CN107486428A - A kind of cleaning drying device - Google Patents
A kind of cleaning drying device Download PDFInfo
- Publication number
- CN107486428A CN107486428A CN201710586686.0A CN201710586686A CN107486428A CN 107486428 A CN107486428 A CN 107486428A CN 201710586686 A CN201710586686 A CN 201710586686A CN 107486428 A CN107486428 A CN 107486428A
- Authority
- CN
- China
- Prior art keywords
- cleaning
- cleaning storehouse
- housing
- drying device
- storehouse
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000004140 cleaning Methods 0.000 title claims abstract description 136
- 238000001035 drying Methods 0.000 title claims abstract description 45
- 239000000463 material Substances 0.000 claims abstract description 79
- 230000007246 mechanism Effects 0.000 claims abstract description 69
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims abstract description 58
- 238000010438 heat treatment Methods 0.000 claims abstract description 25
- 230000000903 blocking effect Effects 0.000 claims abstract description 12
- 239000011248 coating agent Substances 0.000 claims description 13
- 238000000576 coating method Methods 0.000 claims description 13
- 238000007599 discharging Methods 0.000 claims description 8
- 239000002519 antifouling agent Substances 0.000 claims description 7
- 238000003756 stirring Methods 0.000 claims description 7
- 230000005540 biological transmission Effects 0.000 claims description 6
- 238000005507 spraying Methods 0.000 claims description 6
- 238000007598 dipping method Methods 0.000 claims description 4
- OEPOKWHJYJXUGD-UHFFFAOYSA-N 2-(3-phenylmethoxyphenyl)-1,3-thiazole-4-carbaldehyde Chemical compound O=CC1=CSC(C=2C=C(OCC=3C=CC=CC=3)C=CC=2)=N1 OEPOKWHJYJXUGD-UHFFFAOYSA-N 0.000 claims description 3
- RSWGJHLUYNHPMX-UHFFFAOYSA-N Abietic-Saeure Natural products C12CCC(C(C)C)=CC2=CCC2C1(C)CCCC2(C)C(O)=O RSWGJHLUYNHPMX-UHFFFAOYSA-N 0.000 claims description 3
- KHPCPRHQVVSZAH-HUOMCSJISA-N Rosin Natural products O(C/C=C/c1ccccc1)[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 KHPCPRHQVVSZAH-HUOMCSJISA-N 0.000 claims description 3
- KHPCPRHQVVSZAH-UHFFFAOYSA-N trans-cinnamyl beta-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OCC=CC1=CC=CC=C1 KHPCPRHQVVSZAH-UHFFFAOYSA-N 0.000 claims description 3
- 239000011347 resin Substances 0.000 claims description 2
- 229920005989 resin Polymers 0.000 claims description 2
- 238000005406 washing Methods 0.000 claims description 2
- 239000012535 impurity Substances 0.000 abstract description 8
- 230000000694 effects Effects 0.000 description 7
- 230000003373 anti-fouling effect Effects 0.000 description 5
- 235000013339 cereals Nutrition 0.000 description 4
- 230000033001 locomotion Effects 0.000 description 4
- 230000000813 microbial effect Effects 0.000 description 4
- 239000007921 spray Substances 0.000 description 4
- 244000005700 microbiome Species 0.000 description 3
- DAKSMIWQZPHRIB-BZSNNMDCSA-N His-Tyr-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O DAKSMIWQZPHRIB-BZSNNMDCSA-N 0.000 description 2
- MPPHJZYXDVDGOF-BWBBJGPYSA-N Ser-Cys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CO MPPHJZYXDVDGOF-BWBBJGPYSA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 239000011538 cleaning material Substances 0.000 description 2
- 235000013399 edible fruits Nutrition 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000009434 installation Methods 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 239000003973 paint Substances 0.000 description 2
- 239000012466 permeate Substances 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 238000007789 sealing Methods 0.000 description 2
- 239000002699 waste material Substances 0.000 description 2
- DECCMEWNXSNSDO-ZLUOBGJFSA-N Ala-Cys-Ala Chemical compound C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O DECCMEWNXSNSDO-ZLUOBGJFSA-N 0.000 description 1
- SPIPSJXLZVTXJL-ZLUOBGJFSA-N Asn-Cys-Ser Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O SPIPSJXLZVTXJL-ZLUOBGJFSA-N 0.000 description 1
- WZJLBUPPZRZNTO-CIUDSAMLSA-N Cys-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)N WZJLBUPPZRZNTO-CIUDSAMLSA-N 0.000 description 1
- QCBYAHHNOHBXIH-UWVGGRQHSA-N His-Pro-Gly Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)NCC(O)=O)C1=CN=CN1 QCBYAHHNOHBXIH-UWVGGRQHSA-N 0.000 description 1
- DGLAHESNTJWGDO-SRVKXCTJSA-N His-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N DGLAHESNTJWGDO-SRVKXCTJSA-N 0.000 description 1
- LJADEBULDNKJNK-IHRRRGAJSA-N Lys-Leu-Val Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O LJADEBULDNKJNK-IHRRRGAJSA-N 0.000 description 1
- ALEVUGKHINJNIF-QEJZJMRPSA-N Lys-Phe-Ala Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CC1=CC=CC=C1 ALEVUGKHINJNIF-QEJZJMRPSA-N 0.000 description 1
- OSFZCEQJLWCIBG-BZSNNMDCSA-N Ser-Tyr-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OSFZCEQJLWCIBG-BZSNNMDCSA-N 0.000 description 1
- YRNBANYVJJBGDI-VZFHVOOUSA-N Thr-Ala-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)O)N)O YRNBANYVJJBGDI-VZFHVOOUSA-N 0.000 description 1
- 150000001413 amino acids Chemical group 0.000 description 1
- 238000013475 authorization Methods 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 239000004566 building material Substances 0.000 description 1
- 239000008199 coating composition Substances 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 239000003344 environmental pollutant Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000011194 food seasoning agent Nutrition 0.000 description 1
- 108010015792 glycyllysine Proteins 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 238000007603 infrared drying Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000005272 metallurgy Methods 0.000 description 1
- -1 metallurgy Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000010422 painting Methods 0.000 description 1
- 231100000719 pollutant Toxicity 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000007639 printing Methods 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 238000007440 spherical crystallization Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B08—CLEANING
- B08B—CLEANING IN GENERAL; PREVENTION OF FOULING IN GENERAL
- B08B3/00—Cleaning by methods involving the use or presence of liquid or steam
- B08B3/02—Cleaning by the force of jets or sprays
- B08B3/022—Cleaning travelling work
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D29/00—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor
- B01D29/11—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with bag, cage, hose, tube, sleeve or like filtering elements
- B01D29/13—Supported filter elements
- B01D29/23—Supported filter elements arranged for outward flow filtration
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D29/00—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor
- B01D29/50—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with multiple filtering elements, characterised by their mutual disposition
- B01D29/52—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor with multiple filtering elements, characterised by their mutual disposition in parallel connection
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D29/00—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor
- B01D29/96—Filters with filtering elements stationary during filtration, e.g. pressure or suction filters, not covered by groups B01D24/00 - B01D27/00; Filtering elements therefor in which the filtering elements are moved between filtering operations; Particular measures for removing or replacing the filtering elements; Transport systems for filters
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F26—DRYING
- F26B—DRYING SOLID MATERIALS OR OBJECTS BY REMOVING LIQUID THEREFROM
- F26B23/00—Heating arrangements
Landscapes
- Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Sustainable Development (AREA)
- Mechanical Engineering (AREA)
- General Engineering & Computer Science (AREA)
- Cleaning By Liquid Or Steam (AREA)
Abstract
The present invention provides a kind of cleaning drying device, including housing, housing upper end is provided with cleaning storehouse, housing central section is provided with supporting plate, supporting plate upper end is provided with water storing bin, filter mechanism and wiper mechanism, housing lower end is provided with collecting bin, housing bottom is provided with universal wheel, housing right side wall is provided with rabbling mechanism, housing front side wall is provided with blocking mechanism, cleaning storehouse and collecting bin bottom are provided with heating tube, apparatus of the present invention have cleaning, drying function, and it is joined integrally, improve and carried out the utilization rate of device, and it is provided with filter mechanism, the removal of impurity can effectively be filtered off, and it can clean and dry simultaneously various materials, greatly improve the operating efficiency of the present apparatus.
Description
Technical field
The present invention relates to a kind of cleaning drying device, and in particular to a kind of cleaning drying device.
Background technology
The English full name of drying plant is Drying equipment, is referred to by certain technological means, dried object body surface
A series of combination of plant equipment of the moisture in face or other liquid.Currently a popular drying technology is mainly ultraviolet drying,
Infrared drying, electromagnetic drying and hot-air seasoning.They have their own characteristics each, and are widely used in the drying of various plant equipment and food,
It is mainly used in the material that certain humidity or granularity are dried in the departments such as ore dressing, building materials, metallurgy, chemical industry, printing.
Such as, Chinese invention patent mandate document, Authorization Notice No. CN104874562B, the invention is related to paddy to prior art
Thing cleaning equipment field, specifically one kind of multiple cereal simultaneously cleaning drying device, including fuselage, cleaning storehouse, drain sump,
Collecting bin, cleaning device, agitating device, retention device and heating tube, described fuselage generally cube structure, described is clear
Bring down stocks and be located at back, described drain sump is located at waist, and described collecting bin is located at underbelly；Described cleaning
Storehouse is evenly arranged with three along fuselage, and described drain sump is arranged in the supporting plate of waist, described cleaning device bag
Water pump, suction hose, outlet pipe and shower nozzle are included, described agitating device includes stirring motor and agitating shaft, described retention device
Including top plate, cylinder and baffle plate, described collecting bin bottom is installed with heating tube.The invention can be realized to paddy not of the same race
Cleaning, drying while thing, when needing to clean not cereal of the same race, the invention can effectively improve cleaning efficiency.But actually should
Water and debris after the invention is cleaned in enter drain sump, may cause drain sump cleaning inconvenience, thereby increases and it is possible to cause debris to block up
Fill in the phenomenon that the shower nozzle in cleaning device blocks.
The content of the invention
The present invention provides one kind for solution above-mentioned technical problem and cleaned up comprehensively, and has filtering foreign mechanism, filters
Nonpolluting coating is coated with mechanism, a kind of cleaning, drying dress of the function integration of filter mechanism strainability can be effectively improved
Put.
The present invention is for the scheme taken of solution above-mentioned technical problem：A kind of cleaning drying device, including housing, housing
Upper end is provided with cleaning storehouse, and housing central section is provided with supporting plate, and supporting plate upper end is provided with water storing bin, filter mechanism and wiper mechanism, shell
Body lower end is provided with collecting bin, and housing bottom is provided with universal wheel, and housing right side wall is provided with rabbling mechanism, and housing front side wall, which is provided with, to be stopped
Mechanism, cleaning storehouse and collecting bin bottom are provided with heating tube, and apparatus of the present invention have cleaning, drying function, and be it is joined integrally,
Improve and carried out the utilization rate of device, and can clean and dry simultaneously various materials, improve device operating efficiency.
Preferably, cleaning storehouse is distributed in case inside, cleaning storehouse is open-topped cube structure, at the top of cleaning storehouse
Back edge is provided with charging aperture, and from back to front diagonally downward, the inclination angle of bottom surface is 10 ~ 17 ° to cleaning storehouse bottom surface, cleaning storehouse bottom
Apopore is evenly equipped with front side of face, cleaning storehouse front end face bottom is provided with discharging opening, and cleaning storehouse is cleaned available for material, open top,
Be advantageous to material to topple over, bottom surface is provided with inclination angle, is advantageous to material and voluntarily pours out from discharging opening, avoids manpower pusher.
Preferably, filter mechanism is arranged between water storing bin front end and cleaning storehouse front end, filter mechanism includes fixed plate,
Fixed plate is spill, and the side roof part of fixed plate two is connected with retainer ring, and retainer ring is detachably secured on hook, and hook is arranged at
Middle part at left and right sides of housing, fixed plate lower end are connected with collection leakage, collect leakage and are made up of polygon cone and semicircular body, collect leakage
For grid material, filter mechanism can be filtered effectively from the impurity in the water of cleaning storehouse outflow, avoided impurity and entered in water storing bin,
Water is avoided to influence the normal work of cleaning device when being re-used for hydro-peening, and filter mechanism is detachable installation so that debris
Can easily it topple over away, avoid water storing bin influences the quality of stored water because being inconvenient to clean, so as to improve thing
The cleaning performance of material, collect leakage and be made up of polygon cone and semicircular body so that debris can enter along the projection of changeable cone
Enter in semicircular body, avoid debris accumulation from influenceing water body flow, so as to improve the operating efficiency for collecting leakage.
Preferably, filter mechanism surface spraying has nonpolluting coating, nonpolluting coating is made up of following component and parts by weight：Tree
20 ~ 40 parts of fat, 7 ~ 13 parts of Vinylidene Chloride, 14 ~ 22 parts of rosin, 0.13 ~ 0.22 part of anti-fouling agent, filter mechanism is chronically at water body stream
Dynamic state, and contacted with a large amount of debris, there is very big microbial reproduction possibility, antifouling paint is coated on filter mechanism table
Face, nonpolluting coating is formed after drying processing, the antifouling property on filter mechanism surface can be effectively improved, can not only prevent microorganism
Breeding, avoids polluting cleaned material, can also improve the automatical cleaning ability of filter mechanism, can reduce artificial cleaning difficulty.
Preferably, wiper mechanism includes water pump, water pump is arranged at supporting plate upper end, and water pump is connected with aqueduct, water guide
The one end of pipe 7 is connected with water storing bin, and the aqueduct other end is connected with sparge pipe, and sparge pipe is arranged at cleaning storehouse inwall upper end, water spray
Pipe surface is furnished with random spout, and wiper mechanism can effectively spray water body, cleaning material, and sparge pipe is arranged at cleaning storehouse inwall,
And surface is furnished with random spout so that water spraying direction is random, can not only improve the cleaning performance of material, can also effectively prevent
Material sticks and cleaning storehouse inwall, the rate of recovery of material is improved, reduces and wastes.
Preferably, rabbling mechanism includes motor, motor is arranged at supporting plate upper end, and motor passes through transmission belt and agitating shaft
I connection, agitating shaft I are connected by transmission belt with agitating shaft II, and agitating shaft I is arranged at cleaning storehouse front bottom end, and agitating shaft II is set
Cleaning storehouse rear end bottom is placed in, agitating shaft I and the surface of agitating shaft II are evenly equipped with cylindrical stirring rod, and the setting of rabbling mechanism causes
Material can be stirred ceaselessly during cleaning, be advantageous to coming off for impurity in material, improve cleaning performance, and before and after cleaning storehouse
Provided with agitating shaft, increase stirring scope so that material in cleaning storehouse can in storehouse grand movement, be advantageous to improve clear
Wash efficiency.
Preferably, blocking mechanism includes baffle plate, baffle plate setting is provided with cleaning storehouse front end face outer wall bottom, baffle surface
Seal, baffle plate upper end are connected with cylinder, and cylinder upper end is connected with top plate, and top plate is fixed on upper surface on front side of cleaning storehouse, stops
By the motion of cylinder controlling baffle plate in mechanism, stable simplicity is controlled, and baffle surface is provided with seal, improves blocking mechanism
Blocking effect, water body permeates when avoiding cleaning, so as to ensure that the independent normal operation of each part.
Preferably, collecting bin includes gathering materials, for passage with the area that gathers materials, the passage that gathers materials is arranged at cleaning storehouse front end face bottom, collects
Material area is arranged at supporting plate lower end, and the area that gathers materials is connected with the passage lower end that gathers materials, and the area that gathers materials inclines for the outward-dipping open slot in both ends
The angle of bevel angle α is 43 ° ~ 56 °, and collecting bin both ends are provided with outside beveled groove, member's collection material easy to operation, and tilt
Angle has certain limit, improves body mechanics's performance in the area that gathers materials so that operator can more comfortable quick collection material.
Preferably, heating tube is U-shaped distribution and cleaning storehouse and collecting bin bottom, the heating-up temperature of heating tube for 33 DEG C ~
98 DEG C, cleaning storehouse and collecting bin bottom are equipped with heating tube so that cleaning storehouse can also be used for drying when not cleaning, and heating tube is
U is distributed, and improves the heat distributivity of heating tube, avoids the too high or too low influence drying effect of local temperature, and heat
Pipe has certain heated perimeter so that heating tube significantly more efficient can heat to material, avoid influenceing the performance of material.
Compared with prior art, beneficial effects of the present invention are：1）Apparatus of the present invention integrate functions as one, can also be same
When to various types of grain carry out cleaning, drying, there is high efficiency；2）Cleaning storehouse is equipped with heating tube with collecting bin bottom so that device
Working method there are a variety of associativities, improve the scope of application of device；3）Filter mechanism can effectively prevent debris from entering to store
Sump, manpower cleaning difficulty is reduced, and ensure that the normal operation of wiper mechanism；4）The antifouling painting of filter mechanism surface spraying
Layer, can effectively prevent the microbial reproduction on filter mechanism, improve the clean and tidy degree of device, also improve the cleaning effect of material
Fruit.
Present invention employs above-mentioned technical proposal to provide a kind of cleaning drying device, compensate for the deficiencies in the prior art, if
Meter is reasonable, easy to operate.
Brief description of the drawings
Fig. 1 is a kind of structural representation of cleaning drying device of the present invention；
Fig. 2 is a kind of full sectional view of cleaning drying device of the present invention；
Fig. 3 is a kind of structural representation of the filter mechanism of cleaning drying device of the present invention；
Fig. 4 is a kind of side view of the filter mechanism of cleaning drying device of the present invention；
Fig. 5 is a kind of top view of the collection leakage of cleaning drying device of the present invention；
Fig. 6 is a kind of partial enlarged drawing of the heating tube of cleaning drying device of the present invention.
Description of reference numerals：1 housing；2 collecting bins；3 water storing bins；4 cleaning storehouses；5 charging apertures；6 sparge pipes；7 aqueducts；8
Agitating shaft I；9 motors；10 water inlet pipes；11 hooks；12 agitating shafts II；13 outlet pipes；14 water pumps；15 top plates；16 cylinders；17 gears
Plate；18 discharging openings；19 apopores；20 gather materials passage；21 gather materials area；22 heating tubes；23 universal wheels；24 filter mechanisms；25 fix
Plate；26 retainer rings；27 collect leakage；28 supporting plates.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As shown in Fig. 1 ~ 6, a kind of cleaning drying device, including housing 1, the upper end of housing 1 are provided with cleaning storehouse 4, and the middle part of housing 1 is provided with
Supporting plate 28, the upper end of supporting plate 28 are provided with water storing bin 3, filter mechanism 24 and wiper mechanism, and the lower end of housing 1 is provided with collecting bin 2, shell
The bottom of body 1 is provided with universal wheel 23, and the right side wall of housing 1 is provided with rabbling mechanism, and the front side wall of housing 1 is provided with blocking mechanism, the He of cleaning storehouse 4
The bottom of collecting bin 2 is provided with heating tube 22, and apparatus of the present invention have cleaning, drying function, and is joined integrally, improves and has carried out dress
The utilization rate put, and various materials can be cleaned and dry simultaneously, improve device operating efficiency.
Cleaning storehouse 4 is distributed in the inner side of housing 1, and cleaning storehouse 4 is open-topped cube structure, the top back of cleaning storehouse 4
Along charging aperture 5 is provided with, from back to front diagonally downward, the inclination angle of bottom surface is 10 ~ 17 ° to the bottom surface of cleaning storehouse 4, and cleaning storehouse 4 is gone to the bottom
Apopore 19 is evenly equipped with front side of face, the front end face bottom of cleaning storehouse 4 is provided with discharging opening 18, and cleaning storehouse 4 is cleaned available for material, top
Opening, is advantageous to material and topples over, bottom surface is provided with inclination angle, is advantageous to material and is voluntarily poured out from discharging opening 18, avoids manpower
Pusher.
Filter mechanism 24 is arranged between the front end of water storing bin 3 and the front end of cleaning storehouse 4, and filter mechanism 24 includes fixed plate 25,
Fixed plate 25 is spill, and 25 liang of side roof parts of fixed plate are connected with retainer ring 26, and retainer ring 26 is detachably secured on hook 11,
Hook 11 is arranged at the middle part of the left and right sides of housing 1, and the lower end of fixed plate 25 is connected with collection leakage 27, collects leakage 27 by polygon cone
Formed with semicircular body, it is grid material to collect leakage 27, and filter mechanism 24 can effectively filter miscellaneous in the water flowed out from cleaning storehouse 4
Matter, avoid impurity and enter in water storing bin 3, avoid water from influenceing the normal work of cleaning device when being re-used for hydro-peening, and filter
Mechanism is detachable installation so that debris can easily topple over away, and avoid water storing bin 3 influences institute because being inconvenient to cleaning
The quality of the water stored, so as to improve the cleaning performance of material, collect leakage 27 and be made up of polygon cone and semicircular body so that be miscellaneous
Thing can enter in semicircular body along the projection of changeable cone, avoid debris accumulation from influenceing water body flow, received so as to improve
The operating efficiency of collection leakage 27.
The surface spraying of filter mechanism 24 has nonpolluting coating, and nonpolluting coating is made up of following component and preferred weight part：Resin
38 parts, 12 parts of Vinylidene Chloride, 20 parts of rosin, 0.2 part of anti-fouling agent, filter mechanism 24 is chronically at water body flow state, and with it is big
Debris contact is measured, there is very big microbial reproduction possibility, antifouling paint is coated on the surface of filter mechanism 24, drying processing
After form nonpolluting coating, the antifouling property on the surface of filter mechanism 24 can be effectively improved, microbial reproduction can be not only prevented, avoid dirt
The cleaned material of dye, can also improve the automatical cleaning ability of filter mechanism 24, can reduce artificial cleaning difficulty.
Anti-fouling agent in nonpolluting coating composition is active peptides, and the amino acid sequence of active peptides is：
HSHACASYYCSKTACAKFASCTHYLSCTHYLLHPGKLVNCSR, the addition of anti-fouling agent can effectively improve oozing for nonpolluting coating
Effect thoroughly, makes it not in the surface filming of filter mechanism 24, and penetrates into internal capillary, forms the spherical crystallization conservation layer of nanoscale,
And then the invasion of pollutant can be effectively prevented, anti-fouling agent can also make protein denaturation in thing biology, precipitate, so that micro- life
Thing loses activity, so that this nonpolluting coating has the ability efficiently suppressed growth of microorganism, can effectively avoid filter mechanism
24 surface microorganisms are bred, and anti-fouling agent can also improve the adhesiveness of this nonpolluting coating, nonpolluting coating is effectively attached to filtering
The surface of mechanism 24, and be not easy scuffing and come off.
Wiper mechanism includes water pump 14, and water pump 14 is arranged at the upper end of supporting plate 28, and water pump 14 is connected with aqueduct 7, water guide
The one end of pipe 7 is connected with water storing bin 3, and the other end of aqueduct 7 is connected with sparge pipe 6, and sparge pipe 6 is arranged at the inwall upper end of cleaning storehouse 4,
The surface of sparge pipe 6 is furnished with random spout, and wiper mechanism can effectively spray water body, cleaning material, and sparge pipe 6 is arranged at cleaning storehouse
4 inwalls, and surface is furnished with random spout so that water spraying direction is random, can not only improve the cleaning performance of material, can also have
Effect prevents material sticks and the inwall of cleaning storehouse 3, improves the rate of recovery of material, reduces and wastes.
Rabbling mechanism includes motor 9, and motor 9 is arranged at the upper end of supporting plate 28, and motor 9 is connected by transmission belt and agitating shaft I 8
Connect, agitating shaft I 8 is connected by transmission belt with agitating shaft II 12, and agitating shaft I 8 is arranged at the front bottom end of cleaning storehouse 4, agitating shaft II
12 are arranged at the rear end bottom of cleaning storehouse 4, and agitating shaft I 8 and the surface of agitating shaft II 12 are evenly equipped with cylindrical stirring rod, rabbling mechanism
Set material when causing cleaning ceaselessly to be stirred, be advantageous to coming off for impurity in material, improve cleaning performance, and clean
Be equipped with agitating shaft before and after storehouse 4, increase stirring scope so that material in cleaning storehouse 4 can in storehouse grand movement, have
Beneficial to raising cleaning efficiency.
Blocking mechanism includes baffle plate 17, and baffle plate 17 is arranged at the front end face outer wall bottom of cleaning storehouse 4, and the surface of baffle plate 17 is provided with close
Sealing, the upper end of baffle plate 17 are connected with cylinder 16, and the upper end of cylinder 16 is connected with top plate 15, and top plate 15 is fixed on the front side of cleaning storehouse 4
End face, by the motion of the controlling baffle plate 17 of cylinder 16 in blocking mechanism, control stable easy, and the surface of baffle plate 17 is provided with sealing
Part, the blocking effect of blocking mechanism is improved, water body permeates when avoiding cleaning, so as to ensure that the independent normal fortune of each part
OK.
Collecting bin 2 includes gathering materials passage 20 with the area 21 that gathers materials, and the passage 20 that gathers materials is arranged at the front end face bottom of cleaning storehouse 4, collects
Material area 21 is arranged at the lower end of supporting plate 28, and the area 21 that gathers materials is connected with the lower end of passage 20 that gathers materials, and the area 21 that gathers materials is outward-dipping for both ends
Open slot, the angle of inclined angle alpha is 43 ° ~ 56 °, and the both ends of collecting bin 2 are provided with outside beveled groove, member's receipts easy to operation
Collect material, and inclination angle has certain limit, improves body mechanics's performance in the area 21 that gathers materials so that operator can be more comfortable
Quick collection material.
Heating tube 22 is U-shaped distribution and cleaning storehouse 4 and the bottom of collecting bin 2, and the heating-up temperature of heating tube 22 is 33 DEG C ~ 98
DEG C, cleaning storehouse 4 and the bottom of collecting bin 2 are equipped with heating tube 22 so that cleaning storehouse 4 can also be used for drying when not cleaning, heating
Pipe 22 is distributed for U, improves the heat distributivity of heating tube 22, avoids the too high or too low influence drying effect of local temperature
Fruit, and heating tube 22 has certain heated perimeter so that heating tube 22 significantly more efficient can heat to material, avoid shadow
Ring the performance of material.
The side wall of water storing bin 3 one is provided with water inlet pipe 10 and outlet pipe 13, is advantageous to the water circulation in water storing bin 3, improves clear
Wash effect.
Embodiment 2：
As shown in Fig. 1 ~ 6, a kind of cleaning drying device, in real work, the cylinder 16 in blocking mechanism is in stretching state,
Discharging opening 18 is stopped by baffle plate 17, and the material containing impurity is poured into cleaning storehouse 4 from charging aperture 5, if there is a variety of different things
Material, then pour into different materials in different cleaning storehouses 4, opens water pump 14, and aqueduct 7 absorbs water from water storing bin 3, passes through spray
Material sprinkling water body of the water pipe 6 into cleaning storehouse 4, meanwhile, open motor 9 so that agitating shaft I 8 and agitating shaft II 12 work, and enter
And the material inside cleaning storehouse 4 is driven to be stirred so that material cleaning is more abundant, and the water in cleaning storehouse 4 passes through cleaning storehouse 4
The apopore of bottom is exited into water storing bin 3, and impurity is then collected in the collection leakage 27 of filter mechanism 24, when material is clear
After washing, close motor 9 and water pump 14, cylinder 16 and shrink so that discharging opening 18 is not blocked, it is cleaned after material from going out
Material mouth 18 is dropped out into the passage 20 that gathers materials, and is later fallen into and is gathered materials in area 21, now, heating tube 22 is worked with to the area 21 that gathers materials
Lower end is heated, and so as to dry into the cereal in area 21 of gathering materials, stops the heating of heating tube after the completion of drying, and operator is from collection
Expect the collection material of area 21, that is, complete the cleaning, drying of a material.
From back to front diagonally downward, the inclination angle of bottom surface is not limited only to 10 ~ 17 ° to the bottom surface of cleaning storehouse 4, should also include 10 °
Or 10.1 ° or 10.2 ° or 10.3 ° or 10.4 ° ... or 16.9 ° or 17 °.
The area 21 that gathers materials is not limited only to 43 ° ~ 56 °, should also included for the outward-dipping open slot in both ends, the angle of inclined angle alpha
43 ° or 43.1 ° or 43.2 ° or 43.3 ° or 43.4 ° ... or 55.9 ° or 56 °.
Routine techniques connection or the prior art of prior art dawn known to those skilled in the art in above-described embodiment,
Therefore it is not described in detail herein.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, it can also make a variety of changes and modification.Therefore, it is all equivalent
Technical scheme fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
SEQUENCE LISTING
<110>Ningbo Qi Chen Electronic Science and Technology Co., Ltd.s
<120>A kind of cleaning drying device
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 42
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ala Cys Ala Ser Tyr Tyr Cys Ser Lys Thr Ala Cys Ala
1 5 10 15
Lys Phe Ala Ser Cys Thr His Tyr Leu Ser Cys Thr His Tyr Leu Leu
20 25 30
His Pro Gly Lys Leu Val Asn Cys Ser Arg
35 40
Claims (8)
1. a kind of cleaning drying device, including housing（1）, it is characterised in that the housing（1）Upper end is provided with cleaning storehouse（4）, institute
State housing（1）Middle part is provided with supporting plate（28）, the supporting plate（28）Upper end is provided with water storing bin（3）, filter mechanism（24）With it is clear
Washing machine structure, the housing（1）Lower end is provided with collecting bin（2）, the housing（1）Bottom is provided with universal wheel（23）, the housing（1）
Right side wall is provided with rabbling mechanism, the housing（1）Front side wall is provided with blocking mechanism, the cleaning storehouse（4）And collecting bin（2）Bottom
Provided with heating tube（22）.
A kind of 2. cleaning drying device according to claim 1, it is characterised in that the cleaning storehouse（4）It is distributed in housing
（1）Inner side, the cleaning storehouse（4）For open-topped cube structure, the cleaning storehouse（4）Top back edge is provided with charging aperture
（5）, the cleaning storehouse（4）From back to front diagonally downward, the inclination angle of the bottom surface is 10 ~ 17 ° to bottom surface, the cleaning storehouse
（4）Apopore is evenly equipped with front side of bottom surface（19）, the cleaning storehouse（4）Front end face bottom is provided with discharging opening（18）.
A kind of 3. cleaning drying device according to claim 1, it is characterised in that the filter mechanism（24）It is arranged at storage
Sump（3）Front end and cleaning storehouse（4）Between front end, the filter mechanism（24）Including fixed plate（25）, the fixed plate（25）
For spill, the fixed plate（25）Two side roof parts are connected with retainer ring（26）, the retainer ring（26）It is detachably secured to hang
Hook（11）On, the hook（11）It is arranged at housing（1）The middle part of the left and right sides, the fixed plate（25）Lower end is connected with collection
Leakage（27）, it is described to collect leakage（27）It is made up of polygon cone and semicircular body, it is described to collect leakage（27）For grid material.
A kind of 4. cleaning drying device according to claim 1, it is characterised in that the filter mechanism（24）Surface spraying
There is nonpolluting coating, the nonpolluting coating is made up of following component and parts by weight：20 ~ 40 parts of resin, 7 ~ 13 parts of Vinylidene Chloride, rosin
14 ~ 22 parts, 0.13 ~ 0.22 part of anti-fouling agent.
5. a kind of cleaning drying device according to claim 1, it is characterised in that the wiper mechanism includes water pump
（14）, the water pump（14）It is arranged at supporting plate（28）Upper end, the water pump（14）It is connected with aqueduct（7）, the aqueduct
（7）One end and water storing bin（3）Connection, the aqueduct（7）The other end and sparge pipe（6）Connection, the sparge pipe（6）It is arranged at
Cleaning storehouse（4）Inwall upper end, the sparge pipe（6）Surface is furnished with random spout.
6. a kind of cleaning drying device according to claim 1, it is characterised in that the rabbling mechanism includes motor（9）,
The motor（9）It is arranged at supporting plate（28）Upper end, the motor（9）Pass through transmission belt and agitating shaft I（8）Connection, it is described to stir
Mix axle I（8）Pass through transmission belt and agitating shaft II（12）Connection, the agitating shaft I（8）It is arranged at cleaning storehouse（4）Front bottom end, institute
State agitating shaft II（12）It is arranged at cleaning storehouse（4）Rear end bottom, the agitating shaft I（8）With agitating shaft II（12）Surface is evenly equipped with
Cylindrical stirring rod.
7. a kind of cleaning drying device according to claim 1, it is characterised in that the blocking mechanism includes baffle plate
（17）, the baffle plate（17）It is arranged at cleaning storehouse（4）Front end face outer wall bottom, the baffle plate（17）Surface is provided with seal, institute
State baffle plate（17）Upper end is connected with cylinder（16）, the cylinder（16）Upper end is connected with top plate（15）, the top plate（15）It is fixed
In cleaning storehouse（4）Front side upper surface.
A kind of 8. cleaning drying device according to claim 1, it is characterised in that the collecting bin（2）It is logical including gathering materials
Road（20）With the area that gathers materials（21）, the passage that gathers materials（20）It is arranged at cleaning storehouse（4）Front end face bottom, the area that gathers materials（21）If
It is placed in supporting plate（28）Lower end, the area that gathers materials（21）With the passage that gathers materials（20）Lower end connects, the area that gathers materials（21）For both ends
Outward-dipping open slot, the angle of the inclined angle alpha is 43 ° ~ 56 °.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710586686.0A CN107486428A (en) | 2017-07-18 | 2017-07-18 | A kind of cleaning drying device |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710586686.0A CN107486428A (en) | 2017-07-18 | 2017-07-18 | A kind of cleaning drying device |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107486428A true CN107486428A (en) | 2017-12-19 |
Family
ID=60643875
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710586686.0A Pending CN107486428A (en) | 2017-07-18 | 2017-07-18 | A kind of cleaning drying device |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107486428A (en) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20010017142A1 (en) * | 1992-02-07 | 2001-08-30 | Masaaki Suzuki | Method of washing substrate with UV radiation and ultrasonic cleaning |
| CN102504697A (en) * | 2011-11-16 | 2012-06-20 | 大连理工大学 | High-efficiency tin-free self-polishing antifouling paint composition and application thereof |
| CN104874562A (en) * | 2015-05-31 | 2015-09-02 | 枞阳县田园面业有限责任公司 | Device for simultaneously cleaning and drying multiple grains |
| CN105477920A (en) * | 2016-01-19 | 2016-04-13 | 成都科盛石油科技有限公司 | Filtering device with double-layer filter screen |
-
2017
- 2017-07-18 CN CN201710586686.0A patent/CN107486428A/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20010017142A1 (en) * | 1992-02-07 | 2001-08-30 | Masaaki Suzuki | Method of washing substrate with UV radiation and ultrasonic cleaning |
| CN102504697A (en) * | 2011-11-16 | 2012-06-20 | 大连理工大学 | High-efficiency tin-free self-polishing antifouling paint composition and application thereof |
| CN104874562A (en) * | 2015-05-31 | 2015-09-02 | 枞阳县田园面业有限责任公司 | Device for simultaneously cleaning and drying multiple grains |
| CN105477920A (en) * | 2016-01-19 | 2016-04-13 | 成都科盛石油科技有限公司 | Filtering device with double-layer filter screen |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN108325852A (en) | A kind of quality grain seed highly effective and safe screening plant | |
| CN207040819U (en) | Cleaning, drying integration apparatus after harvesting peanut | |
| CN208162159U (en) | Cleaning equipment is used in a kind of production of jasmine tea | |
| CN107685042A (en) | A kind of particle drying unit | |
| CN214813196U (en) | Seed coating cleaning machine | |
| CN107486428A (en) | A kind of cleaning drying device | |
| CN207108453U (en) | A kind of honey concentrates bulking system | |
| CN107822170A (en) | A kind of concentric type potato washing device and cleaning method | |
| CN218737105U (en) | Nut drying machine | |
| CN209696586U (en) | A kind of deduster | |
| CN209423854U (en) | A kind of seed pelleting machine dust removal with machine device | |
| CN109043605A (en) | Fresh date production and sewage treatment set composite | |
| CN110170485A (en) | Cleaning equipment for tealeaves | |
| CN109396123A (en) | Tuber of pinellia cleaning device | |
| CN208798322U (en) | A kind of corn seed cleaning device with dyeing function | |
| CN208494405U (en) | A kind of cereal dedusting baking grinding all-in-one machine | |
| CN208807586U (en) | A kind of agricultural product production and processing potato cleaning device | |
| CN109317462A (en) | It can remove the cleaning device of tealeaves surface pesticide | |
| CN208743188U (en) | Rocker arm shaft cleaning device | |
| CN208030215U (en) | A kind of jujube slagging-off cleaning device | |
| CN208482193U (en) | A kind of vehicle-mounted Wet-dry filter device | |
| CN208373688U (en) | A kind of food processing pressure-bearing type cleaning equipment | |
| CN110810206A (en) | Energy-conserving irrigation equipment of afforestation with sewage recovery stage filtering capability | |
| CN108720053A (en) | Fresh dates production, sewage disposal and Quality Detection integration apparatus | |
| CN206858396U (en) | Fowl and animal excrement harmless treatment drying unit |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WD01 | Invention patent application deemed withdrawn after publication | ||
| WD01 | Invention patent application deemed withdrawn after publication |
Application publication date: 20171219 |