CN107474125A - Control GAP-associated protein GAP and encoding gene and the application of wheat study on temperature sensitive male sterility - Google Patents
Control GAP-associated protein GAP and encoding gene and the application of wheat study on temperature sensitive male sterility Download PDFInfo
- Publication number
- CN107474125A CN107474125A CN201710777140.3A CN201710777140A CN107474125A CN 107474125 A CN107474125 A CN 107474125A CN 201710777140 A CN201710777140 A CN 201710777140A CN 107474125 A CN107474125 A CN 107474125A
- Authority
- CN
- China
- Prior art keywords
- wheat
- temperature sensitive
- male sterility
- gap
- study
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8216—Methods for controlling, regulating or enhancing expression of transgenes in plant cells
- C12N15/8218—Antisense, co-suppression, viral induced gene silencing [VIGS], post-transcriptional induced gene silencing [PTGS]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8287—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for fertility modification, e.g. apomixis
- C12N15/8289—Male sterility
Abstract
The present invention relates to genetic engineering field, and in particular to provides GAP-associated protein GAP and encoding gene and the application of control wheat study on temperature sensitive male sterility.The nucleotide sequence of the gene is as shown in SEQ ID NO.2.The silence gene significantly reduces Wheat Pollen fertility, and overexpression then recovers the fertility of Thermo-sensitive sterile line, therefore, has the characteristic sensitive to environment temperature using TMS1 gene transcript expressions, male plant fertility can be made to possess temperature sensitive feature.The study on temperature sensitive male sterility GAP-associated protein GAP and its encoding gene of the present invention is to crop hybrid breeding and improves yield, the degeneration-resistant molecular breeding process of acceleration, and world food has highly important theoretical and practical significance safely.
Description
Technical field
The present invention relates to genetic engineering field, and in particular to the GAP-associated protein GAP and coding base of control wheat study on temperature sensitive male sterility
Cause and application.
Background technology
Wheat photoperiod-temperature sensitive male sterility system BS366 is the core female parent material of two-line hybrid wheat, by low temperature environment because
Element induction pollen abortion, but due to not knowing still at present in the temperature sensitive sterile key gene of light, male sterility gene regulation process
Where is key node, and therefore, BS366 still deposits obstacle in large scale application.
The pollen protein gene families of Ole e 1 are distributed more scattered in Plant Genome and control pollen formation
A kind of important super gene family.The functional diversities in different plants of Ole e 1, participate in numerous vital movements.Ole e 1
Pollen protein superfamily Ole domains have higher diversity.At present, 571 Ole e have been cloned and predicted in plant
The class pollen protein family members of 1 and Ole e 1.
The content of the invention
It is an object of the invention to provide wheat study on temperature sensitive male sterility GAP-associated protein GAP.
Another object of the present invention is to provide the pollen protein genes of control wheat study on temperature sensitive male sterility Ole e 1.
It is a further object of the present invention to provide the recombinant vector comprising said gene.
Another object of the present invention provides the application of the above-mentioned pollen protein genes of wheat study on temperature sensitive male sterility Ole e 1.
The pollen protein gene TMS1 of control wheat study on temperature sensitive male sterility Ole e 1 provided by the present invention, from temperature sensitive
Property sterile line wheat BS366, encode 236 amino acid, the amino acid sequence of its encoding proteins is as shown in SEQ ID NO.1.
SEQ ID NO.1：
MGSRLVLFGALALLLAGSFGVAQAAPAVVVGSVKCLDCSPDDVSAEDALKGLQVAIKCRSGAGETYETQ
TVGQLDDKGAFSVPLQAGLLREDSELDRDCFAQLHSAPDTPCDGPAPPRIAPAKSTTQGVADAANTYLAVAEDTVFS
PVACACKKKKKHFMVGPPPPPPPRPEPSYGTPTPTPTPTPTPSYGPPSTPKPPAPEDDPKPFFHKHPKMKKMMHKKK
PCPPLGEEDKPKN
There is nucleotide sequence, TMS1 ORFs (ORF) as shown in SEQ ID NO.2 according to the TMS1 genes of the present invention
Length is 711bp.
SEQ ID NO.2：
ATGGGTTCTCGGCTGGTTCTTTTCGGTGCTCTCGCTCTGCTCCTGGCCGGCAGCTTCGGTGTGGCCCAG
GCGGCGCCGGCCGTAGTGGTTGGCTCCGTCAAGTGCCTGGATTGCTCCCCCGACGACGTCAGTGCTGAAGATGCCCT
CAAAGGGCTCCAGGTAGCCATCAAGTGCAGGTCCGGCGCCGGCGAGACCTACGAGACGCAGACGGTCGGGCAGCTCG
ACGACAAGGGCGCCTTCAGCGTCCCCCTCCAGGCAGGCCTCCTGCGCGAAGACAGCGAGCTGGACCGCGACTGCTTC
GCCCAGCTCCACAGCGCGCCCGACACGCCGTGCGACGGGCCGGCGCCGCCCAGGATCGCCCCAGCCAAGTCCACCAC
CCAAGGTGTCGCCGACGCCGCCAACACCTACCTCGCGGTCGCCGAGGACACGGTTTTCTCGCCGGTCGCGTGCGCGT
GCAAGAAGAAGAAGAAGCACTTCATGGTCGGCCCGCCGCCGCCGCCCCCGCCGAGGCCGGAGCCCTCATACGGTACC
CCGACGCCGACGCCGACGCCCACTCCCACGCCGTCCTACGGTCCTCCTTCGACGCCCAAGCCGCCCGCGCCCGAGGA
CGACCCGAAGCCGTTCTTCCACAAGCACCCCAAGATGAAGAAGATGATGCACAAGAAGAAGCCGTGCCCGCCGCTCG
GGGAGGAGGACAAGCCCAAGAACTGA
According to the embodiment of the present invention, hero is shown as 20 DEG C in high temperature using photoperiod-temperature sensitive male sterility system BS366
Property it is fertile, 10 DEG C of low temperature shows as male sterile characteristic, and analysis wheat TMS1 is under fertile environment and under sterile environment
Differential expression in BS366 stamens, diad period stamen altimeter reaches under fertile environment in BS366, under sterile environment
Obvious reduction is expressed in diad period stamen, illustrates that wheat TMS1 take part in BS366 pollen abortion process.
It is a further object to provide a kind of method for cultivating Temperature sensitive male sterility wheat.The present invention is carried
The method of the cultivation male sterile wheat of confession, is to lead any of the above-described kind of recombinant expression carrier containing TMS1 gene silencing fragments
Enter in wheat cell, obtain male sterile wheat.
It is a further object to provide a kind of method for recovering Thermo-sensitive infertility wheat fertility, by any of the above-described kind
Recombinant expression carrier containing excessive TMS1 genetic fragments is imported in Thermo-sensitive sterile line BS366 cells, recovers Thermo-sensitive infertility
Wheat fertility.
The pollen protein gene TMS1 of control wheat study on temperature sensitive male sterility Ole e 1 of the present invention can be used as a temperature quick
Perceptual male sterility gene, and then be used as in crop hybrid breeding with high-quality candidate gene.
The present invention has obtained temperature sensitivity male sterility TMS1 bases using Thermo-sensitive male sterile wheat as experiment material
Cause, the silence TMS1 in common wheat significantly reduce Wheat Pollen fertility, and overexpression then recovers educating for Thermo-sensitive sterile line
Property, therefore, there is the characteristic sensitive to environment temperature using TMS1 gene transcript expressions, male plant fertility can be made to possess temperature
Quick feature.The present invention study on temperature sensitive male sterility GAP-associated protein GAP and its encoding gene to crop hybrid breeding and improve yield, plus
The degeneration-resistant molecular breeding process of speed, and world food have highly important theoretical and practical significance safely.
Brief description of the drawings
Fig. 1 is shown under fertile (20 DEG C) and sterile (10 DEG C) environment, and TMS1 expresses in Bs366 and capital 411 (Jing411)
Pattern analysis, wherein, S1-4 represents pollen mother cell period (PMC) under sterile environment, diad (Dyad), tetrad respectively
Period (Tetrad) and the flower pesticide of mature pollen phase (MP)；F1-4 represents the pollen mother cell period under fertile environment respectively
(PMC), the flower pesticide of diad (Dyad), tetrad (Tetrad) and mature pollen phase (MP).
Fig. 2 shows that TMS1-RNAi transfer-gen plants reduce the fertility of setting percentage and flower pesticide, but base than control Fielder
This does not influence morphogenesis and the growth cycle of plant, and wherein A and B are TMS1-RNAi transfer-gen plants after blooming 2 days with compareing
Growing state, transgenic line performance Ying shell is opened a business, exposed without flower pesticide；C is TMS1-RNAi transfer-gen plants after blooming 25 days
With compareing tassel, transgenic line setting percentage is decreased obviously, and D is TMS1-RNAi transfer-gen plants before blooming with compareing pollen iodine
Dye situation, transgenic line pollen fertility are decreased obviously.
Fig. 3 is shown under the conditions of infertility, and overexpression TMS1 (OE-TMS1) transfer-gen plant (OE-BS366) carries than control
The high fertility of setting percentage and flower pesticide, but have substantially no effect on morphogenesis and the growth cycle of plant, wherein A：After blooming 25 days,
Overexpression TMS1 (OE-TMS1) transfer-gen plants significantly improve with compareing growing state, transgenic line setting percentage；B：Bloom
After 25 days, overexpression TMS1 (OE-TMS1) transfer-gen plants significantly improve with compareing tassel, transgenic line setting percentage；C：
Before blooming, overexpression TMS1 (OE-TMS1) transfer-gen plants are with compareing flower pesticide and pollen iodine dye situation, transgenic line flower pesticide
Open a business, pollen fertility significantly improves.
Embodiment
Embodiment 1, the clone of TMS1 genes and sequence motif analysis
BS366 kinds are planted in Beijing (20 DEG C of high temperature) and Fuyang (10 DEG C of low temperature) field, after wheat chooses flag, are taken respectively
Pollen mother cell period (PMC), diad (Dyad), tetrad (Tetrad) and mature pollen phase (MP) are immediately placed in liquid
Chilled nitrogen, -80 DEG C save backup.Plant leaf blade is completed according to RNA extracts kits (Beijing Tiangeng biochemical technology Co., Ltd)
The Total RNAs extraction of tissue, afterwards using the total serum IgE of extraction as template, using TMS1-F/R sequences as primer, with reverse transcriptase (M-
MLV reverse transcription) is carried out, obtains the cDNA templates for subsequent experimental.Design pair of primers：
TMS1-F GTCCCTGCTGTGATATCAAGAGC
TMS1-R CAGGGCAGGTCAGTTCTTGG
The present invention obtains gene TMS1, TMS1 ORFs (ORF) length 711bp, encodes 236 amino acid, the base
Because being a pollen protein gene family of coding Ole e 1, TMS1 is the pollen protein bases of Ole e 1 cloned first in wheat
Because of the new gene of family.
Embodiment 2：The TMS1 expression characteristics in BS366 stamens under fertile environment and under sterile environment
Male sterile wheat line BS366 is tied up under fertile (20 DEG C) and sterile (10 DEG C) environment and induced, it is female thin in pollen
Born of the same parents' period (PMC), diad (Dyad), tetrad (Tetrad) and mature pollen phase (MP) are separately sampled, will be above-mentioned each
The RNA reverse transcriptions of kind Stress treatment material are cDNA, and as template, stamen specific expression gene is analyzed in gynoecium using RT-PCR
Idiophase, formation stage of anther separation, the expression pattern of Meiosis and monokaryotic stage, and with Common Wheat Varieties JING411 table
Expression patterns compare, expression patterns of the checking TMS1 under environmental induction.As shown in figure 1, under fertile and sterile environment, TMS1 exists
It is not notable that difference is showed in common wheat；And BS366 is under two environment that there were significant differences, in BS366 two under fertile environment
Split period altimeter in stamen reaches, and diad period expresses in stamen under sterile environment substantially reduces, in summary
TMS1 genes are suppressed to express by low temperature infertility environment.
Embodiment 3：TMS1 transgenic wheat Thermo-sensitive male sterility Function Identifications
Using wheat TaPollen1-D cDNA sequence as template, its conserved domain is avoided, chooses three TMS1 bases as far as possible
Because of homology segment, 350bp or so fragment is chosen, in the reverse of its 3 ' end plus the preceding paragraph rice intron sequences and 350bp sequences
Complementary series, carry out full genome synthesis (Huada gene company, Beijing).Add respectively at its both ends after analyzing the sequence restriction enzyme site
Upper restriction enzyme site BamHI and SacI, double digestion, the company of trying again then are carried out than carrier and synthesis fragment to pCAMBIA3300
Connect and the reverse complementary sequence of synthesis is building up on pCAMBIA3300 carriers.The carrier built is converted to Agrobacterium
In EHA105, the callus of transformed spring wheat Fielder ratarias induction, TMS1 silencing transgene plant are obtained.Obtain T2 generations
Transgenic line, transfer-gen plant or non-transfer-gen plant are contaminated by iodine, as shown in Fig. 2 TMS1-RNAi transfer-gen plants compare
The fertility of setting percentage and flower pesticide is reduced according to Fielder, but has substantially no effect on morphogenesis and the growth cycle of plant, wherein A
It is that TMS1-RNAi transfer-gen plants are opened a business, do not spent with compareing growing state, transgenic line performance Ying shell after blooming 2 days with B
Medicine is exposed；C is that TMS1-RNAi transfer-gen plants are decreased obviously with compareing tassel, transgenic line setting percentage after blooming 25 days, D
Situation is contaminated with compareing pollen iodine for TMS1-RNAi transfer-gen plants before blooming, transgenic line pollen fertility is decreased obviously, and is found
In common wheat silence TMS1, improved than control pollen abortion rate in more than 70-100%, cause common wheat Fielder male
Infertility, it is one of pollen development process essential gene to illustrate TMS1, small to remove male hybridization from available for cultivating male sterile wheat
Wheat contributes.
TMS1 is building up in overexpression pCAMBIA3300 carriers, using agrobacterium-mediated transformation, by the genetic transformation temperature
In quick property sterile line BS366, T2 is obtained for transgenic line (OE-BS366), transfer-gen plant is contaminated by iodine or non-transgenosis is planted
Strain, as shown in figure 3, under the conditions of infertility, overexpression TMS1 (OE-TMS1) transfer-gen plant (OE-BS366) improves than control
The fertility of setting percentage and flower pesticide, but have substantially no effect on morphogenesis and the growth cycle of plant, wherein A：After blooming 25 days, mistake
Amount expression TMS1 (OE-TMS1) transfer-gen plants significantly improve with compareing growing state, transgenic line setting percentage；B：Bloom 25
After it, overexpression TMS1 (OE-TMS1) transfer-gen plants significantly improve with compareing tassel, transgenic line setting percentage；C：Open
Hua Qian, overexpression TMS1 (OE-TMS1) transfer-gen plant are opened with compareing flower pesticide and pollen iodine dye situation, transgenic line flower pesticide
, pollen fertility significantly improves, and under the conditions of infertility, is improved than control pollen fertility rate in 50-85%, it is real to illustrate TMS1
Photoperiod-temperature sensitive male sterility gene.Therefore, TMS1 gene transcript expressions have the characteristic sensitive to environment temperature, can make plant
Male fertile possesses temperature sensitive feature, can be used as in crop hybrid breeding with high-quality candidate gene.
Sequence table
<110>Beijing City Agriculture and Forestry Institute
<120>Control GAP-associated protein GAP and encoding gene and the application of wheat study on temperature sensitive male sterility
<130> FDI17080
<160> 2
<170> SIPOSequenceListing 1.0
<210> 2
<211> 236
<212> PRT
<213>Wheat (Triticum aestivuml.)
<400> 2
Met Gly Ser Arg Leu Val Leu Phe Gly Ala Leu Ala Leu Leu Leu Ala
1 5 10 15
Gly Ser Phe Gly Val Ala Gln Ala Ala Pro Ala Val Val Val Gly Ser
20 25 30
Val Lys Cys Leu Asp Cys Ser Pro Asp Asp Val Ser Ala Glu Asp Ala
35 40 45
Leu Lys Gly Leu Gln Val Ala Ile Lys Cys Arg Ser Gly Ala Gly Glu
50 55 60
Thr Tyr Glu Thr Gln Thr Val Gly Gln Leu Asp Asp Lys Gly Ala Phe
65 70 75 80
Ser Val Pro Leu Gln Ala Gly Leu Leu Arg Glu Asp Ser Glu Leu Asp
85 90 95
Arg Asp Cys Phe Ala Gln Leu His Ser Ala Pro Asp Thr Pro Cys Asp
100 105 110
Gly Pro Ala Pro Pro Arg Ile Ala Pro Ala Lys Ser Thr Thr Gln Gly
115 120 125
Val Ala Asp Ala Ala Asn Thr Tyr Leu Ala Val Ala Glu Asp Thr Val
130 135 140
Phe Ser Pro Val Ala Cys Ala Cys Lys Lys Lys Lys Lys His Phe Met
145 150 155 160
Val Gly Pro Pro Pro Pro Pro Pro Pro Arg Pro Glu Pro Ser Tyr Gly
165 170 175
Thr Pro Thr Pro Thr Pro Thr Pro Thr Pro Thr Pro Ser Tyr Gly Pro
180 185 190
Pro Ser Thr Pro Lys Pro Pro Ala Pro Glu Asp Asp Pro Lys Pro Phe
195 200 205
Phe His Lys His Pro Lys Met Lys Lys Met Met His Lys Lys Lys Pro
210 215 220
Cys Pro Pro Leu Gly Glu Glu Asp Lys Pro Lys Asn
225 230 235
<210> 2
<211> 711
<212> DNA
<213>Wheat (Triticum aestivuml.)
<400> 2
atgggttctc ggctggttct tttcggtgct ctcgctctgc tcctggccgg cagcttcggt 60
gtggcccagg cggcgccggc cgtagtggtt ggctccgtca agtgcctgga ttgctccccc 120
gacgacgtca gtgctgaaga tgccctcaaa gggctccagg tagccatcaa gtgcaggtcc 180
ggcgccggcg agacctacga gacgcagacg gtcgggcagc tcgacgacaa gggcgccttc 240
agcgtccccc tccaggcagg cctcctgcgc gaagacagcg agctggaccg cgactgcttc 300
gcccagctcc acagcgcgcc cgacacgccg tgcgacgggc cggcgccgcc caggatcgcc 360
ccagccaagt ccaccaccca aggtgtcgcc gacgccgcca acacctacct cgcggtcgcc 420
gaggacacgg ttttctcgcc ggtcgcgtgc gcgtgcaaga agaagaagaa gcacttcatg 480
gtcggcccgc cgccgccgcc cccgccgagg ccggagccct catacggtac cccgacgccg 540
acgccgacgc ccactcccac gccgtcctac ggtcctcctt cgacgcccaa gccgcccgcg 600
cccgaggacg acccgaagcc gttcttccac aagcacccca agatgaagaa gatgatgcac 660
aagaagaagc cgtgcccgcc gctcggggag gaggacaagc ccaagaactg a 711
Claims (9)
1. control the GAP-associated protein GAP of wheat study on temperature sensitive male sterility, it is characterised in that the amino acid sequence of the albumen such as SEQ ID
Shown in NO.1.
2. control the pollen protein genes of wheat study on temperature sensitive male sterility Ole e 1, it is characterised in that the gene code claim
The GAP-associated protein GAP of offer control wheat study on temperature sensitive male sterility described in 1.
3. the pollen protein genes of control wheat study on temperature sensitive male sterility Ole e 1 according to claim 2, it is characterised in that
The nucleotide sequence of the gene is as shown in SEQ ID NO.2.
4. include the recombinant vector that the pollen protein genes of wheat study on temperature sensitive male sterility Ole e 1 are controlled described in claim 2.
5. include the recombinant cell that the pollen protein genes of wheat study on temperature sensitive male sterility Ole e 1 are controlled described in claim 2.
6. the application of the GAP-associated protein GAP of wheat study on temperature sensitive male sterility is controlled described in claim 1.
7. the application of the pollen protein genes of wheat study on temperature sensitive male sterility Ole e 1 is controlled described in claim 2.
A kind of 8. method for cultivating Temperature sensitive male sterility wheat, it is characterised in that methods described, which includes containing, has the right to want
Ask the recombinant expression carrier importing of the silence fragment of the 2 pollen protein genes of control wheat study on temperature sensitive male sterility Ole e 1 small
The step of wheat cell.
A kind of 9. method for the fertility for recovering Thermo-sensitive sterile line wheat, it is characterised in that methods described is included in mistake in wheat
The step of wheat study on temperature sensitive male sterility Ole 1 pollen protein genes of e being controlled described in amount expression claim 2.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710777140.3A CN107474125B (en) | 2017-09-01 | 2017-09-01 | Related protein for controlling temperature-sensitive male sterility of wheat, coding gene and application |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710777140.3A CN107474125B (en) | 2017-09-01 | 2017-09-01 | Related protein for controlling temperature-sensitive male sterility of wheat, coding gene and application |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107474125A true CN107474125A (en) | 2017-12-15 |
| CN107474125B CN107474125B (en) | 2020-05-22 |
Family
ID=60604315
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710777140.3A Expired - Fee Related CN107474125B (en) | 2017-09-01 | 2017-09-01 | Related protein for controlling temperature-sensitive male sterility of wheat, coding gene and application |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107474125B (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108341860A (en) * | 2018-05-11 | 2018-07-31 | 北京市农林科学院 | The BURP pollen proteins TaBURP4B and its gene of control wheat male sterility and application |
| CN109734786A (en) * | 2018-12-10 | 2019-05-10 | 北京市农林科学院 | Plant pollen fertility restores GAP-associated protein GAP TaDMT25 and its encoding gene and application |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101333533A (en) * | 2008-07-25 | 2008-12-31 | 华南农业大学 | Temperature sensing male fertile gene and use thereof |
| US20130185831A1 (en) * | 2000-12-14 | 2013-07-18 | David K. Kovalic | Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement |
| CN106011167A (en) * | 2016-05-27 | 2016-10-12 | 上海交通大学 | Application of male sterility gene OsDPW2 and rice sterility recovery method |
-
2017
- 2017-09-01 CN CN201710777140.3A patent/CN107474125B/en not_active Expired - Fee Related
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130185831A1 (en) * | 2000-12-14 | 2013-07-18 | David K. Kovalic | Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement |
| CN101333533A (en) * | 2008-07-25 | 2008-12-31 | 华南农业大学 | Temperature sensing male fertile gene and use thereof |
| CN106011167A (en) * | 2016-05-27 | 2016-10-12 | 上海交通大学 | Application of male sterility gene OsDPW2 and rice sterility recovery method |
Non-Patent Citations (3)
| Title |
|---|
| TANG,Y.: ""Triticum aestivum cultivar BS366 TMS1 (TMS1) gene, complete cds"", 《GENBANK DATABASE》 * |
| YU YA 等: ""Molecular cloning and characterization of a proliferating cell nuclear antigen gene by chemically induced male sterility in wheat (Triticum aestivum L.)."", 《GENET MOL RES》 * |
| 姚清国 等: ""植物花粉胞外蛋白的研究进展"", 《安徽农业科学》 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108341860A (en) * | 2018-05-11 | 2018-07-31 | 北京市农林科学院 | The BURP pollen proteins TaBURP4B and its gene of control wheat male sterility and application |
| CN109734786A (en) * | 2018-12-10 | 2019-05-10 | 北京市农林科学院 | Plant pollen fertility restores GAP-associated protein GAP TaDMT25 and its encoding gene and application |
| CN109734786B (en) * | 2018-12-10 | 2022-05-31 | 北京市农林科学院 | Plant pollen fertility restorer related protein TaDMT25, and coding gene and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107474125B (en) | 2020-05-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Duan et al. | Genome-wide analysis of the MADS-box gene family in Brassica rapa (Chinese cabbage) | |
| Li et al. | Genome-wide analysis of basic/helix-loop-helix transcription factor family in rice and Arabidopsis | |
| Li et al. | Genome-wide identification and characterization of R2R3MYB family in Cucumis sativus | |
| Zalewski et al. | Evolution of the class IV HD-zip gene family in streptophytes | |
| Lin et al. | Genome-wide identification of MADS-box gene family in sacred lotus (Nelumbo nucifera) identifies a SEPALLATA homolog gene involved in floral development | |
| CN107474125A (en) | Control GAP-associated protein GAP and encoding gene and the application of wheat study on temperature sensitive male sterility | |
| CN105695466B (en) | A kind of strong specific expression promoter OsPoll3 of paddy pollen and its application | |
| Ge et al. | Cloning and expression of floral organ development-related genes in herbaceous peony (Paeonia lactiflora Pall.) | |
| CN112961229B (en) | Rubber tree transcription factor HbICE4 and coding gene and application thereof | |
| Kitahara et al. | Rose MADS-box genes ‘MASAKO BP and B3’homologous to class B floral identity genes | |
| CN101413006B (en) | Drought-induced rice flower specific promoter and use thereof | |
| CN107698672B (en) | Rice male sterility related protein and coding gene and application thereof | |
| CN108341860A (en) | The BURP pollen proteins TaBURP4B and its gene of control wheat male sterility and application | |
| Wang et al. | Genome-wide identification and characterization of the R2R3MYB transcription factor superfamily in eggplant (Solanum melongena L.) | |
| CN111235168B (en) | Receptor kinase SlSRK2B participating in lycopene synthesis and application thereof | |
| Liang et al. | Comparison of gene order in the chromosome region containing a TERMINAL FLOWER 1 homolog in apricot and peach reveals microsynteny across angiosperms | |
| CN114292855A (en) | PagARR9 gene for regulating and controlling growth of xylem of poplar and application thereof | |
| Roque et al. | Functional genomics and genetic control of flower and fruit development in Medicago truncatula: an overview | |
| CN106222171A (en) | A kind of method utilizing RNAi technology to improve soybean yields | |
| Tsaftaris et al. | Cloning, structural characterization, and phylogenetic analysis of flower MADS-box genes from crocus (Crocus sativus L.) | |
| CN112778408A (en) | Rubber tree transcription factor HbICE2 and coding gene and application thereof | |
| CN108753793B (en) | Rice blast resistance gene RMg42 and application thereof | |
| CN112195162A (en) | Rice leaf senescence control gene ES2 and application thereof | |
| CN113337537B (en) | OsCDKB1;1 protein and function and application of encoding gene thereof in salt tolerance of rice | |
| CN110204601B (en) | Medicinal wild rice OoMYB2 protein and coding gene, expression vector and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20200522 Termination date: 20210901 |