickness ratio of inner casing 2:1, it can also be 1:1 or 1.01:1 or 1.02:1 or 1.03:1 ... or 1.39:
1 or 1.4:1；The angle of limiting plate 7 and the inwall of inner casing 1 is not limited only to 38 ° ~ 46 °, can also be 38 ° or 38.1 ° or 38.2 ° or
38.3 ° ... or 45.9 ° or 46 °.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment 1 ~ 3, do not make herein in detail
Thin narration.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
SEQUENCE LISTING
<110>Zhejiang Ocean university
<120>A kind of fish metal magnetic line mark
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 147
<212> PRT
<213>It is artificial synthesized
<400> 1
Met Val Tyr Lys Ile Leu Thr Val Cys Leu Val Ala Ser Leu Leu Glu
1 5 10 15
Thr Cys Leu Ala Asp Tyr His Thr Lys Tyr Gly Lys Pro Ser Tyr Gly
20 25 30
Gly Tyr Gly Gly Lys Gly Gly Arg Gly Gly Gly Gly Ala Val Ala His
35 40 45
Ala His Ala His Ala His Ala Ser Ala Gly Ala His Gly Arg Ala Arg
50 55 60
Ala His Ala Arg Ala Met Ala His Ala His Ala Gly Gly Gly Ala His
65 70 75 80
Gly His Pro Gly Phe Ala Gly Ser Ala Ser Ala Ala Ala Arg Ala Ala
85 90 95
Arg Ala Gly Ala Val Gly Gly Phe Gly Gly Gly Phe Gly Ser Ala Ser
100 105 110
Ala Ala Ala Ala Ala Arg Ala Ala Ala Ala Ala Gly Gly Leu Gly Gly
115 120 125
Gly Phe Gly Ser Ala Ala Ala Asn Ala Ala Ala Arg Ala Ala Ala Gly
130 135 140
Gly Phe Gly
145
Claims (7)
1. a kind of fish metal magnetic line mark, including inner casing（2）, and inner casing（2）The frequency core shooting piece of interior placement（4）, its feature exists
In：The inner casing（2）Pass through support bar（3）, adapter sleeve（13）It is connected with shell（1）, the adapter sleeve（13）Inside it is connected with spiral shell
Line plug（10）, the thread plug（10）Outside is filled with fluid sealant（11）, the inner casing（2）Middle part surface and shell（1）Between
Provided with support ring（6）, the support ring（6）It is interior to be provided with spherical pore, it is mounted with balancing pole in the spherical pore（5）.
A kind of 2. fish metal magnetic line mark according to claim 1, it is characterised in that：The inner casing（2）One end passes through
Support bar（3）With shell（1）Connection, the other end pass through adapter sleeve（13）With shell（1）Connection, the adapter sleeve（13）It is provided with
Locator（9）, the adapter sleeve（13）Endoporus be provided with screw thread.
A kind of 3. fish metal magnetic line mark according to claim 1, it is characterised in that：The support ring（6）Interior placement
Balancing pole（5）Middle-end is provided with and support ring（6）The spheroid that spherical interporal lacuna coordinates, the support ring（6）The diameter of spherical pore
With balancing pole（5）Sphere diameter ratio be 1：0.92~0.96.
A kind of 4. fish metal magnetic line mark according to claim 1, it is characterised in that：The shell（1）Surface coats
There is erosion shield, the erosion shield is made up of following component and parts by weight：36 ~ 48 parts of epoxy acrylic resin, aniline
MTMS 0.2-0.25 parts, stabilizer 0.2-0.3 parts, magnesium dimethacrylate 0.3-0.38 parts, benzoic acid two
Fourth fat 3-6 parts, cyanacrylate 0.1-0.3 parts, hydroxy-ethyl acrylate 2-11 parts, polytetrafluoroethylene (PTFE) 2-3 parts, polyvinyl alcohol
The weight ratio of 12.4-14 parts, p methoxy phenol 2-3 parts, epoxy acrylic resin and benzoic acid dibutylester is 6 ~ 12：1.
A kind of 5. fish metal magnetic line mark according to claim 1, it is characterised in that：The balancing pole（5）Centre is
Spheroid, both ends are connected with balanced ball, the balanced ball and balancing pole by connecting rod（5）Middle sphere diameter ratio for 0.8 ~
0.93:1。
A kind of 6. fish metal magnetic line mark according to claim 1, it is characterised in that：The shell（1）And inner casing（2）
For spherocylinder, the shell（1）With inner casing（2）Thickness ratio be 1 ~ 1.4:1.
A kind of 7. fish metal magnetic line mark according to claim 1, it is characterised in that：The inner casing（2）It is close to be provided with
Adapter sleeve（13）Limiting plate is connected with the inwall of one end（7）, limiting plate（7）Angle with inwall is 38 ° ~ 46 °, the limiting plate
（7）Inner side is mounted with electronic chip（8）.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710538767.3A CN107494373A (en) | 2017-07-04 | 2017-07-04 | A kind of fish metal magnetic line mark |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710538767.3A CN107494373A (en) | 2017-07-04 | 2017-07-04 | A kind of fish metal magnetic line mark |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107494373A true CN107494373A (en) | 2017-12-22 |
Family
ID=60679498
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710538767.3A Withdrawn CN107494373A (en) | 2017-07-04 | 2017-07-04 | A kind of fish metal magnetic line mark |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107494373A (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5482008A (en) * | 1991-09-13 | 1996-01-09 | Stafford; Rodney A. | Electronic animal identification system |
| US5588234A (en) * | 1992-09-21 | 1996-12-31 | N.V. Nederlandsche Apparatenfabriek Nedap | Fraud-resistant electronic identification device |
-
2017
- 2017-07-04 CN CN201710538767.3A patent/CN107494373A/en not_active Withdrawn
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5482008A (en) * | 1991-09-13 | 1996-01-09 | Stafford; Rodney A. | Electronic animal identification system |
| US5588234A (en) * | 1992-09-21 | 1996-12-31 | N.V. Nederlandsche Apparatenfabriek Nedap | Fraud-resistant electronic identification device |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN104285122A (en) | Biological active bullets, systems, and methods | |
| CN107494373A (en) | A kind of fish metal magnetic line mark | |
| Soll | Candida biofilms: is adhesion sexy? | |
| CN103153336B (en) | For controlling the vaccine combination of ectoparasite infestation | |
| CN107439452A (en) | One kind is used for tuna metal magnetic line mark | |
| CN104404511A (en) | Preparation method of dopamine biomass anti-corrosive film on magnesium alloy surface | |
| CN103319605B (en) | A kind of liver targeting peptides and Angiostatin fusion and preparation method thereof and application | |
| CN107318739A (en) | A kind of abyssal fishes metal magnetic line mark | |
| CN107517908A (en) | A kind of five spine broad shad metal magnetic line marks | |
| CN103224893B (en) | A kind of large yellow croaker antibacterial peptide hepcidin gene yeast expression product and preparation method thereof and application | |
| CN105504063B (en) | The antineoplastic amalgamation protein of a kind of alexin-albumin and its preparation and application | |
| CN107082804A (en) | A kind of egg-shaped pompano β thymosin extrasins and its application | |
| CN104862757B (en) | Metal surface treatment method based on chitosan and mussel adhesion protein composite membrane | |
| AU690442B2 (en) | Shot pellets for game hunting on wet marschlands and a method of manufacturing such shot | |
| Denny et al. | Leishmania major: clathrin and adaptin complexes of an intra-cellular parasite | |
| EP0626060B1 (en) | Shot for wild game hunting and a method for its manufacture | |
| CN107372272B (en) | Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone | |
| CN107393411A (en) | It is a kind of to trace label for dolphin | |
| CN103897422A (en) | Young inkfish marking method, reagent and application | |
| CN107439453B (en) | Traceability device carrying fish biological information | |
| DE69729010T2 (en) | PRODUCTION OF THE PROTEIN INGAP HIGH EXPRESSION RATE | |
| Reina | Salt gland blood flow in the hatchling green turtle, Chelonia mydas | |
| Kim et al. | Complete mitochondrial genome of a water deer subspecies, Hydropotes inermis argyropus (Cervidae: Hydropotinae) | |
| CN108715851A (en) | A kind of Epinephelus coioides are ingested regulation and control related gene AgRP1 and its application | |
| CN101816299B (en) | In-vitro tissue stabilization protective agent and preparation method thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20171222 |
|
| WW01 | Invention patent application withdrawn after publication |