CN107268245A - A kind of clothes hanger of acid rain preventing intelligent control - Google Patents
A kind of clothes hanger of acid rain preventing intelligent control Download PDFInfo
- Publication number
- CN107268245A CN107268245A CN201710393323.5A CN201710393323A CN107268245A CN 107268245 A CN107268245 A CN 107268245A CN 201710393323 A CN201710393323 A CN 201710393323A CN 107268245 A CN107268245 A CN 107268245A
- Authority
- CN
- China
- Prior art keywords
- clothes
- dividing plate
- parts
- rectangular frame
- clothes hanger
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06F—LAUNDERING, DRYING, IRONING, PRESSING OR FOLDING TEXTILE ARTICLES
- D06F57/00—Supporting means, other than simple clothes-lines, for linen or garments to be dried or aired
- D06F57/12—Supporting means, other than simple clothes-lines, for linen or garments to be dried or aired specially adapted for attachment to walls, ceilings, stoves, or other structures or objects
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D163/00—Coating compositions based on epoxy resins; Coating compositions based on derivatives of epoxy resins
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D5/00—Coating compositions, e.g. paints, varnishes or lacquers, characterised by their physical nature or the effects produced; Filling pastes
- C09D5/08—Anti-corrosive paints
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K3/00—Use of inorganic substances as compounding ingredients
- C08K3/18—Oxygen-containing compounds, e.g. metal carbonyls
- C08K3/20—Oxides; Hydroxides
- C08K3/22—Oxides; Hydroxides of metals
- C08K2003/2237—Oxides; Hydroxides of metals of titanium
- C08K2003/2241—Titanium dioxide
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08K—Use of inorganic or non-macromolecular organic substances as compounding ingredients
- C08K2201/00—Specific properties of additives
- C08K2201/011—Nanostructured additives
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L2205/00—Polymer mixtures characterised by other features
- C08L2205/03—Polymer mixtures characterised by other features containing three or more polymers in a blend
- C08L2205/035—Polymer mixtures characterised by other features containing three or more polymers in a blend containing four or more polymers in a blend
Landscapes
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Materials Engineering (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Textile Engineering (AREA)
- Holders For Apparel And Elements Relating To Apparel (AREA)
Abstract
The present invention provides a kind of clothes hanger of acid rain preventing intelligent control, guard mechanism including being fixed on balcony, and the clothes airing machine structure being connected with guard mechanism, if guard mechanism upper end is made up of dried layer dividing plate, elastic driver is provided with dividing plate, elastic driver is connected by wire with controller, dividing plate both sides are provided with and are connected with the support frame of clothes airing machine structure both sides, the first rectangular frame that clothes airing machine structure is made up of some support bars is constituted with second rectangular frame, connected between first rectangular frame and second rectangular frame by guide rail, the clothes hanger for this acid rain preventing intelligent control that the present invention is provided, each sensor is disposed, the clothes airing machine structure on clothes hanger is set clothes is had larger light-receiving area to light is flexible by light sensor, baroceptor, humidity sensor, Raindrop sensor can sense the conversion of weather in time, clothes can be contracted in dividing plate in time prevent clothes it is wet fall.
Description
Technical field
The present invention relates to clothes hanger technical field, especially a kind of clothes hanger of acid rain preventing intelligent control.
Background technology
Clothes hanger is the necessity that people give the clothes an airing, and existing clothes drying support clothes is much required for clothes-horse 13 etc. auxiliary
Assistant engineer has, and generally requires curved waist and dry in the air clothing and to receive clothing, man-computer relation defective tightness, for city dweller, both wished to by
Clothes is dried in the sun reaches bactericidal effect, is afraid of that precipitate heavy rain drenches clothes again, the problem of in order to solve above-mentioned,
In the market occurs in that some automatic Scalable drying racks, the product such as automatic rain-proof horse, but these products only solve one mostly
Individual problem, and cost performance is not high.
Prior art such as, Chinese invention granted patent document, the B of Authorization Notice No. CN 104611890, the disclosure of the invention
A kind of Intelligent telescopic blocks clothes hanger, and the Intelligent telescopic, which blocks clothes hanger, includes supervisor, wireless router and mobile phone, Zhu Guanshang
Provided with power knob, intelligence conversion button and control button, supervisor is transmitted provided with control piece and signal to be connected on receiving element, supervisor
Automatic telescopic baffle plate and support are connected to, support is provided with fixed plate and sliding groove, sliding groove and is connected with intelligent sliding bar, automatically
Telescopic baffle is provided with intelligent rotating bar, and intelligent rotating bar is provided with Protective film, and automatic telescopic baffle plate is filled provided with intelligent-induction
Put, the invention has simple and ingenious structure, practical function, automation performance is strong, reduces the influence of strange land weather difference, improves
The advantage of reliability and convenient degree, but the clothes that the invention is dried can only often shine the clothing face towards sunny side, another side shines not
Arrive, also there is certain room for promotion in terms of intelligentized control method.
The content of the invention
The technical problems to be solved by the invention be provide one kind can automatically adjust, make its abundant light, strong wind, under
It can also prevent from floaing to above clothing after the rainy self-recovery clothes of the special weathers such as rain, intelligence degree height, the effect given the clothes an airing
A kind of clothes hanger of really excellent acid rain preventing intelligent control.
To solve above-mentioned existing technical problem, the present invention uses following scheme：A kind of clothing that dries in the air of acid rain preventing intelligent control
Frame, including the guard mechanism of balcony and the clothes airing machine structure being connected with guard mechanism are fixed on, guard mechanism upper end passes through some
Elastic driver is provided with layer dividing plate composition, dividing plate, elastic driver is connected by wire with controller, dividing plate two
Side is provided with and is connected with the support frame of clothes airing machine structure both sides, the first rectangular frame and second that clothes airing machine structure is made up of some support bars
Rectangular frame is constituted, and is connected between first rectangular frame and second rectangular frame by guide rail.
Preferably, guard mechanism is connected by two pieces of dividing plates by guide rail, dividing plate is provided with Raindrop sensor, underlay screen
Light-shielding sheet is provided with, upper baffle is connected with elastic driver, dividing plate is provided with one layer of waterproof anti-corrosion coating, by hiding
Separator lined is shading light part and light part by machine-glazed paper, according to the material characteristic of clothes, be may be selected to dry in the shade or is dried, more
Rationalize, also upper baffle can be exited by elastic driver, the protective capability of clothes is increased when raining.
Preferably, waterproof anti-corrosion coating is made up of following component and its parts by weight：18-37 parts of polyvinyl alcohol, hydroxyl
13-22 parts of alkyd resin, 17-28 parts of amino resins, 7-34 parts of epoxy resin, 0.1-0.4 parts of m-dinitrobenzene, Vinylidene Chloride tree
6-33 parts of fat, 2-12 parts of talcum powder, 1-5 parts of titanium dioxide, 0.2-1.3 parts of nano silicon, 2-10 parts of butyl silicate, film forming
0.3-4 parts of auxiliary agent, 0.2-0.7 parts of GMA, 0.1-0.3 parts of stabilizer, waterproof prepared by the formula are resistance to
Corrosion resistant coating can effectively play water-proof function of the dividing plate when working the rainy day, prevent dividing plate by the erosion of rainwater, moreover it is possible to block
Acid rain, prevents corrosion of the acidic materials to dividing plate, influences the effect of dividing plate, and waterproof anti-corrosion coating can also lift the heat-resisting of dividing plate
Ability, prevents dividing plate is exposed to the sun in summer dry and cracked, influences the using effect of device.
Wherein stabilizer is active peptides, and the amino acid sequence of active peptides is
TDHQMAQHCKLCVCVNCGAAKCRVLHPGLCVCKQDNAASAICHGGKTCEGICADATATRYSGPLSTVNAFHFRGEEN
VSYKVYGVAGCFYTHCGPNFCCCIS, the active peptides can make waterproof anti-corrosion coating have preferable photostability, prevent
Waterproof anti-corrosion coating produces cracking in the working environment of solar exposure, influences the effect of waterproof anti-corrosion coating, it is to avoid sun
The irradiation of light produces infringement to waterproof anti-corrosion coating.
Preferably, underlay screen face is provided with some cylindrical rollers, cylindrical roller is in movable connection, cylinder with dividing plate
Roller is located at the 70-80% of septum plate length, and upper baffle face is provided with square groove and lower section on some square grooves, upper baffle
The cylindrical roller of dividing plate is connected, and square groove two ends are provided with resilient rubbber cushion, is coordinated by cylindrical roller and square groove and slided,
Promotion of the elastic driver to dividing plate is aided in, the friction dynamics between dividing plate are reduced, improves and slides smoothness, cylindrical roller position
In the 70-80% of septum plate length, the dividing plate stretching area of top can be made larger.
Preferably, dividing plate both sides are connected by flexible connector with the support frame of clothes hanger both sides, flexible company can be passed through
The spacing between device regulation guard mechanism and clothes airing machine structure is connect, guard mechanism and clothes airing machine structure can be changed when sunlight angle is poor
Between spacing, increase clothes light-receiving area, and air amount of flow.
Preferably, being provided with clothes-horse in clothes airing machine structure in the middle of first rectangular frame, clothes-horse lower end is provided with telescope motor,
Telescope motor lower end is provided with disk, disk and is uniformly distributed some clothes hanger hooks, changes the position of disk by telescope motor, can
To change light-receiving area by lifting, and when raining by reducing the risk being caught in the rain between contraction.
Preferably, being provided with symmetrical parallel guide rail in clothes airing machine structure on the downside of first rectangular frame, guide rail is provided with some
Guide rail motor is connected with second rectangular frame, second rectangular frame is slided on guide rail by multiple guide rail motors, extension the
The position of two rectangular frames, makes it increase light-receiving area, it is ensured that clothes is irradiated by sunlight, and can increase extension clothing amount and keep away
Exempt from the overlapping clothes for causing to drip wet lower section of clothes.
Preferably, guide rail two ends are provided with scotch, rail length is 1.8-2.3 times of second rectangular frame length, if
When some scotch effectively can prevent that second rectangular frame from moving on guide rail, active force is excessive and can not stop in time, plus
Long guideway length makes second rectangular frame move distance farther, it is ensured that second rectangular frame sufficiently can be irradiated by sunlight.
Preferably, baroceptor, humidity sensor, light sensor are additionally provided with first rectangular frame, by many
Work is sensed while individual sensor, the change of observation weather, judges whether to rain according to different data reports, adopt in time
Collect data more comprehensive, solve prior art more single monitoring and error occur and shrink clothing without law technology to protect.
Preferably, the motor and sensor in clothes airing machine structure are by wire access controller, passing through sensor
Monitoring to parameters, and transmit in time to controller, then each motor and elastic driver are controlled by controller,
Clothes is contracted to below dividing plate, elongation dividing plate increase shielded area protection clothes, and controls flexible connector to make clothes close
Dividing plate strengthens rain cover ability.
Compared with prior art, beneficial effects of the present invention：
1st, the clothes hanger for this acid rain preventing intelligent control that the present invention is provided, has disposed each sensor, has been made by light sensor
Clothes airing machine structure on clothes hanger enables clothes to have larger light-receiving area, baroceptor, humidity sensor, raindrop to light is flexible
Sensor can sense the conversion of weather in time, clothes can be contracted in dividing plate in time prevent clothes it is wet fall；
2nd, the clothes hanger for this acid rain preventing intelligent control that the present invention is provided, the screening to rainwater is improved by the contractile function of dividing plate
Gear, is improved to the protectiveness of clothes, and can be dried in the air clothing in shading light part and light part according to the selection of the characteristic of clothes, and individual is passed through
The waterproof anti-corrosion layer that dividing plate is provided with keeps out the infringement of acid rain；
A kind of clothes hanger of acid rain preventing intelligent control is provided present invention employs above-mentioned technical proposal, prior art is compensate for not
Foot, it is reasonable in design, it is easy to operate.
Brief description of the drawings
Fig. 1 is structural representation of the invention；
Fig. 2 is clothes airing machine structure structural representation of the invention；
Fig. 3 is elastic activation configuration schematic diagram of the invention；
Fig. 4 is the structural representation of the dividing plate of the present invention.
Description of reference numerals：1st, guard mechanism；2nd, clothes airing machine structure；3rd, dividing plate；4th, elastic driver；5th, wire；6、
Controller；7th, support frame；8th, first rectangular frame；9th, second rectangular frame；10th, guide rail；11st, Raindrop sensor；12nd, stretch and connect
Connect device；13rd, clothes-horse；16th, guide rail motor；17th, steel wire cable；18th, baroceptor；19th, humidity sensor；20th, it is photosensitive to pass
Sensor.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
As Figure 1-4, a kind of clothes hanger of acid rain preventing intelligent control, including be fixed on balcony guard mechanism 1 and with screening
The clothes airing machine structure 2 that retaining device 1 is connected, if the upper end of guard mechanism 1 is made up of dried layer dividing plate 3, drives in dividing plate 3 provided with elastic
Dynamic device 4, elastic driver 4 is connected by wire 5 with controller 6, and the both sides of dividing plate 3 are provided with the branch with the both sides of clothes airing machine structure 2
Support 7 is connected, and the first rectangular frame 8 that clothes airing machine structure 2 is made up of some support bars is constituted with second rectangular frame 9, the first square
Connected between shape framework 8 and second rectangular frame 9 by guide rail 10.
Guard mechanism 1 is connected by two pieces of dividing plates 3 by guide rail 10, and dividing plate 3 is provided with Raindrop sensor 11, underlay screen 3
Light-shielding sheet is provided with, upper baffle 3 is connected with elastic driver 4, dividing plate 3 leads to provided with one layer of waterproof anti-corrosion coating
Cross light-shielding sheet and dividing plate 3 is divided into shading light part and light part, according to the material characteristic of clothes, may be selected to dry in the shade or shine
It is dry, more rationalize, also upper baffle 3 can be exited by elastic driver 4, the protection energy of clothes is increased when raining
Power.
Waterproof anti-corrosion coating is made up of following component and its parts by weight：18 parts of polyvinyl alcohol, 13 parts of hydroxyl alkyd resinses,
28 parts of amino resins, 34 parts of epoxy resin, 0.4 part of m-dinitrobenzene, 21 parts of superchlorinated polyvinyl chloride resin, 6 parts of talcum powder, titanium dioxide 1
Part, 1.3 parts of nano silicon, 8 parts of butyl silicate, 2 parts of coalescents, 0.4 part of GMA, stably
0.1 part of agent, waterproof anti-corrosion coating prepared by the formula can effectively play water-proof function of the dividing plate 3 when working the rainy day, prevent
Only dividing plate 3 is by the erosion of rainwater, moreover it is possible to block acid rain, prevents corrosion of the acidic materials to dividing plate 3, influences the effect of dividing plate 3, prevents
Water corrosion-resistant finishes can also lift the temperature capacity of dividing plate 3, prevent dividing plate 3 is exposed to the sun in summer dry and cracked, the use effect of influence device
Really.
Wherein stabilizer is active peptides, and the amino acid sequence of active peptides is
TDHQMAQHCKLCVCVNCGAAKCRVLHPGLCVCKQDNAASAICHGGKTCEGICADATATRYSGPLSTVNAFHFRGEEN
VSYKVYGVAGCFYTHCGPNFCCCIS, the active peptides can make waterproof anti-corrosion coating have preferable photostability, prevent
Waterproof anti-corrosion coating produces cracking in the working environment of solar exposure, influences the effect of waterproof anti-corrosion coating, it is to avoid sun
The irradiation of light produces infringement to waterproof anti-corrosion coating.
The face of underlay screen 3 is provided with some cylindrical rollers, and cylindrical roller is in movable connection, cylindrical roller position with dividing plate 3
In the 70-80% of the length of dividing plate 3, the face of upper baffle 3 is provided with square groove and underlay screen on some square grooves, upper baffle 3
3 cylindrical roller is connected, and square groove two ends are provided with resilient rubbber cushion, is coordinated by cylindrical roller and square groove and slided, auxiliary
Promotion of the elastic driver 4 to dividing plate 3 is helped, the friction dynamics between dividing plate 3 are reduced, improves and slides smoothness, cylindrical roller
Positioned at the 70-80% of septum plate length, the stretching area of dividing plate 3 of top can be made larger.
The both sides of dividing plate 3 are connected by flexible connector 12 with the support frame 7 of clothes hanger both sides, can pass through the connector 12 that stretches
The spacing between guard mechanism 1 and clothes airing machine structure 2 is adjusted, guard mechanism 1 and clothes airing machine structure 2 can be changed when sunlight angle is poor
Between spacing, increase clothes light-receiving area, and air amount of flow.
Clothes-horse 13 is provided with clothes airing machine structure 2 in the middle of first rectangular frame 8, the lower end of clothes-horse 13 is provided with telescope motor 14,
The lower end of telescope motor 14 is provided with disk 15, disk 15 and is uniformly distributed some clothes hanger hooks, and disk is changed by telescope motor 14
15 position, can change light-receiving area by lifting, and when raining by reducing the risk being caught in the rain between contraction.
The downside of first rectangular frame 8 is provided with symmetrical parallel guide rail 10 in clothes airing machine structure 2, and guide rail 10 is provided with guide rail motor
16 are connected with second rectangular frame 9, second rectangular frame 9 is slided on guide rail 10 by guide rail motor 16, extend the second square
The position of shape framework 9, makes it increase light-receiving area, it is ensured that clothes is irradiated by sunlight, and can increase extension clothing amount and avoid
The overlapping clothes for causing to drip wet lower section of clothes.
The two ends of guide rail 10 are provided with scotch, and the length of guide rail 10 is 1.8-2.3 times of the length of second rectangular frame 9, is provided with
When scotch can effectively prevent that second rectangular frame 9 from moving on guide rail 10, active force is excessive and can not stop in time, lengthens
The length of guide rail 10 makes the move distance of second rectangular frame 9 farther, it is ensured that second rectangular frame 9 sufficiently can be shone by sunlight
Penetrate.
Baroceptor 18, humidity sensor 19, light sensor 20 are additionally provided with first rectangular frame 8, by multiple
Work is sensed while sensor, the change of observation weather, judges whether to rain according to different data reports in time, gathers
Data are more comprehensive, solve prior art more single monitoring and error occur and shrink clothing without law technology to protect.
Motor and sensor in clothes airing machine structure 2 are by the access controller 6 of wire 5, by sensor to each
The monitoring of parameter, and transmit in time to controller 6, then each motor and elastic driver 4 are controlled by controller 6, will
Clothes is contracted to the lower section of dividing plate 3, the elongation increase shielded area protection clothes of dividing plate 3, and controls flexible connector 12 to lean on clothes
The nearly enhancing of dividing plate 3 rain cover ability.
Embodiment 2：
As Figure 1-3, a kind of clothes hanger of acid rain preventing intelligent control, during real work, after people, which are in, washes clothing,
By the flexible connector 12 of the operating of controller 6, clothes airing machine structure 2 is fallen, clothes is hung on according to the judgement of operating personnel and dried in the air
On the clothes hanger hook of clothing mechanism 2, the clothing dried in the shade is hung in the first rectangular frame 8 of clothes airing machine structure 2, it would be desirable to which sunlight shines
The clothes penetrated is hung in second rectangular frame 9, is finished when hanging, and is risen clothing by flexible connector 12, according to the
The sensing sunlight of light sensor 20 on one rectangular frame 8, the sensing ambient air pressure situation of baroceptor 18, humidity sensor 19
Sensing control in humidity condition, whether Raindrop sensor 11 is sensed rains, when the light sensing of light sensor 20 is preferable and
The control of controller 6 electrode of guide rail 10 prolongs second rectangular frame 9 by guide rail 10 when remaining sensor is under normal condition
Stretch, enable stretching in the increase light-receiving area that the clothing being hung in second rectangular frame 9 is larger, first rectangular frame 8
Contracting motor 14 can adjust the height of disk 15, clothing is divulged information under the situation dried in the shade smooth, improve the drying time of clothes, the
With one layer of light-shielding sheet on the dividing plate 3 of the top of one rectangular frame 8, it can guarantee that clothes that some needs dry in the shade not by the sudden and violent of the sun
Shine, light-shielding sheet also can be according to demand 80% or 70% or 50% etc. with changing shading rate into, when light sensor 20 senses no light
When, drive guide rail motor 16 to withdraw second rectangular frame 9 by controller 6, the length of guide rail 10 is the two of second rectangular frame 9
Second rectangular frame 9 is set effectively to be irradiated by sunlight again, guide rail 10 passes through four rectangle frames of guide rail motor 16 and second
Frame 9 is connected, and improves smoothness when second rectangular frame 9 is moved on guide rail 10, and ensure guide rail 10 to second rectangular frame 9
Support force, controller 6 control telescope motor 14 disk 15 is resetted, wait operating personnel collect clothing, work as humidity sensor
19 and baroceptor 18 when reacting, controller 6 can control the elastic driver 4 of the side of dividing plate 3 to work, by top
Dividing plate 3 be pushed into out, the dividing plate 3 of top passes through cylindrical roller in push between the dividing plate 3 of top and the dividing plate 3 of lower section
Coordinate with square groove, reduce the frictional force between dividing plate 3, reduce the active force of elastic driver 4, dividing plate is released and played
Rainy effect is prevented, releases and obtains 3 implementations of dividing plate using safety glass material, be of course not solely limited to safety glass
Material, can be released the also permeable glass of sunlight after dividing plate 3 when that may occur to rain and is shone with plastics, metal, textile product etc.
On the clothes for being incident upon second rectangular frame 9, when the Raindrop sensor 11 on dividing plate 3 reacts, the control guide rail of controller 6 motor 16
Second rectangular frame 9 is withdrawn, and controls telescope motor 14 to withdraw disk 15, prevents clothes to be soaked with rain, is additionally provided with dividing plate 3
Waterproof anti-corrosion coating, the product of the present invention can be used to acid rain take place frequently area, and the waterproof anti-corrosion coating of the use of dividing plate 3 can
Prevent the infringement of acid rain.
The prior art of routine techniques dawn known to those skilled in the art in above-described embodiment, thus it is no longer detailed herein
Description.
Specific embodiment described herein is only to present invention explanation for example.The technical field of the invention
Technical staff can be made various modifications or supplement to described specific embodiment or be substituted using similar mode, but
Without departing from the present invention's or surmount scope defined in appended claims.
SEQUENCE LISTING
<110>Ningbo Qi Chen Electronic Science and Technology Co., Ltd.s
<120>A kind of clothes hanger of acid rain preventing intelligent control
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 102
<212> PRT
<213>It is artificial synthesized
<400> 1
Thr Asp His Gln Met Ala Gln His Cys Lys Leu Cys Val Cys Val Asn
1 5 10 15
Cys Gly Ala Ala Lys Cys Arg Val Leu His Pro Gly Leu Cys Val Cys
20 25 30
Lys Gln Asp Asn Ala Ala Ser Ala Ile Cys His Gly Gly Lys Thr Cys
35 40 45
Glu Gly Ile Cys Ala Asp Ala Thr Ala Thr Arg Tyr Ser Gly Pro Leu
50 55 60
Ser Thr Val Asn Ala Phe His Phe Arg Gly Glu Glu Asn Val Ser Tyr
65 70 75 80
Lys Val Tyr Gly Val Ala Gly Cys Phe Tyr Thr His Cys Gly Pro Asn
85 90 95
Phe Cys Cys Cys Ile Ser
100
Claims (10)
1. a kind of clothes hanger of acid rain preventing intelligent control, including it is fixed on the guard mechanism of balcony（1）And and guard mechanism
（1）The clothes airing machine structure of connection（2）, it is characterised in that the guard mechanism（1）If upper end passes through dried layer dividing plate（3）Composition, dividing plate
（3）It is interior to be provided with elastic driver（4）, elastic driver（4）Pass through wire（5）With controller（6）Connection, dividing plate
（3）Both sides are provided with and clothes airing machine structure（2）The support frame of both sides（7）Connection, clothes airing machine structure（2）First be made up of some support bars
Rectangular frame（8）With second rectangular frame（9）Composition, first rectangular frame（8）With second rectangular frame（9）Between pass through guide rail
（10）Connection.
2. a kind of clothes hanger of acid rain preventing intelligent control according to claim 1, it is characterised in that the guard mechanism
（1）By two pieces of dividing plates（3）Pass through guide rail（10）Connection, dividing plate（3）It is provided with Raindrop sensor（11）, underlay screen（3）On set
There are light-shielding sheet, upper baffle（3）With elastic driver（4）Connection, dividing plate（3）Provided with one layer of waterproof anti-corrosion coating.
3. a kind of clothes hanger of acid rain preventing intelligent control according to claim 2, it is characterised in that the waterproof anti-corrosion
Coating is made up of following component and its parts by weight：18-37 parts of polyvinyl alcohol, 13-22 parts of hydroxyl alkyd resinses, amino resins 17-
28 parts, 7-34 parts of epoxy resin, 0.1-0.4 parts of m-dinitrobenzene, 6-33 parts of superchlorinated polyvinyl chloride resin, 2-12 parts of talcum powder, titanium white
1-5 parts of powder, 0.2-1.3 parts of nano silicon, 2-10 parts of butyl silicate, 0.3-4 parts of coalescents, Glycidyl methacrylate
0.2-0.7 parts of glyceride, 0.1-0.3 parts of stabilizer.
4. a kind of clothes hanger of acid rain preventing intelligent control according to claim 2, it is characterised in that the underlay screen
（3）Face is provided with some cylindrical rollers, cylindrical roller and dividing plate（3）In movable connection, cylindrical roller is located at dividing plate（3）Length
70-80%, upper baffle（3）Face is provided with some square grooves, upper baffle（3）On square groove and underlay screen（3）Circle
Post roller is connected, and square groove two ends are provided with resilient rubbber cushion.
5. a kind of clothes hanger of acid rain preventing intelligent control according to claim 1, it is characterised in that the dividing plate（3）Two
Side passes through the connector that stretches（12）With the support frame of clothes hanger both sides（7）Connection.
6. a kind of clothes hanger of acid rain preventing intelligent control according to claim 1, it is characterised in that the clothes airing machine structure
（2）Middle first rectangular frame（8）Centre is provided with clothes-horse（13）, clothes-horse（13）Lower end is provided with telescope motor（14）, stretch electricity
Machine（14）Lower end is provided with disk（15）, disk（15）On be uniformly distributed some clothes hanger hooks.
7. a kind of clothes hanger of acid rain preventing intelligent control according to claim 1, it is characterised in that the clothes airing machine structure
（2）Middle first rectangular frame（8）Downside is provided with symmetrical parallel guide rail（10）, guide rail（10）It is provided with some guide rail motors（16）
With second rectangular frame（9）Connection.
8. the clothes hanger of a kind of acid rain preventing intelligent control according to claim 7, it is characterised in that the guide rail two ends are set
There is scotch, rail length is 1.8-2.3 times of second rectangular frame length.
9. a kind of clothes hanger of acid rain preventing intelligent control according to claim 1, it is characterised in that first rectangle frame
Frame（8）On be additionally provided with baroceptor（18）, humidity sensor（19）, light sensor（20）.
10. a kind of clothes hanger of acid rain preventing intelligent control according to claim 1, it is characterised in that the clothes airing machine structure
（2）Interior motor and sensor passes through wire（5）Access controller（6）It is interior.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710393323.5A CN107268245A (en) | 2017-05-27 | 2017-05-27 | A kind of clothes hanger of acid rain preventing intelligent control |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710393323.5A CN107268245A (en) | 2017-05-27 | 2017-05-27 | A kind of clothes hanger of acid rain preventing intelligent control |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107268245A true CN107268245A (en) | 2017-10-20 |
Family
ID=60064864
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710393323.5A Pending CN107268245A (en) | 2017-05-27 | 2017-05-27 | A kind of clothes hanger of acid rain preventing intelligent control |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107268245A (en) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107938272A (en) * | 2018-01-11 | 2018-04-20 | 翁毅 | Clothes hanger and its control system |
| CN108221307A (en) * | 2018-03-28 | 2018-06-29 | 吴芷婧 | A kind of clothes hanger |
| CN108660708A (en) * | 2018-05-29 | 2018-10-16 | 大连民族大学 | Convolution Intelligent balcony escaping clothes hanger |
| CN109696865A (en) * | 2018-12-19 | 2019-04-30 | 重庆秉为科技有限公司 | A kind of clothes hanger control system based on smart home |
| CN113557891A (en) * | 2021-06-03 | 2021-10-29 | 重庆市荣昌区林业科学技术推广站 | Seedling growing rack for planting thornless pepper |
| CN117838897A (en) * | 2024-03-06 | 2024-04-09 | 泉州市双羽服饰股份有限公司 | Uniform batch sterilization and degerming equipment and use method thereof |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH08209541A (en) * | 1995-01-31 | 1996-08-13 | Showa Denko Kk | Waterproof moisture-permeable processing agent having dew condensation preventing function and textile cloth processed with the agent |
| CN203113111U (en) * | 2013-02-27 | 2013-08-07 | 河海大学常州校区 | Rainproof stretchable clothes drying device |
| CN204589665U (en) * | 2015-04-13 | 2015-08-26 | 佛山市南海加伦电机有限公司 | Clothes hanger |
| CN205242118U (en) * | 2015-12-17 | 2016-05-18 | 三明学院 | Multi -functional intelligence clothes hanger that dries in air |
| CN106243943A (en) * | 2016-08-22 | 2016-12-21 | 广东纳路纳米科技有限公司 | A kind of modified white graphite alkene composite anticorrosion coating and preparation thereof |
-
2017
- 2017-05-27 CN CN201710393323.5A patent/CN107268245A/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH08209541A (en) * | 1995-01-31 | 1996-08-13 | Showa Denko Kk | Waterproof moisture-permeable processing agent having dew condensation preventing function and textile cloth processed with the agent |
| CN203113111U (en) * | 2013-02-27 | 2013-08-07 | 河海大学常州校区 | Rainproof stretchable clothes drying device |
| CN204589665U (en) * | 2015-04-13 | 2015-08-26 | 佛山市南海加伦电机有限公司 | Clothes hanger |
| CN205242118U (en) * | 2015-12-17 | 2016-05-18 | 三明学院 | Multi -functional intelligence clothes hanger that dries in air |
| CN106243943A (en) * | 2016-08-22 | 2016-12-21 | 广东纳路纳米科技有限公司 | A kind of modified white graphite alkene composite anticorrosion coating and preparation thereof |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107938272A (en) * | 2018-01-11 | 2018-04-20 | 翁毅 | Clothes hanger and its control system |
| CN108221307A (en) * | 2018-03-28 | 2018-06-29 | 吴芷婧 | A kind of clothes hanger |
| CN108660708A (en) * | 2018-05-29 | 2018-10-16 | 大连民族大学 | Convolution Intelligent balcony escaping clothes hanger |
| CN109696865A (en) * | 2018-12-19 | 2019-04-30 | 重庆秉为科技有限公司 | A kind of clothes hanger control system based on smart home |
| CN113557891A (en) * | 2021-06-03 | 2021-10-29 | 重庆市荣昌区林业科学技术推广站 | Seedling growing rack for planting thornless pepper |
| CN117838897A (en) * | 2024-03-06 | 2024-04-09 | 泉州市双羽服饰股份有限公司 | Uniform batch sterilization and degerming equipment and use method thereof |
| CN117838897B (en) * | 2024-03-06 | 2024-05-31 | 泉州市双羽服饰股份有限公司 | Uniform batch sterilization and degerming equipment and use method thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN107268245A (en) | A kind of clothes hanger of acid rain preventing intelligent control | |
| CN104674529B (en) | Self adaptation dry in the sun Intelligent clothes airing apparatus | |
| CN208650231U (en) | One kind can water discharging manhole cover capable of automatically hoisting | |
| CN206448071U (en) | A kind of Intellective airer | |
| CN111676673A (en) | Adjustable intelligent external clothes hanger device | |
| CN205934505U (en) | Formula intelligence electric airer irones | |
| CN209024830U (en) | A kind of two-sided tanning device based on chain drive | |
| CN110983729A (en) | Intelligent clothes airing device driven by worm gear and worm and based on machine vision | |
| CN111593537B (en) | Multifunctional typhoon-preventing and clothes-airing device and typhoon-preventing method thereof | |
| CN213508131U (en) | Energy-saving road construction attention device regulation and control device | |
| CN209941333U (en) | Intelligent clothes hanger | |
| JP3006789B1 (en) | Automatic rain shelter on a clothesline | |
| CN206706426U (en) | It is a kind of intelligently to receive the clothes hanger to put garments out in the sun | |
| CN209836608U (en) | Clothes hanger drying device based on single chip microcomputer control | |
| CN109653450A (en) | A kind of greening building energy saving roofing | |
| CN205558069U (en) | Roof structure of sunshade | |
| CN212199725U (en) | Worm and gear driven intelligent clothes airing device based on machine vision | |
| CN208594699U (en) | A kind of aluminum sunshade | |
| CN108049134A (en) | A kind of anti-riot airer of intelligence rainproof | |
| CN107287862A (en) | Intelligent balcony clothes hanger | |
| CN207062610U (en) | Intelligent balcony clothes hanger | |
| CN202744847U (en) | Automatic clothes airing rack | |
| CN201986854U (en) | Fully surrounded type umbrella | |
| CN208533182U (en) | A kind of automatic clothes pole | |
| CN217869606U (en) | Rain-proof clothes hanger |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171020 |
|
| RJ01 | Rejection of invention patent application after publication |